{ "conflicts": [], "coverage": { "cells": {}, "data_levels": {}, "single_method_states": [], "states": [], "techniques": [ "xray", "cryoem", "nmr_structure", "nmr_shifts", "saxs_sans", "force_spectroscopy", "integrative", "af_prediction" ], "unmapped_evidence": 708 }, "curation": { "as_of": "", "curator": "none", "file": "", "status": "uncurated" }, "evidence": [ { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1,Protein Jade-3 (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/11AF", "evidence_id": "EV-PDB-11AF-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "11AF", "doi": "10.1038/s41467-026-75379-w", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/11AF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of JADE3 PZP domain in complex with Histone H3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GENE FRAGMENT FOR HISTONE H3 (chains K,L)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1O9S", "evidence_id": "EV-PDB-1O9S-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "1O9S", "doi": "10.1038/NATURE01378", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1O9S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of a ternary complex of the human histone methyltransferase SET7/9" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.1, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 (chains P)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1Q3L", "evidence_id": "EV-PDB-1Q3L-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.64 }, "provenance": { "deposit_id": "1Q3L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1Q3L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Chromodomain Of HP1 Complexed With Histone H3 Tail Containing monomethyllysine 9." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/21ME", "evidence_id": "EV-PDB-21ME-5", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.58 }, "provenance": { "deposit_id": "21ME", "doi": "10.1038/s42003-026-10946-x", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/21ME" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of heterotypic CENP-A/H3 nucleosome isolated from human cells" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 tail (chains D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2B2T", "evidence_id": "EV-PDB-2B2T-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.45 }, "provenance": { "deposit_id": "2B2T", "doi": "10.1038/nature04290", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2B2T" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Tandem chromodomains of human CHD1 complexed with Histone H3 Tail containing trimethyllysine 4 and phosphothreonine 3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 (chains D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2B2U", "evidence_id": "EV-PDB-2B2U-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.95 }, "provenance": { "deposit_id": "2B2U", "doi": "10.1038/nature04290", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2B2U" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Tandem chromodomains of human CHD1 complexed with Histone H3 Tail containing trimethyllysine 4 and dimethylarginine 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 (chains D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2B2V", "evidence_id": "EV-PDB-2B2V-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.65 }, "provenance": { "deposit_id": "2B2V", "doi": "10.1038/nature04290", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2B2V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure analysis of human CHD1 chromodomains 1 and 2 bound to histone H3 resi 1-15 MeK4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 (chains D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2B2W", "evidence_id": "EV-PDB-2B2W-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "2B2W", "doi": "10.1038/nature04290", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2B2W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Tandem chromodomains of human CHD1 complexed with Histone H3 Tail containing trimethyllysine 4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "HISTONE H3 ACETYLPHOSPHOPEPTIDE (chains C,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2C1N", "evidence_id": "EV-PDB-2C1N-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2C1N", "doi": "10.1016/J.MOLCEL.2005.08.032", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2C1N" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Molecular basis for the recognition of phosphorylated and phosphoacetylated histone H3 by 14-3-3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "HISTONE H3 DIMETHYL-LYSINE 4 (chains B,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2CO0", "evidence_id": "EV-PDB-2CO0-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.25 }, "provenance": { "deposit_id": "2CO0", "doi": "10.1038/NSMB1119", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2CO0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "WDR5 and unmodified Histone H3 complex at 2.25 Angstrom" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2CV5", "evidence_id": "EV-PDB-2CV5-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "2CV5", "doi": "10.1093/nar/gki663", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2CV5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of human nucleosome core particle" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3(1-15)K4me2 peptide (chains P)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2FSA", "evidence_id": "EV-PDB-2FSA-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "2FSA", "doi": "10.1038/nature04802", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2FSA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of PHD finger-linker-bromodomain fragment of human BPTF in the H3(1-15)K4ME2 bound state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Histone peptide (chains B)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2KWK", "evidence_id": "EV-PDB-2KWK-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2KWK", "doi": "10.1038/nature09139", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2KWK" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution structures of the double PHD fingers of human transcriptional protein DPF3b bound to a H3 peptide wild type" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "14-meric peptide from 1Histone H3.1 (chains B)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2L75", "evidence_id": "EV-PDB-2L75-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2L75", "doi": "10.1074/jbc.M110.208207", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2L75" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution structure of CHD4-PHD2 in complex with H3K9me3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "histone tail H3 K9me3 (chains C)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2LBM", "evidence_id": "EV-PDB-2LBM-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2LBM", "doi": "10.1038/nsmb.2070", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2LBM" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution structure of the ADD domain of ATRX complexed with histone tail H3 1-15 K9me3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "H3K36me3 peptide (chains B)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2M0O", "evidence_id": "EV-PDB-2M0O-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2M0O", "doi": "10.1016/j.molcel.2012.11.026", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2M0O" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "The solution structure of human PHF1 in complex with H3K36me3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Histone H3 peptide (chains B)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2NDF", "evidence_id": "EV-PDB-2NDF-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2NDF", "doi": "10.1016/j.str.2016.05.023", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2NDF" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution NMR structures of AF9 yeats domain in complex with histon H3 acetylation at K18" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Histone H3 peptide (chains B)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2NDG", "evidence_id": "EV-PDB-2NDG-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2NDG", "doi": "10.1016/j.str.2016.05.023", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2NDG" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution NMR structures of AF9 yeats domain in complex with histone H3 crotonylation at K18" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NI", "OGA", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "synthetic peptide (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2OQ6", "evidence_id": "EV-PDB-2OQ6-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2OQ6", "doi": "10.1038/nature05971", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2OQ6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of JMJD2A complexed with histone H3 peptide trimethylated at Lys9" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NI", "OGA", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "histone 3 K9 monomethyl (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2OT7", "evidence_id": "EV-PDB-2OT7-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.135 }, "provenance": { "deposit_id": "2OT7", "doi": "10.1038/nature05971", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2OT7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of JMJD2A complexed with histone H3 peptide monomethylated at Lys9" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NI", "OGA", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "synthetic peptide (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2OX0", "evidence_id": "EV-PDB-2OX0-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "2OX0", "doi": "10.1038/nature05971", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2OX0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of JMJD2A complexed with histone H3 peptide dimethylated at Lys9" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "IPA", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "histone H3.1 (chains P)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2RI7", "evidence_id": "EV-PDB-2RI7-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "2RI7", "doi": "10.1016/j.molcel.2007.10.023", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2RI7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of PHD finger-linker-bromodomain Y17E mutant from human BPTF in the H3(1-9)K4ME2 bound state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Histone H3 (chains B)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2RR4", "evidence_id": "EV-PDB-2RR4-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2RR4", "doi": "10.1016/j.str.2010.06.012", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2RR4" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Complex structure of the zf-CW domain and the H3K4me3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "FDA", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "HISTONE H3.1 (chains E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2UXN", "evidence_id": "EV-PDB-2UXN-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.72 }, "provenance": { "deposit_id": "2UXN", "doi": "10.1038/NSMB1255", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2UXN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structural Basis of Histone Demethylation by LSD1 Revealed by Suicide Inactivation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -178.15 }, "construct": { "description": "HISTONE H3 (chains D,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2V83", "evidence_id": "EV-PDB-2V83-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "2V83", "doi": "10.1073/PNAS.0709170104", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2V83" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of RAG2-PHD finger in complex with H3K4me3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -178.15 }, "construct": { "description": "H3R2ME1K4ME3 PEPTIDE (chains D,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2V85", "evidence_id": "EV-PDB-2V85-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2V85", "doi": "10.1073/PNAS.0709170104", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2V85" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of RAG2-PHD finger in complex with H3R2me1K4me3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H3R2ME2SK4ME3 PEPTIDE (chains D,F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2V88", "evidence_id": "EV-PDB-2V88-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2V88", "doi": "10.1073/PNAS.0709170104", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2V88" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of RAG2-PHD finger in complex with H3R2me2sK4me2 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "HISTONE H3 (chains D,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2V89", "evidence_id": "EV-PDB-2V89-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "2V89", "doi": "10.1038/NATURE06431", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2V89" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of RAG2-PHD finger in complex with H3K4me3 peptide at 1.1A resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DTT", "DTU", "NA", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "HISTONE H3 (chains B,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2VNF", "evidence_id": "EV-PDB-2VNF-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.76 }, "provenance": { "deposit_id": "2VNF", "doi": "10.1074/JBC.M710020200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2VNF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "MOLECULAR BASIS OF HISTONE H3K4ME3 RECOGNITION BY ING4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3AFA", "evidence_id": "EV-PDB-3AFA-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "3AFA", "doi": "10.1073/pnas.1003064107", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3AFA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The human nucleosome structure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.3 (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3ASL", "evidence_id": "EV-PDB-3ASL-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.41 }, "provenance": { "deposit_id": "3ASL", "doi": "10.1073/pnas.1203701109", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3ASL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of UHRF1 in complex with histone tail" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3AYW", "evidence_id": "EV-PDB-3AYW-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.9 }, "provenance": { "deposit_id": "3AYW", "doi": "10.1021/bi201021h", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3AYW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Human Nucleosome Core Particle Containing H3K56Q mutation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3AZE", "evidence_id": "EV-PDB-3AZE-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "3AZE", "doi": "10.1021/bi201021h", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3AZE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Human Nucleosome Core Particle Containing H3K64Q mutation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3AZF", "evidence_id": "EV-PDB-3AZF-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "3AZF", "doi": "10.1021/bi201021h", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3AZF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Human Nucleosome Core Particle Containing H3K79Q mutation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3AZG", "evidence_id": "EV-PDB-3AZG-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "3AZG", "doi": "10.1021/bi201021h", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3AZG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Human Nucleosome Core Particle Containing H3K115Q mutation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3AZH", "evidence_id": "EV-PDB-3AZH-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.49 }, "provenance": { "deposit_id": "3AZH", "doi": "10.1021/bi201021h", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3AZH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Human Nucleosome Core Particle Containing H3K122Q mutation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3AZI", "evidence_id": "EV-PDB-3AZI-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "3AZI", "doi": "10.1021/bi201021h", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3AZI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Human Nucleosome Core Particle Containing H4K31Q mutation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3AZJ", "evidence_id": "EV-PDB-3AZJ-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.89 }, "provenance": { "deposit_id": "3AZJ", "doi": "10.1021/bi201021h", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3AZJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Human Nucleosome Core Particle Containing H4K44Q mutation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3AZK", "evidence_id": "EV-PDB-3AZK-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "3AZK", "doi": "10.1021/bi201021h", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3AZK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Human Nucleosome Core Particle Containing H4K59Q mutation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NI", "OGA", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3AVR", "evidence_id": "EV-PDB-3AVR-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.803 }, "provenance": { "deposit_id": "3AVR", "doi": "10.1101/gad.172296.111", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3AVR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Catalytic fragment of UTX/KDM6A bound with histone H3K27me3 peptide, N-oxyalylglycine, and Ni(II)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "DNA (cytosine-5)-methyltransferase 3A, Histone H3.1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3A1B", "evidence_id": "EV-PDB-3A1B-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.292 }, "provenance": { "deposit_id": "3A1B", "doi": "10.1038/embor.2009.218", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3A1B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the DNMT3A ADD domain in complex with histone H3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FAD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "HISTONE H3 PEPTIDE (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2X0L", "evidence_id": "EV-PDB-2X0L-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "2X0L", "doi": "10.1523/JNEUROSCI.5500-09.2010", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2X0L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of a neuro-specific splicing variant of human histone lysine demethylase LSD1." