{ "conflicts": [], "coverage": { "cells": {}, "data_levels": {}, "single_method_states": [], "states": [], "techniques": [ "xray", "nmr_structure", "nmr_shifts", "saxs_sans", "force_spectroscopy", "af_prediction" ], "unmapped_evidence": 32 }, "curation": { "as_of": "", "curator": "none", "file": "", "status": "uncurated" }, "evidence": [ { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Cytochrome c (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1J3S", "evidence_id": "EV-PDB-1J3S-1", "mappings": [], "molecule_id": "P99999", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "1J3S", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1J3S" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution Structure of Reduced Recombinant Human Cytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MH0" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.3, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Cytochrome c (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2N3Y", "evidence_id": "EV-PDB-2N3Y-1", "mappings": [], "molecule_id": "P99999", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2N3Y", "doi": "10.1073/pnas.1618008114", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2N3Y" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "NMR structure of the Y48pCMF variant of human cytochrome c in its reduced state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Cytochrome c (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2N9I", "evidence_id": "EV-PDB-2N9I-1", "mappings": [], "molecule_id": "P99999", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2N9I", "doi": "10.1016/j.bbrc.2015.12.079", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2N9I" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution structure of reduced human cytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Cytochrome c (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2N9J", "evidence_id": "EV-PDB-2N9J-1", "mappings": [], "molecule_id": "P99999", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2N9J", "doi": "10.1016/j.bbrc.2015.12.079", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2N9J" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution structure of oxidized human cytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -180.15 }, "construct": { "description": "Cytochrome c (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3NWV", "evidence_id": "EV-PDB-3NWV-1", "mappings": [], "molecule_id": "P99999", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "3NWV", "doi": "10.1021/ja106328k", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3NWV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Human cytochrome c G41S" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "CYTOCHROME C (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3ZCF", "evidence_id": "EV-PDB-3ZCF-1", "mappings": [], "molecule_id": "P99999", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "3ZCF", "doi": "10.1042/BJ20130758", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3ZCF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of recombinant human cytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEC", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "CYTOCHROME C (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3ZOO", "evidence_id": "EV-PDB-3ZOO-1", "mappings": [], "molecule_id": "P99999", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "3ZOO", "doi": "10.1042/BJ20130758", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3ZOO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Y46F mutant of human cytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEC", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -180.15 }, "construct": { "description": "Cytochrome c (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5EXQ", "evidence_id": "EV-PDB-5EXQ-1", "mappings": [], "molecule_id": "P99999", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "5EXQ", "doi": "10.1042/BCJ20200793", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5EXQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Human cytochrome c Y48H" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Cytochrome c (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5O10", "evidence_id": "EV-PDB-5O10-1", "mappings": [], "molecule_id": "P99999", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.36 }, "provenance": { "deposit_id": "5O10", "doi": "10.1021/acs.biochem.7b00890", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5O10" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Y48H mutant of human cytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEC", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Cytochrome c (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5TY3", "evidence_id": "EV-PDB-5TY3-1", "mappings": [], "molecule_id": "P99999", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "5TY3", "doi": "10.1021/acs.biochem.7b00342", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5TY3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of K72A variant of Human Cytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Cytochrome c (chains A,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6DUJ", "evidence_id": "EV-PDB-6DUJ-1", "mappings": [], "molecule_id": "P99999", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.82202726164 }, "provenance": { "deposit_id": "6DUJ", "doi": "10.1021/acs.jpcb.9b05869", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6DUJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of A51V variant of Human Cytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -180.15 }, "construct": { "description": "Cytochrome c (chains A,B,C,D,E,F,G,H)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6ECJ", "evidence_id": "EV-PDB-6ECJ-1", "mappings": [], "molecule_id": "P99999", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "6ECJ", "doi": "10.1042/BCJ20200793", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6ECJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Human cytochrome c G41T" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Cytochrome c (chains A,C,E,G)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6XNK", "evidence_id": "EV-PDB-6XNK-1", "mappings": [], "molecule_id": "P99999", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.08 }, "provenance": { "deposit_id": "6XNK", "doi": "10.1021/jacs.2c08325", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6XNK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of dimeric K72A human cytochrome c alkaline conformer" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.8, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=25418", "evidence_id": "EV-BMRB-25418", "mappings": [], "molecule_id": "P99999", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr25418", "doi": "10.13018/BMR25418", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=25418" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Human Cytochrome c WT ferric form (oxidized)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.8, "salt_mM": null, "temperature_c": 14.