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "HISTONE H3 TAIL (chains P,R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2VPG", "evidence_id": "EV-PDB-2VPG-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "2VPG", "doi": "10.1016/J.MOLCEL.2008.03.011", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2VPG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Decoding of methylated histone H3 tail by the Pygo-BCL9 Wnt signaling complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "histone H3 peptide (chains B)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2LGG", "evidence_id": "EV-PDB-2LGG-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2LGG", "doi": "10.1038/cr.2011.123", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2LGG" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Structure of PHD domain of UHRF1 in complex with H3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Histone peptide (chains B)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2KWJ", "evidence_id": "EV-PDB-2KWJ-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2KWJ", "doi": "10.1038/nature09139", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2KWJ" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution structures of the double PHD fingers of human transcriptional protein DPF3 bound to a histone peptide containing acetylation at lysine 14" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "HISTONE H3 DIMETHYL-LYSINE 4 (chains P)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2CNX", "evidence_id": "EV-PDB-2CNX-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "2CNX", "doi": "10.1038/NSMB1119", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2CNX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "WDR5 and Histone H3 Lysine 4 dimethyl complex at 2.1 angstrom" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "HISTONE H3 ACETYLPHOSPHOPEPTIDE (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2C1J", "evidence_id": "EV-PDB-2C1J-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "2C1J", "doi": "10.1016/J.MOLCEL.2005.08.032", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2C1J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Molecular basis for the recognition of phosphorylated and phosphoacetylated histone H3 by 14-3-3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAH", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 (chains P,Q)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1PEG", "evidence_id": "EV-PDB-1PEG-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.59 }, "provenance": { "deposit_id": "1PEG", "doi": "10.1016/S1097-2765(03)00224-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1PEG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structural basis for the product specificity of histone lysine methyltransferases" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "HISTONE H3 PEPTIDE (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CT6", "evidence_id": "EV-PDB-1CT6-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "1CT6", "doi": "10.1021/bi001151h", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CT6" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "SOLUTION STRUCTURE OF CGGIRGERG IN CONTACT WITH THE MONOCLONAL ANTIBODY MAB 4X11, NMR, 11 STRUCTURES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "HISTONE H3 PEPTIDE (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CS9", "evidence_id": "EV-PDB-1CS9-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "1CS9", "doi": "10.1021/bi001151h", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CS9" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "SOLUTION STRUCTURE OF CGGIRGERA IN CONTACT WITH THE MONOCLONAL ANTIBODY MAB 4X11, NMR, 7 STRUCTURES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3AZM", "evidence_id": "EV-PDB-3AZM-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.89 }, "provenance": { "deposit_id": "3AZM", "doi": "10.1021/bi201021h", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3AZM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Human Nucleosome Core Particle Containing H4K79Q mutation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3AZN", "evidence_id": "EV-PDB-3AZN-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "3AZN", "doi": "10.1021/bi201021h", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3AZN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Human Nucleosome Core Particle Containing H4K91Q mutation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 N-terminal Peptide (chains P)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3B95", "evidence_id": "EV-PDB-3B95-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.99 }, "provenance": { "deposit_id": "3B95", "doi": "10.1038/nsmb.1384", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3B95" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "EuHMT1 (Glp) Ankyrin Repeat Domain (Structure 2)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -73.15 }, "construct": { "description": "H3K9(me)3 peptide (chains T)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3FDT", "evidence_id": "EV-PDB-3FDT-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "3FDT", "doi": "10.1074/jbc.M110.191411", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3FDT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the complex of human chromobox homolog 5 (CBX5) with H3K9(me)3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.3, "salt_mM": null, "temperature_c": -113.15 }, "construct": { "description": "Histone H3 (chains G,H,I)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3KMT", "evidence_id": "EV-PDB-3KMT-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.78 }, "provenance": { "deposit_id": "3KMT", "doi": "10.1073/pnas.1009911107", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3KMT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of vSET/SAH/H3 ternary complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -76.15 }, "construct": { "description": "Histone H3 (chains R,S,T)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3LQI", "evidence_id": "EV-PDB-3LQI-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.92 }, "provenance": { "deposit_id": "3LQI", "doi": "10.1016/j.cell.2010.05.016", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3LQI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of MLL1 PHD3-Bromo complexed with H3(1-9)K4me2 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -76.15 }, "construct": { "description": "Histone H3 (chains Q,T)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3LQJ", "evidence_id": "EV-PDB-3LQJ-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "3LQJ", "doi": "10.1016/j.cell.2010.05.016", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3LQJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of MLL1 PHD3-Bromo complexed with H3(1-9)K4me3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BTN", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": -76.15 }, "construct": { "description": "Histone H3.1 (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3O34", "evidence_id": "EV-PDB-3O34-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "3O34", "doi": "10.1038/nature09542", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3O34" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of TRIM24 PHD-Bromo complexed with H3(13-32)K23ac peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -76.15 }, "construct": { "description": "Histone H3.1 (chains E,F,G,H)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3O37", "evidence_id": "EV-PDB-3O37-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "3O37", "doi": "10.1038/nature09542", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3O37" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of TRIM24 PHD-Bromo complexed with H3(1-10)K4 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 peptide (chains P,Q,R,S)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3QO2", "evidence_id": "EV-PDB-3QO2-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.49 }, "provenance": { "deposit_id": "3QO2", "doi": "10.1016/j.jmb.2011.03.018", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3QO2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structural insights for MPP8 chromodomain interaction with histone H3 lysine 9" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NHE", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "peptide of histone 3 thioacetyl-lysine 9 (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3RIG", "evidence_id": "EV-PDB-3RIG-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "3RIG", "doi": "10.1126/science.1207861", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3RIG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Sirt5 is an NAD-dependent protein lysine demalonylase and desuccinylase" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NAD", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "peptide of histone 3 N-succinyl lysine 9 (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3RIY", "evidence_id": "EV-PDB-3RIY-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "3RIY", "doi": "10.1126/science.1207861", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3RIY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Sirt5 is an NAD-dependent protein lysine demalonylase and desuccinylase" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 (chains D,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SOU", "evidence_id": "EV-PDB-3SOU-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8001 }, "provenance": { "deposit_id": "3SOU", "doi": "10.1016/j.molcel.2011.07.006", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SOU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of UHRF1 PHD finger in complex with histone H3 1-9 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "histone 3 myristoyl lysine 9 peptide (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3U3D", "evidence_id": "EV-PDB-3U3D-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "3U3D", "doi": "10.1021/cb200230x", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3U3D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Plasmodium falciparum Sir2A preferentially hydrolyzes medium and long chain fatty acyl lysine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -76.15 }, "construct": { "description": "Histone H3.1 (chains I,J,K,L,M,N,O,P)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3U5O", "evidence_id": "EV-PDB-3U5O-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "3U5O", "doi": "10.1016/j.cell.2011.11.032", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3U5O" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the complex of TRIM33 PHD-Bromo and H3(1-22)K9me3K14acK18ac histone peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -76.15 }, "construct": { "description": "Histone H3.1 (chains I,J,K,L,M,N,O,P)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3U5P", "evidence_id": "EV-PDB-3U5P-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "3U5P", "doi": "10.1016/j.cell.2011.11.032", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3U5P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the complex of TRIM33 PHD-Bromo and H3(1-28)K9me3K14acK18acK23ac histone peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "N-terminal fragment of histone H3 (chains B,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3UEE", "evidence_id": "EV-PDB-3UEE-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.61 }, "provenance": { "deposit_id": "3UEE", "doi": "10.1091/mbc.E11-11-0904", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3UEE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of human Survivin K62A mutant bound to N-terminal histone H3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "N-terminal fragment of histone H3 (chains B,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3UEF", "evidence_id": "EV-PDB-3UEF-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.45 }, "provenance": { "deposit_id": "3UEF", "doi": "10.1091/mbc.E11-11-0904", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3UEF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of human Survivin bound to histone H3 (C2 space group)." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3W97", "evidence_id": "EV-PDB-3W97-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "3W97", "doi": "10.1016/j.fob.2013.08.007", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3W97" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Human Nucleosome Core Particle lacking H2B N-terminal region" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3W98", "evidence_id": "EV-PDB-3W98-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.42 }, "provenance": { "deposit_id": "3W98", "doi": "10.1016/j.fob.2013.08.007", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3W98" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Human Nucleosome Core Particle lacking H3.1 N-terminal region" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3W99", "evidence_id": "EV-PDB-3W99-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "3W99", "doi": "10.1016/j.fob.2013.08.007", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3W99" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Human Nucleosome Core Particle lacking H4 N-terminal region" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3WA9", "evidence_id": "EV-PDB-3WA9-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.07 }, "provenance": { "deposit_id": "3WA9", "doi": "10.1107/S090744491302252X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3WA9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The nucleosome containing human H2A.Z.1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3WAA", "evidence_id": "EV-PDB-3WAA-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "3WAA", "doi": "10.1107/S090744491302252X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3WAA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The nucleosome containing human H2A.Z.2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3WKJ", "evidence_id": "EV-PDB-3WKJ-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "3WKJ", "doi": "10.1107/S2053230X14004695", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3WKJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The nucleosome containing human TSH2B" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3X1S", "evidence_id": "EV-PDB-3X1S-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.805 }, "provenance": { "deposit_id": "3X1S", "doi": "10.1016/j.bbrc.2015.07.070", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3X1S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the nucleosome core particle" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3X1V", "evidence_id": "EV-PDB-3X1V-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.921 }, "provenance": { "deposit_id": "3X1V", "doi": "10.1016/j.bbrc.2015.07.070", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3X1V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of nucleosome core particle in the presence of histone variant involved in reprogramming" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "APR", "GOL", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "PEPTIDE (chains F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3ZG6", "evidence_id": "EV-PDB-3ZG6-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "3ZG6", "doi": "10.1038/NATURE12038", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3ZG6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The novel de-long chain fatty acid function of human sirt6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/43IE", "evidence_id": "EV-PDB-43IE-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.41 }, "provenance": { "deposit_id": "43IE", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/43IE" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of canonical human nucleosome in the presence of 1 mM magnesium chloride" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "HISTONE H3 PEPTIDE (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4A0J", "evidence_id": "EV-PDB-4A0J-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.803 }, "provenance": { "deposit_id": "4A0J", "doi": "10.1016/J.STR.2011.09.002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4A0J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Survivin bound to the phosphorylated N-terminal tail of histone H3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "HISTONE H3.1T (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4A7J", "evidence_id": "EV-PDB-4A7J-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "4A7J", "doi": "10.1038/NSMB.2209", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4A7J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Symmetric Dimethylation of H3 Arginine 2 is a Novel Histone Mark that Supports Euchromatin Maintenance" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "HISTONE H3 (chains B)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4BD3", "evidence_id": "EV-PDB-4BD3-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "4BD3", "doi": "10.1038/NSMB.2434", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4BD3" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Phf19 links methylated lysine 36 of histone H3 to regulation of Polycomb activity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "SAH", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "HISTONE H3.1 (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4C1Q", "evidence_id": "EV-PDB-4C1Q-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "4C1Q", "doi": "10.1016/J.CELREP.2013.08.035", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4C1Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the PRDM9 SET domain in complex with H3K4me2 and AdoHcy." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "HISTONE H3 PEPTIDE (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4A0N", "evidence_id": "EV-PDB-4A0N-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.743 }, "provenance": { "deposit_id": "4A0N", "doi": "10.1016/J.STR.2011.09.002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4A0N" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Survivin bound to the phosphorylated N-terminal tail of histone H3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/43IB", "evidence_id": "EV-PDB-43IB-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.84 }, "provenance": { "deposit_id": "43IB", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/43IB" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of canonical human nucleosome." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "TRS", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "HISTONE H3.1 (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3ZVY", "evidence_id": "EV-PDB-3ZVY-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "3ZVY", "doi": "10.1371/JOURNAL.PONE.0027599", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3ZVY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PHD finger of human UHRF1 in complex with unmodified histone H3 N- terminal tail" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3X1U", "evidence_id": "EV-PDB-3X1U-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.25 }, "provenance": { "deposit_id": "3X1U", "doi": "10.1016/j.bbrc.2015.07.070", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3X1U" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of nucleosome core particle in the presence of histone variants involved in reprogramming" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3X1T", "evidence_id": "EV-PDB-3X1T-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.808 }, "provenance": { "deposit_id": "3X1T", "doi": "10.1016/j.bbrc.2015.07.070", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3X1T" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of nucleosome core particle consisting of mouse testis specific histone variants H2aa and H2ba" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3W96", "evidence_id": "EV-PDB-3W96-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "3W96", "doi": "10.1016/j.fob.2013.08.007", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3W96" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Human Nucleosome Core Particle lacking H2A N-terminal region" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains Q)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3V43", "evidence_id": "EV-PDB-3V43-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.47 }, "provenance": { "deposit_id": "3V43", "doi": "10.1101/gad.188359.112", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3V43" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of MOZ" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "histone H3(1-10) peptide (chains P,Q)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3UIK", "evidence_id": "EV-PDB-3UIK-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.701 }, "provenance": { "deposit_id": "3UIK", "doi": "10.1016/j.str.2011.12.001", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3UIK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "crystal structure of human Survivin mutant K62Y/H80W in complex with H3(1-10) peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "histone H3(1-10) peptide (chains P,Q)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3UII", "evidence_id": "EV-PDB-3UII-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "3UII", "doi": "10.1016/j.str.2011.12.001", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3UII" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "crystal structure of human Survivin in complex with H3(1-10) peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "T3 phosphorylated H3(1-15) peptide (chains P,Q)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3UIG", "evidence_id": "EV-PDB-3UIG-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "3UIG", "doi": "10.1016/j.str.2011.12.001", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3UIG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "crystal structure of human Survivin in complex with T3 phosphorylated H3(1-15) peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -76.15 }, "construct": { "description": "Histone H3.1 (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3U5N", "evidence_id": "EV-PDB-3U5N-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "3U5N", "doi": "10.1016/j.cell.2011.11.032", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3U5N" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the complex of TRIM33 PHD-Bromo and H3(1-20)K9me3K14ac histone peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "08P", "NI", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "HISTONE 3 TAIL ANALOG (T11C Peptide) (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3U4S", "evidence_id": "EV-PDB-3U4S-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.15 }, "provenance": { "deposit_id": "3U4S", "doi": "10.1002/anie.201107833", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3U4S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Histone Lysine demethylase JMJD2A in complex with T11C peptide substrate crosslinked to N-oxalyl-D-cysteine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "NAD", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "histone 3 myristoyl lysine 9 peptide (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3U31", "evidence_id": "EV-PDB-3U31-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "3U31", "doi": "10.1021/cb200230x", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3U31" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Plasmodium falciparum Sir2A preferentially hydrolyzes medium and long chain fatty acyl lysine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SOW", "evidence_id": "EV-PDB-3SOW-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9501 }, "provenance": { "deposit_id": "3SOW", "doi": "10.1016/j.molcel.2011.07.006", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SOW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of UHRF1 PHD finger in complex with histone H3K4me3 1-9 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4", "UNX" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H3K79me3 (chains T)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3QJ6", "evidence_id": "EV-PDB-3QJ6-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "3QJ6", "doi": "10.1371/journal.pone.0018919", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3QJ6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The crystal structure of PWWP domain of human Hepatoma-derived growth factor 2 in complex with H3K79me3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -76.15 }, "construct": { "description": "Histone H3.1 (chains D,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3O35", "evidence_id": "EV-PDB-3O35-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.76 }, "provenance": { "deposit_id": "3O35", "doi": "10.1038/nature09542", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3O35" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of TRIM24 PHD-Bromo complexed with H3(23-31)K27ac peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "MG", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -73.15 }, "construct": { "description": "H3K4Me3 peptide (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3KQI", "evidence_id": "EV-PDB-3KQI-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.78 }, "provenance": { "deposit_id": "3KQI", "doi": "10.1074/jbc.C109.097667", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3KQI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "crystal structure of PHF2 PHD domain complexed with H3K4Me3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3AZL", "evidence_id": "EV-PDB-3AZL-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "3AZL", "doi": "10.1021/bi201021h", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3AZL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Human Nucleosome Core Particle Containing H4K77Q mutation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NI", "OGA", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "SYNTHESIZED methylation peptide (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4EZH", "evidence_id": "EV-PDB-4EZH-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.52 }, "provenance": { "deposit_id": "4EZH", "doi": "10.1038/nature11262", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4EZH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "the crystal structure of KDM6B bound with H3K27me3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "peptide from Histone H3.1 (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4F4U", "evidence_id": "EV-PDB-4F4U-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "4F4U", "doi": "10.1074/jbc.M112.384511", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4F4U" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The bicyclic intermediate structure provides insights into the desuccinylation mechanism of SIRT5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CGK", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "peptide from Histone H3.1 (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4F56", "evidence_id": "EV-PDB-4F56-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "4F56", "doi": "10.1074/jbc.M112.384511", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4F56" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The bicyclic intermediate structure provides insights into the desuccinylation mechanism of SIRT5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H3 peptide (chains P)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4FT2", "evidence_id": "EV-PDB-4FT2-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "4FT2", "doi": "10.1016/j.cell.2012.07.034", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4FT2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "crystal structure of Zea mays ZMET2 in complex H3(1-15)K9me2 peptide and SAH" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FAD", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -143.15 }, "construct": { "description": "Histone H3.1 (chains E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4FWF", "evidence_id": "EV-PDB-4FWF-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "4FWF", "doi": "10.1038/cr.2012.177", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4FWF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Complex structure of LSD2/AOF1/KDM1b with H3K4 mimic" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AKG", "NI", "NO3", "PDO", "SCN", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3 Peptide (chains F,G)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4HON", "evidence_id": "EV-PDB-4HON-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.799 }, "provenance": { "deposit_id": "4HON", "doi": "10.1016/j.str.2012.10.018", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4HON" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of human JMJD2D/KDM4D in complex with an H3K9me3 peptide and 2-oxoglutarate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "SAH", "UNX", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H3K9 NE-ALLYL PEPTIDE (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4I51", "evidence_id": "EV-PDB-4I51-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "4I51", "doi": "10.1073/pnas.1216365110", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4I51" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Methyltransferase domain of HUMAN EUCHROMATIC HISTONE METHYLTRANSFERASE 1, mutant Y1211A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 peptide (chains U)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4L7X", "evidence_id": "EV-PDB-4L7X-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "4L7X", "doi": "10.1016/j.celrep.2013.06.014", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4L7X" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the DIDO PHD finger in complex with H3K4me3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LK9", "evidence_id": "EV-PDB-4LK9-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "4LK9", "doi": "10.1093/nar/gkt931", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LK9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of MOZ double PHD finger histone H3 tail complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LKA", "evidence_id": "EV-PDB-4LKA-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.61 }, "provenance": { "deposit_id": "4LKA", "doi": "10.1093/nar/gkt931", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LKA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of MOZ double PHD finger histone H3K9ac complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LLB", "evidence_id": "EV-PDB-4LLB-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "4LLB", "doi": "10.1093/nar/gkt931", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LLB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of MOZ double PHD finger histone H3K14ac complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NI", "PD2", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H3 peptide (chains D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LXL", "evidence_id": "EV-PDB-4LXL-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.87 }, "provenance": { "deposit_id": "4LXL", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LXL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of JMJD2B complexed with pyridine-2,4-dicarboxylic acid and H3K9me3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 (chains P)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4QBQ", "evidence_id": "EV-PDB-4QBQ-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.406 }, "provenance": { "deposit_id": "4QBQ", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4QBQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of DNMT3a ADD domain bound to H3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 (chains E,P)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4QBR", "evidence_id": "EV-PDB-4QBR-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.902 }, "provenance": { "deposit_id": "4QBR", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4QBR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of DNMT3a ADD domain G550D mutant bound to H3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 (chains P)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4QBS", "evidence_id": "EV-PDB-4QBS-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "4QBS", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4QBS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of DNMT3a ADD domain E545R mutant bound to H3T3ph peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FE", "NO", "SIN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Peptide (chains E,F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4TN7", "evidence_id": "EV-PDB-4TN7-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "4TN7", "doi": "10.1101/gad.246561.114", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4TN7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of mouse KDM2A-H3K36ME-NO complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H3K9me3 (chains D,E,F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4U68", "evidence_id": "EV-PDB-4U68-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "4U68", "doi": "10.1038/cr.2015.10", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4U68" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Rhino chromodomain in complex with H3K9me3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "HISTONE H3.1 (chains F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4UP0", "evidence_id": "EV-PDB-4UP0-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.28 }, "provenance": { "deposit_id": "4UP0", "doi": "10.1021/CB500585S", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4UP0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ternary crystal structure of the Pygo2 PHD finger in complex with the B9L HD1 domain and a H3K4me2 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "HISTONE H3K4ME3 (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4UY4", "evidence_id": "EV-PDB-4UY4-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.862 }, "provenance": { "deposit_id": "4UY4", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4UY4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "1.86 A structure of human Spindlin-4 protein in complex with histone H3K4me3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "peptide THR-ALA-ARG-MYK-SER-THR-GLY (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4Y6L", "evidence_id": "EV-PDB-4Y6L-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "4Y6L", "doi": "10.1021/acs.biochem.5b00150", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4Y6L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Human SIRT2 in complex with myristoylated peptide (H3K9myr)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H3K9me3 peptide (chains P,Q)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4YHP", "evidence_id": "EV-PDB-4YHP-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.53 }, "provenance": { "deposit_id": "4YHP", "doi": "10.1073/pnas.1522691113", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4YHP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of 309M3-B Fab in complex with H3K9me3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4YM5", "evidence_id": "EV-PDB-4YM5-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.005 }, "provenance": { "deposit_id": "4YM5", "doi": "10.1038/srep16330", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4YM5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the human nucleosome containing 6-4PP (inside)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4YM6", "evidence_id": "EV-PDB-4YM6-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.514 }, "provenance": { "deposit_id": "4YM6", "doi": "10.1038/srep16330", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4YM6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the human nucleosome containing 6-4PP (outside)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "SO4", "UNX", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4Z0R", "evidence_id": "EV-PDB-4Z0R-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "4Z0R", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4Z0R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of the CW domain of ZCWPW2 mutant F78R in complex with histone H3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains G,I)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4Z2M", "evidence_id": "EV-PDB-4Z2M-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.981 }, "provenance": { "deposit_id": "4Z2M", "doi": "10.1101/gad.274183.115", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4Z2M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of human SPT16 Mid-AID/H3-H4 tetramer FACT Histone complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5AV5", "evidence_id": "EV-PDB-5AV5-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "5AV5", "doi": "10.1038/srep17204", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5AV5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "human nucleosome core particle" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5AV9", "evidence_id": "EV-PDB-5AV9-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "5AV9", "doi": "10.1038/srep17204", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5AV9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "human nucleosome core particle" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5AVB", "evidence_id": "EV-PDB-5AVB-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "5AVB", "doi": "10.1038/srep17204", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5AVB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "human nucleosome core particle" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5AVC", "evidence_id": "EV-PDB-5AVC-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "5AVC", "doi": "10.1038/srep17204", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5AVC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "human nucleosome core particle" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5B24", "evidence_id": "EV-PDB-5B24-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.6 }, "provenance": { "deposit_id": "5B24", "doi": "10.1016/j.bbrc.2016.01.170", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5B24" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The crystal structure of the nucleosome containing cyclobutane pyrimidine dimer" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5B31", "evidence_id": "EV-PDB-5B31-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "5B31", "doi": "10.1098/rsob.160127", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5B31" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The crystal structure of the heterotypic H2AZ/H2A nucleosome with H3.1." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H3 peptide (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5C11", "evidence_id": "EV-PDB-5C11-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.803 }, "provenance": { "deposit_id": "5C11", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5C11" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Jarid1a PHD finger bound to histone H3C4me3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H3 peptide (chains D,F,H,P)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5C13", "evidence_id": "EV-PDB-5C13-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.101 }, "provenance": { "deposit_id": "5C13", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5C13" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of TAF3 PHD finger bound to histone H3C4me3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains B,F,J,N,R,V)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5C3I", "evidence_id": "EV-PDB-5C3I-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.5 }, "provenance": { "deposit_id": "5C3I", "doi": "10.1007/s13238-015-0190-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5C3I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the quaternary complex of histone H3-H4 heterodimer with chaperone ASF1 and the replicative helicase subunit MCM2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5CPI", "evidence_id": "EV-PDB-5CPI-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.902 }, "provenance": { "deposit_id": "5CPI", "doi": "10.1098/rsob.150128", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5CPI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Nucleosome containing unmethylated Sat2R DNA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5CPJ", "evidence_id": "EV-PDB-5CPJ-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.15 }, "provenance": { "deposit_id": "5CPJ", "doi": "10.1098/rsob.150128", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5CPJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Nucleosome containing methylated Sat2R DNA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5CPK", "evidence_id": "EV-PDB-5CPK-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.632 }, "provenance": { "deposit_id": "5CPK", "doi": "10.1098/rsob.150128", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5CPK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Nucleosome containing methylated Sat2L DNA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 peptide (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5DAH", "evidence_id": "EV-PDB-5DAH-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.611 }, "provenance": { "deposit_id": "5DAH", "doi": "10.1016/j.molcel.2015.08.019", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5DAH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of PZP domain of human AF10 protein fused with Histone H3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Peptide from Histone H3 (chains D,F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5FB0", "evidence_id": "EV-PDB-5FB0-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.702 }, "provenance": { "deposit_id": "5FB0", "doi": "10.1074/jbc.M116.721159", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5FB0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of a PHD finger bound to histone H3 T3ph peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5FFV", "evidence_id": "EV-PDB-5FFV-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "5FFV", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5FFV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the bromodomain of human BRPF1 in complex with H3K14ac histone peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5GH9", "evidence_id": "EV-PDB-5GH9-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.451 }, "provenance": { "deposit_id": "5GH9", "doi": "10.1111/febs.14198", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5GH9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of CBP Bromodomain with H3K56ac peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MLI", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Peptide from Histone H3 (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5FB1", "evidence_id": "EV-PDB-5FB1-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "5FB1", "doi": "10.1074/jbc.M116.721159", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5FB1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of a PHD finger bound to histone H3 K9me3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "peptide H3K23me3 (19-28) (chains a,b,c,d)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5D6Y", "evidence_id": "EV-PDB-5D6Y-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.287 }, "provenance": { "deposit_id": "5D6Y", "doi": "10.1038/ncomms13387", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5D6Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of double tudor domain of human lysine demethylase KDM4A complexed with histone H3K23me3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5B2J", "evidence_id": "EV-PDB-5B2J-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "5B2J", "doi": "10.1002/2211-5463.12064", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5B2J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Human nucleosome containing CpG methylated DNA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5B2I", "evidence_id": "EV-PDB-5B2I-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "5B2I", "doi": "10.1002/2211-5463.12064", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5B2I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Human nucleosome containing CpG unmethylated DNA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5AV8", "evidence_id": "EV-PDB-5AV8-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "5AV8", "doi": "10.1038/srep17204", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5AV8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "human nucleosome core particle" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5AV6", "evidence_id": "EV-PDB-5AV6-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "5AV6", "doi": "10.1038/srep17204", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5AV6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "human nucleosome core particle" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H3K4me3 peptide (chains P)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4YHZ", "evidence_id": "EV-PDB-4YHZ-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.304 }, "provenance": { "deposit_id": "4YHZ", "doi": "10.1073/pnas.1522691113", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4YHZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of 304M3-B Fab in complex with H3K4me3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K", "NI" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H3K27me3 peptide (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4X3K", "evidence_id": "EV-PDB-4X3K-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "4X3K", "doi": "10.1016/j.chembiol.2014.11.021", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4X3K" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of chromobox homolog 7 (CBX7) chromodomain with H3K27me3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PEG", "PO4", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.3, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Peptide from Histone H3.1 (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4N4H", "evidence_id": "EV-PDB-4N4H-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.302 }, "provenance": { "deposit_id": "4N4H", "doi": "10.1038/nature13045", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4N4H" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the Bromo-PWWP of the mouse zinc finger MYND-type containing 11 isoform alpha in complex with histone H3.1K36me3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5GSE", "evidence_id": "EV-PDB-5GSE-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.14 }, "provenance": { "deposit_id": "5GSE", "doi": "10.1126/science.aak9867", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5GSE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of unusual nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5GSU", "evidence_id": "EV-PDB-5GSU-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "5GSU", "doi": "10.1016/j.bpc.2016.11.013", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5GSU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of nucleosome core particle consisting of human testis-specific histone variants, Th2A and Th2B" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5GT0", "evidence_id": "EV-PDB-5GT0-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.82 }, "provenance": { "deposit_id": "5GT0", "doi": "10.1016/j.bpc.2016.11.013", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5GT0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of nucleosome complex with human testis-specific histone variants, Th2a" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5GT3", "evidence_id": "EV-PDB-5GT3-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.91 }, "provenance": { "deposit_id": "5GT3", "doi": "10.1016/j.bpc.2016.11.013", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5GT3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of nucleosome particle in the presence of human testis-specific histone variant, hTh2b" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5GTC", "evidence_id": "EV-PDB-5GTC-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "5GTC", "doi": "10.1021/jacs.7b02138", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5GTC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of complex between DMAP-SH conjugated with a Kaposi's sarcoma herpesvirus LANA peptide (5-15) and nucleosome core particle" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FAD", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "peptide SRTMQTARKSTGGKAPRKQLK (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5H6Q", "evidence_id": "EV-PDB-5H6Q-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.53 }, "provenance": { "deposit_id": "5H6Q", "doi": "10.1016/j.bmc.2017.03.016", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5H6Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of LSD1-CoREST in complex with peptide 11" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "peptide of Histone H3.1 (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5HJB", "evidence_id": "EV-PDB-5HJB-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "5HJB", "doi": "10.1016/j.molcel.2016.03.028", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5HJB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "AF9 YEATS in complex with histone H3 Crotonylation at K9" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "peptide of Histone H3.1 (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5HJC", "evidence_id": "EV-PDB-5HJC-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "5HJC", "doi": "10.1016/j.molcel.2016.03.028", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5HJC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "BRD3 second bromodomain in complex with histone H3 acetylation at K18" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CU", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "peptide of Histone H3.1 (chains B,D,F,H,I,J,L,M)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5HJD", "evidence_id": "EV-PDB-5HJD-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.806 }, "provenance": { "deposit_id": "5HJD", "doi": "10.1016/j.molcel.2016.03.028", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5HJD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "AF9 YEATS in complex with histone H3 Crotonylation at K18" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAH", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H3K27M (chains D,I,O,T)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5HYN", "evidence_id": "EV-PDB-5HYN-4", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.95 }, "provenance": { "deposit_id": "5HYN", "doi": "10.1038/ncomms11316", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5HYN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Human Polycomb Repressive Complex 2 (PRC2) with oncogenic histone H3K27M peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5J3V", "evidence_id": "EV-PDB-5J3V-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.05 }, "provenance": { "deposit_id": "5J3V", "doi": "10.1016/j.str.2016.07.018", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5J3V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of human Karyopherin-beta2 bound to the histone H3 tail" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H3K27ac peptide from Histone H3.1 (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5J9S", "evidence_id": "EV-PDB-5J9S-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.702 }, "provenance": { "deposit_id": "5J9S", "doi": "10.1038/nature21687", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5J9S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ENL YEATS in complex with histone H3 acetylation at K27" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5JRG", "evidence_id": "EV-PDB-5JRG-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "5JRG", "doi": "10.1038/srep41783", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5JRG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the nucleosome containing the DNA with tetrahydrofuran (THF)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAM", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -180.15 }, "construct": { "description": "ALA-ALA-ARG-M3L-SER-ALA-PRO-ALA (chains D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KKL", "evidence_id": "EV-PDB-5KKL-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.94 }, "provenance": { "deposit_id": "5KKL", "doi": "10.1126/science.aaj2335", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KKL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of ctPRC2 in complex with H3K27me3 and H3K27M" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAM", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -180.15 }, "construct": { "description": "Putative uncharacterized protein,Histone H3.1 peptide,Zinc finger domain-containing protein (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KKL", "evidence_id": "EV-PDB-5KKL-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.94 }, "provenance": { "deposit_id": "5KKL", "doi": "10.1126/science.aaj2335", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KKL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of ctPRC2 in complex with H3K27me3 and H3K27M" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "2MR", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "ALA-ARG-THR-M3L-GLN-THR-ALA-2MR-LYS-SER (chains E,F,G,H)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5LUG", "evidence_id": "EV-PDB-5LUG-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5LUG", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5LUG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of human Spindlin-2B protein in complex with ART(M3L)QTA(2MR)KS peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5NNC", "evidence_id": "EV-PDB-5NNC-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.22 }, "provenance": { "deposit_id": "5NNC", "doi": "10.1016/j.molcel.2018.11.006", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5NNC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of the first bromodomain of human BRD4 in complex with a diacetylated histone 4 peptide (H3K9ac/K14ac)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 (chains D,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5NND", "evidence_id": "EV-PDB-5NND-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.82 }, "provenance": { "deposit_id": "5NND", "doi": "10.1016/j.molcel.2018.11.006", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5NND" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of the first bromodomain of human BRD4 in complex with a diacetylated histone 4 peptide (H3K9ac/K14ac)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H3K4me3 (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5SVX", "evidence_id": "EV-PDB-5SVX-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.56 }, "provenance": { "deposit_id": "5SVX", "doi": "10.1016/j.celrep.2016.08.050", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5SVX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "MORC3 CW in complex with histone H3K4me3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H3K4me1 (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5SVY", "evidence_id": "EV-PDB-5SVY-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.05 }, "provenance": { "deposit_id": "5SVY", "doi": "10.1016/j.celrep.2016.08.050", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5SVY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "MORC3 CW in complex with histone H3K4me1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MPD", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 tail peptide (chains H)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5SZC", "evidence_id": "EV-PDB-5SZC-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.193 }, "provenance": { "deposit_id": "5SZC", "doi": "10.1038/s41588-017-0015-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5SZC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of human Dpf3 double-PHD domain bound to histone H3 tail peptide with monomethylated K4 and acetylated K14" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "PO4", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains E,G)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5T8R", "evidence_id": "EV-PDB-5T8R-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "5T8R", "doi": "10.1042/BCJ20161053", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5T8R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of human BAZ2A PHD zinc finger in complex with unmodified H3 10-mer" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5TDR", "evidence_id": "EV-PDB-5TDR-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.42 }, "provenance": { "deposit_id": "5TDR", "doi": "10.1016/j.jmb.2016.09.020", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5TDR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Set3 PHD finger in complex with histone H3K4me2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAM", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3K36M peptide (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5V21", "evidence_id": "EV-PDB-5V21-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.415 }, "provenance": { "deposit_id": "5V21", "doi": "10.1038/srep43906", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5V21" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of human SETD2 SET-domain in complex with H3K36M peptide and SAM" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5VA6", "evidence_id": "EV-PDB-5VA6-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "5VA6", "doi": "10.1093/nar/gkx224", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5VA6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF ATXR5 IN COMPLEX WITH HISTONE H3.1 MONO-METHYLATED ON R26" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 peptide (chains F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5VAB", "evidence_id": "EV-PDB-5VAB-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.702 }, "provenance": { "deposit_id": "5VAB", "doi": "10.1093/nar/gkx224", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5VAB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of ATXR5 PHD domain in complex with histone H3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "ARG-TYR-ARG-PRO-GLY-THR-VAL-ALA-LEU (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5VGE", "evidence_id": "EV-PDB-5VGE-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "5VGE", "doi": "10.1038/ncomms15924", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5VGE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of HLA-C*07:02 in complex with RYR peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.4, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "H3K23acK27ac peptide (chains K)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5VNB", "evidence_id": "EV-PDB-5VNB-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "5VNB", "doi": "10.1021/acschembio.8b00674", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5VNB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "YEATS in complex with histone H3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A97", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -180.0 }, "construct": { "description": "Histone H3.1 (chains D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5WFC", "evidence_id": "EV-PDB-5WFC-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.282 }, "provenance": { "deposit_id": "5WFC", "doi": "10.1038/s41598-018-27175-w", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5WFC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Humanized mutant of the Chaetomium thermophilum Polycomb Repressive Complex 2 bound to the inhibitor GSK343" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H3K4me3 Peptide (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5WLE", "evidence_id": "EV-PDB-5WLE-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.952 }, "provenance": { "deposit_id": "5WLE", "doi": "10.1016/j.str.2017.08.009", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5WLE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the PPS PHD finger in complex with H3K4me3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3K4ac (chains P)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5WXG", "evidence_id": "EV-PDB-5WXG-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.703 }, "provenance": { "deposit_id": "5WXG", "doi": "10.1073/pnas.1704155114", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5WXG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of TAF PHD finger domain binds to H3(1-15)K4ac" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -180.15 }, "construct": { "description": "Histone H3.1 (chains D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5WVO", "evidence_id": "EV-PDB-5WVO-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.997 }, "provenance": { "deposit_id": "5WVO", "doi": "10.1016/j.molcel.2017.09.037", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5WVO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of DNMT1 RFTS domain in complex with K18/K23 mono-ubiquitylated histone H3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAH", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3K36M peptide (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5V22", "evidence_id": "EV-PDB-5V22-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "5V22", "doi": "10.1038/srep43906", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5V22" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of human SETD2 SET-domain in complex with H3K36M peptide and SAH" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3K14bu (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5U2J", "evidence_id": "EV-PDB-5U2J-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "5U2J", "doi": "10.1016/j.str.2017.02.003", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5U2J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "MORF double PHD finger (DPF) in complex with histone H3K14bu" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "histone H3K4me3 (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5TDW", "evidence_id": "EV-PDB-5TDW-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5TDW", "doi": "10.1016/j.jmb.2016.09.020", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5TDW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Set3 PHD finger in complex with histone H3K4me3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Histone H3.1 (chains C)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5TBN", "evidence_id": "EV-PDB-5TBN-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "5TBN", "doi": "10.1016/j.celrep.2016.09.056", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5TBN" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution NMR structure of PHF20 PHD domain in complex with a histone H3K4me2 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "UNX" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5T1I", "evidence_id": "EV-PDB-5T1I-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "5T1I", "doi": "10.1074/jbc.M116.768374", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5T1I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CBX3 chromo shadow domain in complex with histone H3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "UNX" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5T1G", "evidence_id": "EV-PDB-5T1G-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "5T1G", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5T1G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "chromo shadow domain of CBX1 in complex with a histone peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAH", "SAM", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "THR-LYS-GLN-THR-ALA-ARG-NLE-SER-THR-GLY (chains C,P)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5T0M", "evidence_id": "EV-PDB-5T0M-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.896 }, "provenance": { "deposit_id": "5T0M", "doi": "10.7554/eLife.17903", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5T0M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "A histone H3K9M mutation traps histone methyltransferase Clr4 to prevent heterochromatin spreading" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAM", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H3K9 mutant peptide (chains P,Q)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5T0K", "evidence_id": "EV-PDB-5T0K-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5T0K", "doi": "10.7554/eLife.17903", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5T0K" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of G9a SET-domain with H3K9M mutant peptide and SAM" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MPD", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 tail peptide (chains H)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5SZB", "evidence_id": "EV-PDB-5SZB-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "5SZB", "doi": "10.1038/s41588-017-0015-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5SZB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of human Dpf3 double-PHD domain bound to histone H3 tail peptide with acetylated K14" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AKG", "EDO", "FE", "TBU", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -193.15 }, "construct": { "description": "Histone 3 peptide H3(17-33)A21M (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5OY3", "evidence_id": "EV-PDB-5OY3-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.136 }, "provenance": { "deposit_id": "5OY3", "doi": "10.1021/acs.biochem.7b01152", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5OY3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The structural basis of the histone demethylase KDM6B histone 3 lysine 27 specificity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAH", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -180.15 }, "construct": { "description": "HISTONE H3 11-Mer peptide (chains D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5M5G", "evidence_id": "EV-PDB-5M5G-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.27 }, "provenance": { "deposit_id": "5M5G", "doi": "10.1126/science.aaf6236", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5M5G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the Chaetomium Thermophilum polycomb repressive complex 2 (PRC2)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAH", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -180.15 }, "construct": { "description": "Peptide H3K27me3 (chains D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KJH", "evidence_id": "EV-PDB-5KJH-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.27 }, "provenance": { "deposit_id": "5KJH", "doi": "10.1126/science.aaj2335", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KJH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of an active polycomb repressive complex 2 in the stimulated state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAM", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -95.15 }, "construct": { "description": "Histone H3K9M mutant peptide (chains F,G)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5JJ0", "evidence_id": "EV-PDB-5JJ0-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.72 }, "provenance": { "deposit_id": "5JJ0", "doi": "10.1073/pnas.1605523113", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5JJ0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of G9a SET-domain with Histone H3K9M peptide and excess SAH" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAM", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -95.15 }, "construct": { "description": "Histone H3.1 mutant peptide with H3K9nor-leucine (chains F,G)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5JIY", "evidence_id": "EV-PDB-5JIY-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.48 }, "provenance": { "deposit_id": "5JIY", "doi": "10.1073/pnas.1605523113", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5JIY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of G9a SET-domain with Histone H3K9norLeucine mutant peptide and bound S-adenosylmethionine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAM", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -95.15 }, "construct": { "description": "Histone H3.1 peptide with K9M mutation (chains F,G)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5JIN", "evidence_id": "EV-PDB-5JIN-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "5JIN", "doi": "10.1073/pnas.1605523113", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5JIN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of G9a SET-domain with Histone H3K9M mutant peptide and bound S-adenosylmethionine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAM", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -98.15 }, "construct": { "description": "Histone H3.1 peptide with K9A mutation (chains F,G)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5JHN", "evidence_id": "EV-PDB-5JHN-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.67 }, "provenance": { "deposit_id": "5JHN", "doi": "10.1073/pnas.1605523113", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5JHN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of G9a SET-domain with Histone H3K9Ala mutant peptide and bound S-adenosylmethionine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5IQL", "evidence_id": "EV-PDB-5IQL-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "5IQL", "doi": "10.1038/cr.2016.49", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5IQL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of YEATS2 YEATS bound to H3K27cr peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "NA", "UNX", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H3K14ac peptide (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5I3L", "evidence_id": "EV-PDB-5I3L-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "5I3L", "doi": "10.1016/j.jsb.2016.07.001", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5I3L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DPF3b in complex with H3K14ac peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FAD", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "PEPTIDE (HSE)RTMQTARKSTGGKAPRKQLK (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5H6R", "evidence_id": "EV-PDB-5H6R-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "5H6R", "doi": "10.1016/j.bmc.2017.03.016", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5H6R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of LSD1-CoREST in complex with peptide 13" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3K4me3 (chains D,P)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5WXH", "evidence_id": "EV-PDB-5WXH-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.297 }, "provenance": { "deposit_id": "5WXH", "doi": "10.1073/pnas.1704155114", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5WXH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of TAF3 PHD finger bound to H3K4me3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SIN", "SLL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "ILE-MET-PRO-LYS-ASP-ILE-GLN-LEU (chains E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5WYI", "evidence_id": "EV-PDB-5WYI-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "5WYI", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5WYI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The Yaf9 YEATS domain Recognizing H3K122suc Peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FAD", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "PEPTIDE SRTMQTARKSTGGKAPRKQL (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5X60", "evidence_id": "EV-PDB-5X60-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.69 }, "provenance": { "deposit_id": "5X60", "doi": "10.1016/j.bmc.2017.03.016", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5X60" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of LSD1-CoREST in complex with peptide 9" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG", "RRK", "RUD", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5XF3", "evidence_id": "EV-PDB-5XF3-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "5XF3", "doi": "10.1038/s41467-017-01680-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5XF3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Nucleosome core particle with an adduct of a binuclear RAPTA (Ru-arene-phosphaadamantane) compound having a 1,2-diphenylethylenediamine linker (R,R-configuration)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG", "RSK", "RUD", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5XF5", "evidence_id": "EV-PDB-5XF5-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.82 }, "provenance": { "deposit_id": "5XF5", "doi": "10.1038/s41467-017-01680-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5XF5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Nucleosome core particle with an adduct of a binuclear RAPTA (Ru-arene-phosphaadamantane) compound having a 1,2-diphenylethylenediamine linker (R,S-configuration)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -196.15 }, "construct": { "description": "Peptide from Histone H3 (chains E,F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5XFQ", "evidence_id": "EV-PDB-5XFQ-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "5XFQ", "doi": "10.1038/nature23881", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5XFQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ternary complex of PHF1, a DNA duplex and a histone peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "THR-LYS-ALA-ALA-ARG-ALY-SER-ALA-PRO-ALA (chains E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5XTZ", "evidence_id": "EV-PDB-5XTZ-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.105 }, "provenance": { "deposit_id": "5XTZ", "doi": "10.1038/s41421-018-0027-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5XTZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of GAS41 YEATS bound to H3K27ac peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5Y0D", "evidence_id": "EV-PDB-5Y0D-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.99 }, "provenance": { "deposit_id": "5Y0D", "doi": "10.1093/nar/gky661", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5Y0D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of the human nucleosome containing the H2B E76K mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "PEPTIDE FROM HISTONE H3 (chains P)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5Y20", "evidence_id": "EV-PDB-5Y20-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.409 }, "provenance": { "deposit_id": "5Y20", "doi": "10.1016/j.celrep.2017.12.099", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5Y20" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of AL1 PHD finger bound to H3K4me3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "8L9", "AR6", "GOL", "HDR", "PEG", "SO4", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "9-mer peptide QTARKSTGG (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5Y2F", "evidence_id": "EV-PDB-5Y2F-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.53 }, "provenance": { "deposit_id": "5Y2F", "doi": "10.1038/s41589-018-0150-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5Y2F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Human SIRT6 in complex with allosteric activator MDL-801" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1,Histone H3-like centromeric protein A,Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5Z23", "evidence_id": "EV-PDB-5Z23-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.73 }, "provenance": { "deposit_id": "5Z23", "doi": "10.1038/s41467-019-08314-x", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5Z23" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the nucleosome containing a chimeric histone H3/CENP-A CATD" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5Z30", "evidence_id": "EV-PDB-5Z30-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.45 }, "provenance": { "deposit_id": "5Z30", "doi": "10.1093/nar/gky661", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5Z30" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The crystal structure of the nucleosome containing a cancer-associated histone H2A.Z R80C mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1,Histone H3-like centromeric protein A,Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5ZBX", "evidence_id": "EV-PDB-5ZBX-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.58 }, "provenance": { "deposit_id": "5ZBX", "doi": "10.1038/s41467-019-08314-x", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5ZBX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The crystal structure of the nucleosome containing histone H3.1 CATD(V76Q, K77D)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "ALY-SER-ALA-PRO-ALA (chains E,F,G,H)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6AXJ", "evidence_id": "EV-PDB-6AXJ-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.379 }, "provenance": { "deposit_id": "6AXJ", "doi": "10.1093/nar/gkx1151", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6AXJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the Yaf9 YEATS domain bound to H3K27ac" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "ALA-ARG-THR-ML3-GLN-THR (chains P)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6AZE", "evidence_id": "EV-PDB-6AZE-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.451 }, "provenance": { "deposit_id": "6AZE", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6AZE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of the BPTF PHD-bromodomain module bound to H3KC4me3 methyl lysine analog" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "UNX" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6BHD", "evidence_id": "EV-PDB-6BHD-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "6BHD", "doi": "10.1038/s41467-017-02259-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6BHD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of SETDB1 with a modified H3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "UNX" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6BHE", "evidence_id": "EV-PDB-6BHE-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "6BHE", "doi": "10.1038/s41467-017-02259-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6BHE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of SETDB1 with a modified H3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "UNX" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6BHG", "evidence_id": "EV-PDB-6BHG-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "6BHG", "doi": "10.1038/s41467-017-02259-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6BHG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of SETDB1 with a modified H3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4", "UNX" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6BHH", "evidence_id": "EV-PDB-6BHH-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "6BHH", "doi": "10.1038/s41467-017-02259-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6BHH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of SETDB1 with a modified H3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "UNX" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6BHI", "evidence_id": "EV-PDB-6BHI-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "6BHI", "doi": "10.1038/s41467-017-02259-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6BHI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of SETDB1 with a modified H3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D07", "evidence_id": "EV-PDB-6D07-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "6D07", "doi": "10.1021/jacs.9b05725", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D07" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the complex between human chromobox homolog 1 (CBX1) and H3K9me3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Histone H3 (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6E83", "evidence_id": "EV-PDB-6E83-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "6E83", "doi": "10.1038/s41467-018-06247-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6E83" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution structure of ZZZ3 ZZ domain in complex with histone H3 tail" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AKG", "FE", "TBU", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -196.15 }, "construct": { "description": "Histone 3 peptide H3(17-33)K18IA21M (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6F6D", "evidence_id": "EV-PDB-6F6D-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.81810675209 }, "provenance": { "deposit_id": "6F6D", "doi": "10.1021/acs.biochem.7b01152", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6F6D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The catalytic domain of KDM6B in complex with H3(17-33)K18IA21M peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "OGA", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.3 (chains E,F,G,H)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6HGT", "evidence_id": "EV-PDB-6HGT-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.33 }, "provenance": { "deposit_id": "6HGT", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6HGT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of human KDM4A complexed with co-substrate analog NOG and histone H3 peptide with K9R mutation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E,K,O,U,Y,a,e,k,o,u,y)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6HKT", "evidence_id": "EV-PDB-6HKT-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 9.7 }, "provenance": { "deposit_id": "6HKT", "doi": "10.1016/j.molcel.2018.09.027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6HKT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of an H1-bound 6-nucleosome array" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "ALA-ARG-THR-LYS-GLN-THR-ALA-ARG-LYS-SER-THR-GLY (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6IEU", "evidence_id": "EV-PDB-6IEU-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.787 }, "provenance": { "deposit_id": "6IEU", "doi": "10.1038/s41467-019-12126-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6IEU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The structure of TRIM66 PHD-Bromo domain with unmodified H3 N terminal peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -196.15 }, "construct": { "description": "H3K36me3 peptide (chains E,F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6IIS", "evidence_id": "EV-PDB-6IIS-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.358 }, "provenance": { "deposit_id": "6IIS", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6IIS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Complex structure of the HRP3 PWWP domain with both a 16-bp TA-rich DNA and an H3K36me3-containing histone peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -196.15 }, "construct": { "description": "H3K36me2-containing histone peptide (chains E,F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6IIT", "evidence_id": "EV-PDB-6IIT-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "6IIT", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6IIT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Complex structure of the HRP3 PWWP domain with both a 16-bp TA-rich DNA and an H3K36me2-containing histone peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -175.0 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6IPU", "evidence_id": "EV-PDB-6IPU-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.99 }, "provenance": { "deposit_id": "6IPU", "doi": "10.1038/s41467-019-13641-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6IPU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Human nucleosome core particle containing 145 bp of DNA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AU", "D0X", "MG", "XIS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -175.0 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6IQ4", "evidence_id": "EV-PDB-6IQ4-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.25 }, "provenance": { "deposit_id": "6IQ4", "doi": "10.1002/anie.201906423", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6IQ4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Nucleosome core particle cross-linked with a hetero-binuclear molecule possessing RAPTA and gold(I) 4-(diphenylphosphino)benzoic acid groups." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6JOU", "evidence_id": "EV-PDB-6JOU-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.17 }, "provenance": { "deposit_id": "6JOU", "doi": "10.1016/j.bbrc.2019.06.012", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6JOU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the human nucleosome containing H2A.Z.1 S42R" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6JR0", "evidence_id": "EV-PDB-6JR0-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "6JR0", "doi": "10.1107/S2059798319012713", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6JR0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the human nucleosome phased with 12 selenium atoms" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6JR1", "evidence_id": "EV-PDB-6JR1-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "6JR1", "doi": "10.1107/S2059798319012713", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6JR1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the human nucleosome phased with 16 selenium atoms" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -175.0 }, "construct": { "description": "Histone H3.1 (chains E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6JXD", "evidence_id": "EV-PDB-6JXD-5", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.25 }, "provenance": { "deposit_id": "6JXD", "doi": "10.1038/s41467-019-13641-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6JXD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Human nucleosome core particle with cohesive end DNA termini" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -175.0 }, "construct": { "description": "Histone H3.1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6JXD", "evidence_id": "EV-PDB-6JXD-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.25 }, "provenance": { "deposit_id": "6JXD", "doi": "10.1038/s41467-019-13641-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6JXD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Human nucleosome core particle with cohesive end DNA termini" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "K", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -175.0 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6K1I", "evidence_id": "EV-PDB-6K1I-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.75 }, "provenance": { "deposit_id": "6K1I", "doi": "10.1038/s41467-019-13641-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6K1I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Human nucleosome core particle with gammaH2A.X variant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -175.0 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6K1J", "evidence_id": "EV-PDB-6K1J-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.85 }, "provenance": { "deposit_id": "6K1J", "doi": "10.1038/s41467-019-13641-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6K1J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Human nucleosome core particle with H2A.X variant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "K", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -175.0 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6K1K", "evidence_id": "EV-PDB-6K1K-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "6K1K", "doi": "10.1038/s41467-019-13641-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6K1K" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Human nucleosome core particle with H2A.X S139E variant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6KE9", "evidence_id": "EV-PDB-6KE9-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.22 }, "provenance": { "deposit_id": "6KE9", "doi": "10.1093/nar/gkaa289", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6KE9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The Human Telomeric Nucleosome Displays Distinct Structural and Dynamic Properties" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6KVD", "evidence_id": "EV-PDB-6KVD-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.21 }, "provenance": { "deposit_id": "6KVD", "doi": "10.1093/jb/mvz109", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6KVD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of human nucleosome containing H2A.J" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains K,O,S,W)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6L49", "evidence_id": "EV-PDB-6L49-7", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 18.9 }, "provenance": { "deposit_id": "6L49", "doi": "10.1016/j.str.2019.10.016", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6L49" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "H3-CA-H3 tri-nucleosome with the 22 base-pair linker DNA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,O,S,W)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6L4A", "evidence_id": "EV-PDB-6L4A-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 12.3 }, "provenance": { "deposit_id": "6L4A", "doi": "10.1016/j.str.2019.10.016", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6L4A" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "H3-H3-H3 tri-nucleosome with the 22 base-pair linker DNA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6L9H", "evidence_id": "EV-PDB-6L9H-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "6L9H", "doi": "10.1093/nar/gkaa289", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6L9H" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The Human Telomeric Nucleosome Displays Distinct Structural and Dynamic Properties" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "CL", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -175.15 }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6L9Z", "evidence_id": "EV-PDB-6L9Z-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "6L9Z", "doi": "10.1093/nar/gkab070", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6L9Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "338 bp di-nucleosome assembled with linker histone H1.X" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ADP", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains I,M)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6HTS", "evidence_id": "EV-PDB-6HTS-5", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.8 }, "provenance": { "deposit_id": "6HTS", "doi": "10.1038/s41586-018-0021-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6HTS" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human INO80 complex bound to nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "H3K4ac (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6E86", "evidence_id": "EV-PDB-6E86-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "6E86", "doi": "10.1038/s41467-018-06247-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6E86" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution structure of ZZZ3 ZZ domain in complex with histone H3K4ac peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D08", "evidence_id": "EV-PDB-6D08-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "6D08", "doi": "10.1021/jacs.9b05725", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D08" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of an engineered bump-hole complex of mutant human chromobox homolog 1 (CBX1) with H3K9bn peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5Y0C", "evidence_id": "EV-PDB-5Y0C-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.087 }, "provenance": { "deposit_id": "5Y0C", "doi": "10.1093/nar/gky661", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5Y0C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of the human nucleosome at 2.09 angstrom resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NH4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 10.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "ALA-ALA-ARG-ALY-SER-ALA-PRO-ALA (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5XNV", "evidence_id": "EV-PDB-5XNV-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.696 }, "provenance": { "deposit_id": "5XNV", "doi": "10.1038/s41467-017-01173-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5XNV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of YEATS2 YEATS bound to H3K27ac peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -196.15 }, "construct": { "description": "Peptide from Histone H3.1 (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5XFR", "evidence_id": "EV-PDB-5XFR-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.25 }, "provenance": { "deposit_id": "5XFR", "doi": "10.1038/nature23881", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5XFR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ternary complex of MTF2, DNA and histone" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG", "RUD", "SO4", "SSK" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5XF4", "evidence_id": "EV-PDB-5XF4-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.87 }, "provenance": { "deposit_id": "5XF4", "doi": "10.1038/s41467-017-01680-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5XF4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Nucleosome core particle with an adduct of a binuclear RAPTA (Ru-arene-phosphaadamantane) compound having a 1,2-diphenylethylenediamine linker (S,S-configuration)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -175.0 }, "construct": { "description": "Histone H3.1 (chains A,E,K,O,U,Y,e,i)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6LA2", "evidence_id": "EV-PDB-6LA2-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.89 }, "provenance": { "deposit_id": "6LA2", "doi": "10.1093/nar/gkab070", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6LA2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "343 bp di-nucleosome harboring cohesive DNA termini assembled with linker histone H1.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -175.0 }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6LA8", "evidence_id": "EV-PDB-6LA8-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.4 }, "provenance": { "deposit_id": "6LA8", "doi": "10.1038/s41467-020-18533-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6LA8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "349 bp di-nucleosome harboring cohesive DNA termini assembled with linker histone H1.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -175.0 }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6LA9", "evidence_id": "EV-PDB-6LA9-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.7 }, "provenance": { "deposit_id": "6LA9", "doi": "10.1038/s41467-020-18533-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6LA9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "349 bp di-nucleosome harboring cohesive DNA termini assembled with linker histone H1.0 (high cryoprotectant)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "CL", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -175.0 }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6LAB", "evidence_id": "EV-PDB-6LAB-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "6LAB", "doi": "10.1093/nar/gkab070", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6LAB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "169 bp nucleosome, harboring cohesive DNA termini, assembled with linker histone H1.