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=25420", "evidence_id": "EV-BMRB-25420", "mappings": [], "molecule_id": "P99999", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr25420", "doi": "10.13018/BMR25420", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=25420" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Backbone 1H, 13C, and 15N Chemical Shift Assignments for the ferrous form of the G41S mutant of Human Cytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.8, "salt_mM": null, "temperature_c": 14.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=25422", "evidence_id": "EV-BMRB-25422", "mappings": [], "molecule_id": "P99999", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr25422", "doi": "10.13018/BMR25422", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=25422" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Backbone 1H, 13C, and 15N Chemical Shift Assignments for the ferric form of the G41S mutant of Human Cytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.3, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=25660", "evidence_id": "EV-BMRB-25660", "mappings": [], "molecule_id": "P99999", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr25660", "doi": "10.13018/BMR25660", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=25660" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "NMR structure of the Y48pCMF variant of human cytochrome c in its reduced state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.8, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=25907", "evidence_id": "EV-BMRB-25907", "mappings": [], "molecule_id": "P99999", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr25907", "doi": "10.13018/BMR25907", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=25907" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "solution structure of reduced human cytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.8, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=25908", "evidence_id": "EV-BMRB-25908", "mappings": [], "molecule_id": "P99999", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr25908", "doi": "10.13018/BMR25908", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=25908" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Solution structure of oxidized human cytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.3, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=26578", "evidence_id": "EV-BMRB-26578", "mappings": [], "molecule_id": "P99999", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr26578", "doi": "10.13018/BMR26578", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=26578" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "NMR Assignment of Homo sapiens cytochrome c in its oxidized state" }, { "conditions": { "applied_force_pn": null, "buffer": "Sodium phosphate buffer", "environment": "in_vitro", "ions": [], "ligands": [ "partner: SET nuclear proto-oncogene" ], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 16 nm.", "ph": 6.3, "salt_mM": null, "temperature_c": 10.0 }, "construct": { "description": "Cytochrome c with SET nuclear proto-oncogene", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDN87/", "evidence_id": "EV-SASBDB-SASDN87", "mappings": [], "molecule_id": "P99999", "observable": { "type": "radius_of_gyration", "uncertainty": 0.063, "unit": "nm", "value": 4.2 }, "provenance": { "deposit_id": "SASDN87", "doi": "10.1016/j.csbj.2022.07.009", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDN87/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "PP2A is activated by cytochrome c upon formation of a diffuse encounter complex with SET/TAF-Iβ" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_silico", "ions": [], "ligands": [], "notes": "Computed prediction; no experimental conditions.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "AlphaFold Monomer v2.0 pipeline, residues 1-105", "labels": [] }, "data_format": "mmCIF, PAE JSON", "data_level": "processed", "data_link": "https://alphafold.ebi.ac.uk/entry/P99999", "evidence_id": "EV-AFDB-AF-P99999-F1", "mappings": [], "molecule_id": "P99999", "observable": { "type": "plddt", "uncertainty": null, "unit": "pLDDT", "value": 97.94 }, "provenance": { "deposit_id": "AF-P99999-F1", "doi": null, "licence": "CC BY 4.0", "retrieved": "2026-10-19", "source": "AlphaFold DB", "url": "https://alphafold.ebi.ac.uk/entry/P99999" }, "reader": null, "source_kind": "computed", "technique": "af_prediction", "title": "AlphaFold DB prediction AF-P99999-F1" } ], "models": [], "molecule": { "components": [], "domains": [], "gene": "CYCS", "identifiers": { "genbank": null, "isoform": null, "nakb": null, "pdb": [], "rfam": null, "rnacentral": null, "uniprot": "P99999" }, "ligands": [ "heme c" ], "modifications": [ { "kind": "ptm", "name": "N-acetylglycine", "position": 2, "source": "UniProtKB" }, { "kind": "ptm", "name": "Phosphotyrosine", "position": 49, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-succinyllysine", "position": 56, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-acetyllysine; alternate", "position": 73, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-succinyllysine; alternate", "position": 73, "source": "UniProtKB" }, { "kind": "ptm", "name": "Phosphotyrosine", "position": 98, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-acetyllysine", "position": 100, "source": "UniProtKB" } ], "molecule_id": "P99999", "molecule_type": "protein", "name": "Cytochrome c", "organism": { "name": "Homo sapiens", "taxon_id": 9606 }, "provenance": { "deposit_id": "P99999", "doi": null, "licence": "CC BY 4.0 (UniProt)", "retrieved": "2026-10-19", "source": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P99999/entry" }, "sequence": "MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE", "sequence_length": 105 }, "molecule_id": "P99999", "states": [], "transitions": [] }