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "ARG-TYR-ARG-PRO-GLY-THR-VAL-ALA-LEU (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6PAG", "evidence_id": "EV-PDB-6PAG-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.501 }, "provenance": { "deposit_id": "6PAG", "doi": "10.1038/s41467-021-22359-x", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6PAG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Killer cell immunoglobulin-like receptor 2DL3 in complex with HLA-C*07:02" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6R91", "evidence_id": "EV-PDB-6R91-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.1 }, "provenance": { "deposit_id": "6R91", "doi": "10.1038/s41586-019-1259-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6R91" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of NCP_THF2(-3)-UV-DDB" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6R93", "evidence_id": "EV-PDB-6R93-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.0 }, "provenance": { "deposit_id": "6R93", "doi": "10.1038/s41586-019-1259-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6R93" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of NCP-6-4PP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NI", "UNX" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H3tK27me3 (chains B,D,F,H,J,L)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6V2H", "evidence_id": "EV-PDB-6V2H-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "6V2H", "doi": "10.1016/j.chembiol.2020.05.007", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6V2H" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of CDYL2 in complex with H3tK27me3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains a,e)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6V92", "evidence_id": "EV-PDB-6V92-23", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 20.0 }, "provenance": { "deposit_id": "6V92", "doi": "10.7554/eLife.54449", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6V92" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "RSC-NCP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Histone H3.1 (chains D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6YIH", "evidence_id": "EV-PDB-6YIH-4", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.55 }, "provenance": { "deposit_id": "6YIH", "doi": "10.1083/jcb.201910059", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6YIH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Chromosomal Passenger Complex (CPC) bound to phosphorylated Histone 3 peptide at 2.6 A." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BWD", "evidence_id": "EV-PDB-7BWD-5", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.32 }, "provenance": { "deposit_id": "7BWD", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BWD" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of Dot1L-H2BK34ub Nucleosome Complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "GOL", "SRO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H3K4me3Q5ser peptide (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7CFQ", "evidence_id": "EV-PDB-7CFQ-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7CFQ", "doi": "10.1126/sciadv.abf4291", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7CFQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of WDR5 in complex with H3K4me3Q5ser peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SRO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H3Q5ser peptide (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7CFP", "evidence_id": "EV-PDB-7CFP-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7CFP", "doi": "10.1126/sciadv.abf4291", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7CFP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of WDR5 in complex with a H3Q5ser peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,L,P)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7CCR", "evidence_id": "EV-PDB-7CCR-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.9 }, "provenance": { "deposit_id": "7CCR", "doi": "10.1038/s41422-020-00422-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7CCR" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of the 2:2 cGAS-nucleosome complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7CCQ", "evidence_id": "EV-PDB-7CCQ-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.8 }, "provenance": { "deposit_id": "7CCQ", "doi": "10.1038/s41422-020-00422-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7CCQ" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of the 1:1 cGAS-nucleosome complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,a,e)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7C0M", "evidence_id": "EV-PDB-7C0M-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.9 }, "provenance": { "deposit_id": "7C0M", "doi": "10.1126/science.abd0237", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7C0M" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Human cGAS-nucleosome complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PTD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6YOV", "evidence_id": "EV-PDB-6YOV-5", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.42 }, "provenance": { "deposit_id": "6YOV", "doi": "10.1126/science.abb0074", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6YOV" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "OCT4-SOX2-bound nucleosome - SHL+6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PTD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6YOV", "evidence_id": "EV-PDB-6YOV-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.42 }, "provenance": { "deposit_id": "6YOV", "doi": "10.1126/science.abb0074", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6YOV" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "OCT4-SOX2-bound nucleosome - SHL+6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Phosphorylated (Thr3) Histone H3 (chains D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6YIF", "evidence_id": "EV-PDB-6YIF-4", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.81 }, "provenance": { "deposit_id": "6YIF", "doi": "10.1083/jcb.201910059", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6YIF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Chromosomal Passenger Complex (CPC) bound to phosphorylated Histone 3 peptide at 1.8 A." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1,E3 ubiquitin-protein ligase HERC2 (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6WW4", "evidence_id": "EV-PDB-6WW4-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.252 }, "provenance": { "deposit_id": "6WW4", "doi": "10.1016/j.str.2020.07.003", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6WW4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of HERC2 ZZ domain in complex with histone H3 tail" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4", "UNX" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains E,F,G,H)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6WAV", "evidence_id": "EV-PDB-6WAV-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "6WAV", "doi": "10.7554/eLife.58675", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6WAV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of PHF1 in complex with H3K36me3 substitution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains I,J,L,M)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6VIL", "evidence_id": "EV-PDB-6VIL-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.301 }, "provenance": { "deposit_id": "6VIL", "doi": "10.1038/s41588-020-00729-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6VIL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of mouse BAHCC1 BAH domain in complex with H3K27me3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "UNX" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 Peptide (chains QQQ)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6V41", "evidence_id": "EV-PDB-6V41-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.603 }, "provenance": { "deposit_id": "6V41", "doi": "10.1016/j.chembiol.2020.05.007", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6V41" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "crystal structure of CDY1 chromodomain bound to H3K9me3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "UNX" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "ACE-GLN-LEU-ALA-THR-LYS-ALA-ALA-ARG-M3L-SER-ALA-PRO-ALA-THR-TYR-NH2 (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6V3N", "evidence_id": "EV-PDB-6V3N-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "6V3N", "doi": "10.1016/j.chembiol.2020.05.007", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6V3N" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of CDYL2 in complex with H3K27me3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6V2K", "evidence_id": "EV-PDB-6V2K-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "6V2K", "doi": "10.1038/s42003-021-01707-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6V2K" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The nucleosome structure after H2A-H2B exchange" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6USJ", "evidence_id": "EV-PDB-6USJ-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 10.5 }, "provenance": { "deposit_id": "6USJ", "doi": "10.1371/journal.pone.0240932", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6USJ" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of two nucleosomes bridged by human PARP2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6UPL", "evidence_id": "EV-PDB-6UPL-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 7.4 }, "provenance": { "deposit_id": "6UPL", "doi": "10.1038/s41586-019-1820-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6UPL" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of FACT_subnucleosome complex 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6UPK", "evidence_id": "EV-PDB-6UPK-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.9 }, "provenance": { "deposit_id": "6UPK", "doi": "10.1038/s41586-019-1820-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6UPK" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of FACT_subnucleosome complex 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6T93", "evidence_id": "EV-PDB-6T93-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.49 }, "provenance": { "deposit_id": "6T93", "doi": "10.1126/science.abb0074", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6T93" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Nucleosome with OCT4-SOX2 motif at SHL-6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PTD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6T90", "evidence_id": "EV-PDB-6T90-5", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.05 }, "provenance": { "deposit_id": "6T90", "doi": "10.1126/science.abb0074", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6T90" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "OCT4-SOX2-bound nucleosome - SHL-6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PTD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6T90", "evidence_id": "EV-PDB-6T90-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.05 }, "provenance": { "deposit_id": "6T90", "doi": "10.1126/science.abb0074", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6T90" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "OCT4-SOX2-bound nucleosome - SHL-6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6R94", "evidence_id": "EV-PDB-6R94-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.5 }, "provenance": { "deposit_id": "6R94", "doi": "10.1038/s41586-019-1259-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6R94" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of NCP_THF2(-3)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6R92", "evidence_id": "EV-PDB-6R92-4", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.8 }, "provenance": { "deposit_id": "6R92", "doi": "10.1038/s41586-019-1259-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6R92" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of NCP-THF2(+1)-UV-DDB class B" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6R90", "evidence_id": "EV-PDB-6R90-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.5 }, "provenance": { "deposit_id": "6R90", "doi": "10.1038/s41586-019-1259-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6R90" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of NCP-THF2(+1)-UV-DDB class A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6R8Z", "evidence_id": "EV-PDB-6R8Z-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.9 }, "provenance": { "deposit_id": "6R8Z", "doi": "10.1038/s41586-019-1259-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6R8Z" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of NCP_THF2(-1)-UV-DDB" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6R8Y", "evidence_id": "EV-PDB-6R8Y-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.3 }, "provenance": { "deposit_id": "6R8Y", "doi": "10.1038/s41586-019-1259-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6R8Y" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of NCP-6-4PP(-1)-UV-DDB" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.4, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "ALA-ARG-THR-MLZ-GLN-THR-ALA-ARG-TYR (chains B)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QXZ", "evidence_id": "EV-PDB-6QXZ-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "6QXZ", "doi": "10.1111/febs.15256", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QXZ" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution structure of the ASHH2 CW domain with the N-terminal histone H3 tail mimicking peptide monomethylated on lysine 4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "ARG-TYR-ARG-PRO-GLY-THR-VAL-ALA-LEU (chains C,G)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6PA1", "evidence_id": "EV-PDB-6PA1-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.01 }, "provenance": { "deposit_id": "6PA1", "doi": "10.1038/s41467-021-22359-x", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6PA1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Killer cell immunoglobulin-like receptor 2DL2 in complex with HLA-C*07:02" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3K9bu (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6MIQ", "evidence_id": "EV-PDB-6MIQ-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "6MIQ", "doi": "10.1038/s41467-018-07072-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6MIQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Taf14 YEATS domain in complex with histone H3K9bu" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3K9pr (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6MIO", "evidence_id": "EV-PDB-6MIO-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "6MIO", "doi": "10.1038/s41467-018-07072-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6MIO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Taf14 YEATS domain in complex with histone H3K9pr" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3K9cr (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6MIN", "evidence_id": "EV-PDB-6MIN-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "6MIN", "doi": "10.1038/s41467-018-07072-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6MIN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Taf14 YEATS domain G82A mutant in complex with histone H3K9cr" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3K9cr (chains B,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6MIM", "evidence_id": "EV-PDB-6MIM-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.525 }, "provenance": { "deposit_id": "6MIM", "doi": "10.1038/s41467-018-07072-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6MIM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of AF9 YEATS domain Y78W mutant in complex with histone H3K9cr" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MLI", "PEG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3K9bu (chains B,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6MIL", "evidence_id": "EV-PDB-6MIL-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.93 }, "provenance": { "deposit_id": "6MIL", "doi": "10.1038/s41467-018-07072-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6MIL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of AF9 YEATS domain in complex with histone H3K9bu" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6M4H", "evidence_id": "EV-PDB-6M4H-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.9 }, "provenance": { "deposit_id": "6M4H", "doi": "10.15252/embj.2020105907", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6M4H" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structural mechanism of nucleosome dynamics governed by human histone variants H2A.B and H2A.Z.2.2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6M4G", "evidence_id": "EV-PDB-6M4G-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "6M4G", "doi": "10.15252/embj.2020105907", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6M4G" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structural mechanism of nucleosome dynamics governed by human histone variants H2A.B and H2A.Z.2.2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6M4D", "evidence_id": "EV-PDB-6M4D-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.4 }, "provenance": { "deposit_id": "6M4D", "doi": "10.15252/embj.2020105907", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6M4D" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structural mechanism of nucleosome dynamics governed by human histone variants H2A.B and H2A.Z.2.2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -175.15 }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6M44", "evidence_id": "EV-PDB-6M44-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.81 }, "provenance": { "deposit_id": "6M44", "doi": "10.1038/s41467-020-18533-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6M44" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "355 bp di-nucleosome harboring cohesive DNA termini (high cryoprotectant)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -175.15 }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6M3V", "evidence_id": "EV-PDB-6M3V-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.6 }, "provenance": { "deposit_id": "6M3V", "doi": "10.1038/s41467-020-18533-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6M3V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "355 bp di-nucleosome harboring cohesive DNA termini" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "2 (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6LSD", "evidence_id": "EV-PDB-6LSD-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.05 }, "provenance": { "deposit_id": "6LSD", "doi": "10.1093/nar/gkaa1130", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6LSD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of YEATS domain of human YEATS2 in complex with H3K27bz peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "2 (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6LS6", "evidence_id": "EV-PDB-6LS6-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "6LS6", "doi": "10.1093/nar/gkaa1130", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6LS6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of YEATS domain of AF9 in complex with H3K9bz peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -175.0 }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6LER", "evidence_id": "EV-PDB-6LER-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "6LER", "doi": "10.1093/nar/gkab070", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6LER" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "169 bp nucleosome harboring non-identical cohesive DNA termini." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6LE9", "evidence_id": "EV-PDB-6LE9-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "6LE9", "doi": "10.1093/nar/gkaa289", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6LE9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The Human Telomeric Nucleosome Displays Distinct Structural and Dynamic Properties" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "CL", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -175.0 }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7COW", "evidence_id": "EV-PDB-7COW-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.86 }, "provenance": { "deposit_id": "7COW", "doi": "10.1093/nar/gkab070", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7COW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "353 bp di-nucleosome harboring cohesive DNA termini with linker histone H1.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7D1Z", "evidence_id": "EV-PDB-7D1Z-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.15 }, "provenance": { "deposit_id": "7D1Z", "doi": "10.26508/lsa.202000919", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7D1Z" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of SET8-nucleosome complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7DBP", "evidence_id": "EV-PDB-7DBP-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.5 }, "provenance": { "deposit_id": "7DBP", "doi": "10.1038/s41598-020-79654-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7DBP" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Linker histone defines structure and self-association behaviour of the 177 bp human chromosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7K5X", "evidence_id": "EV-PDB-7K5X-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.93 }, "provenance": { "deposit_id": "7K5X", "doi": "10.1016/j.molcel.2020.10.038", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7K5X" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of a chromatosome containing human linker histone H1.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7K5Y", "evidence_id": "EV-PDB-7K5Y-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.76 }, "provenance": { "deposit_id": "7K5Y", "doi": "10.1016/j.molcel.2020.10.038", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7K5Y" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of a chromatosome containing human linker histone H1.4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7K60", "evidence_id": "EV-PDB-7K60-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.12 }, "provenance": { "deposit_id": "7K60", "doi": "10.1016/j.molcel.2020.10.038", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7K60" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of a chromatosome containing human linker histone H1.10" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7K61", "evidence_id": "EV-PDB-7K61-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.85 }, "provenance": { "deposit_id": "7K61", "doi": "10.1016/j.molcel.2020.10.038", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7K61" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of 197bp nucleosome aided by scFv" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7K63", "evidence_id": "EV-PDB-7K63-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.03 }, "provenance": { "deposit_id": "7K63", "doi": "10.1016/j.molcel.2020.10.038", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7K63" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of a chromatosome containing chimeric linker histone gH1.10-ncH1.4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Histone H3.1 (chains B)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7KLR", "evidence_id": "EV-PDB-7KLR-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "7KLR", "doi": "10.1021/acschembio.0c00976", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7KLR" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution structure of the PHD1 domain of histone demethylase KDM5A in complex with a histone H3(1-10) peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "histone H3 T3phK4me3 peptide (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LBK", "evidence_id": "EV-PDB-7LBK-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "7LBK", "doi": "10.1091/mbc.E21-06-0283", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LBK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of human Survivin bound to histone H3 T3phK4me3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "histone H3T3phK4ac peptide (chains B,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LBP", "evidence_id": "EV-PDB-7LBP-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "7LBP", "doi": "10.1091/mbc.E21-06-0283", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LBP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of human Survivin bound to histone H3T3phK4ac peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LYA", "evidence_id": "EV-PDB-7LYA-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.91 }, "provenance": { "deposit_id": "7LYA", "doi": "10.1038/s41586-021-03716-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LYA" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome core particle with linked histone proteins H2A and H2B" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LYB", "evidence_id": "EV-PDB-7LYB-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.28 }, "provenance": { "deposit_id": "7LYB", "doi": "10.1038/s41586-021-03716-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LYB" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome core particle in complex with BRCA1-BARD1-UbcH5c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LYC", "evidence_id": "EV-PDB-7LYC-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.94 }, "provenance": { "deposit_id": "7LYC", "doi": "10.1038/s41586-021-03716-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LYC" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome core particle ubiquitylated at histone H2A Lys13 and Lys15 in complex with BARD1 (residues 415-777)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1,Protein AF-10 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7MJU", "evidence_id": "EV-PDB-7MJU-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "7MJU", "doi": "10.1038/s41467-021-24418-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7MJU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of human AF10 PZP bound to histone H3 tail" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7NL0", "evidence_id": "EV-PDB-7NL0-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.5 }, "provenance": { "deposit_id": "7NL0", "doi": "10.1038/s41556-021-00727-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7NL0" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the Lin28B nucleosome core particle" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7SCY", "evidence_id": "EV-PDB-7SCY-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.1 }, "provenance": { "deposit_id": "7SCY", "doi": "10.1016/j.molcel.2021.11.014", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7SCY" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Nuc147 bound to single BRCT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7SCZ", "evidence_id": "EV-PDB-7SCZ-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.5 }, "provenance": { "deposit_id": "7SCZ", "doi": "10.1016/j.molcel.2021.11.014", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7SCZ" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Nuc147 bound to multiple BRCTs" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAM", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -180.15 }, "construct": { "description": "THR-LYS-ALA-ALA-ARG-M3L-SER-ALA-PRO-ALA (chains E,J)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7TD5", "evidence_id": "EV-PDB-7TD5-5", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.994 }, "provenance": { "deposit_id": "7TD5", "doi": "10.1038/s41467-022-34431-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7TD5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of human PRC2-EZH1 containing phosphorylated SUZ12" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAM", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -180.15 }, "construct": { "description": "THR-LYS-ALA-ALA-ARG-MET-SER-ALA-PRO-SER (chains D,I)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7TD5", "evidence_id": "EV-PDB-7TD5-4", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.994 }, "provenance": { "deposit_id": "7TD5", "doi": "10.1038/s41467-022-34431-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7TD5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of human PRC2-EZH1 containing phosphorylated SUZ12" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7U0G", "evidence_id": "EV-PDB-7U0G-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "7U0G", "doi": "10.1016/j.molcel.2023.05.030", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7U0G" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "structure of LIN28b nucleosome bound 3 OCT4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7U0I", "evidence_id": "EV-PDB-7U0I-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "7U0I", "doi": "10.1016/j.molcel.2023.05.030", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7U0I" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of LIN28b nucleosome bound 2 OCT4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7U0J", "evidence_id": "EV-PDB-7U0J-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "7U0J", "doi": "10.1016/j.molcel.2023.05.030", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7U0J" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of 162bp LIN28b nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1PE", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains B,F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7V6Q", "evidence_id": "EV-PDB-7V6Q-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "7V6Q", "doi": "10.1101/gad.349100.121", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7V6Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of sNASP-ASF1A-H3.1-H4 complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7V96", "evidence_id": "EV-PDB-7V96-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.92 }, "provenance": { "deposit_id": "7V96", "doi": "10.1038/s41586-022-05236-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7V96" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Telomeric Dinucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,O,S,W,a,e)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7V9K", "evidence_id": "EV-PDB-7V9K-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 8.1 }, "provenance": { "deposit_id": "7V9K", "doi": "10.1038/s41586-022-05236-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7V9K" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Telomeric tetranucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,O,S,W,a,e)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7VA4", "evidence_id": "EV-PDB-7VA4-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 14.0 }, "provenance": { "deposit_id": "7VA4", "doi": "10.1038/s41586-022-05236-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7VA4" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Telomeric tetranucleosome in open state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7VZ4", "evidence_id": "EV-PDB-7VZ4-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.89 }, "provenance": { "deposit_id": "7VZ4", "doi": "10.1007/978-1-0716-4486-7_6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7VZ4" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of human nucleosome core particle composed of the Widom 601L DNA sequence" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7W9V", "evidence_id": "EV-PDB-7W9V-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.95 }, "provenance": { "deposit_id": "7W9V", "doi": "10.1016/j.isci.2022.104563", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7W9V" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of nucleosome in complex with p300 acetyltransferase catalytic core (complex I)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,C,E,G)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7X57", "evidence_id": "EV-PDB-7X57-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.63 }, "provenance": { "deposit_id": "7X57", "doi": "10.1073/pnas.2206542119", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7X57" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of human subnucleosome (closed form)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,C,E,G)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7X58", "evidence_id": "EV-PDB-7X58-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.93 }, "provenance": { "deposit_id": "7X58", "doi": "10.1073/pnas.2206542119", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7X58" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of human subnucleosome (open form)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CIT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3K27ac(24-27) peptide (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7X88", "evidence_id": "EV-PDB-7X88-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.25 }, "provenance": { "deposit_id": "7X88", "doi": "10.1016/j.molcel.2022.09.034", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7X88" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of ENL YEATS domain T2 mutant in complex with histone H3 acetylation at K27" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H3K27ac(24-27) peptide (chains B,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7X8F", "evidence_id": "EV-PDB-7X8F-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.44 }, "provenance": { "deposit_id": "7X8F", "doi": "10.1016/j.molcel.2022.09.034", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7X8F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of ENL T4 mutant YEATS domain in complex with histone H3 acetylation at K27" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H3K27ac(24-27) peptide (chains B,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7X8G", "evidence_id": "EV-PDB-7X8G-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.91 }, "provenance": { "deposit_id": "7X8G", "doi": "10.1016/j.molcel.2022.09.034", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7X8G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of ENL T1(H116P) mutant YEATS domain in complex with histone H3 acetylation at K27" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7XD1", "evidence_id": "EV-PDB-7XD1-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "7XD1", "doi": "10.1038/s41589-022-01067-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7XD1" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "cryo-EM structure of unmodified nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -175.0 }, "construct": { "description": "Histone H3.1 (chains A,E,K,O,U,Y,e,i)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7XVL", "evidence_id": "EV-PDB-7XVL-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.506 }, "provenance": { "deposit_id": "7XVL", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7XVL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Nucleosome-H1.0 Linker Histone Assembly (sticky-169an DNA fragment)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "CL", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -175.0 }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7XVM", "evidence_id": "EV-PDB-7XVM-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.84 }, "provenance": { "deposit_id": "7XVM", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7XVM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Nucleosome-H5 Linker Histone Assembly (sticky-169a DNA fragment)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -175.0 }, "construct": { "description": "Histone H3.1 (chains A,E,K,O,U,Y,e,i)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7XX6", "evidence_id": "EV-PDB-7XX6-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.39 }, "provenance": { "deposit_id": "7XX6", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7XX6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Nucleosome-H1.0 Linker Histone Assembly (sticky-169a DNA fragment)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7XZX", "evidence_id": "EV-PDB-7XZX-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.53 }, "provenance": { "deposit_id": "7XZX", "doi": "10.1093/pnasnexus/pgac177", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7XZX" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the nucleosome in complex with p53 DNA-binding domain" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7XZY", "evidence_id": "EV-PDB-7XZY-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.97 }, "provenance": { "deposit_id": "7XZY", "doi": "10.1093/pnasnexus/pgac177", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7XZY" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the nucleosome containing 193 base-pair DNA with a p53 target sequence" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7XZZ", "evidence_id": "EV-PDB-7XZZ-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.07 }, "provenance": { "deposit_id": "7XZZ", "doi": "10.1093/pnasnexus/pgac177", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7XZZ" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the nucleosome in complex with p53" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -175.0 }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7XX5", "evidence_id": "EV-PDB-7XX5-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.19 }, "provenance": { "deposit_id": "7XX5", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7XX5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Nucleosome-H1.3 Linker Histone Assembly (sticky-169a DNA fragment)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H3K27ac(24-27) peptide (chains B,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7X8B", "evidence_id": "EV-PDB-7X8B-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "7X8B", "doi": "10.1016/j.molcel.2022.09.034", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7X8B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of ENL T1 mutant YEATS domain in complex with histone H3 acetylation at K27" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,O,S,W)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7V9S", "evidence_id": "EV-PDB-7V9S-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 11.0 }, "provenance": { "deposit_id": "7V9S", "doi": "10.1038/s41586-022-05236-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7V9S" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Telomeric trinucleosome in open state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,O,S,W)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7V9J", "evidence_id": "EV-PDB-7V9J-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 8.0 }, "provenance": { "deposit_id": "7V9J", "doi": "10.1038/s41586-022-05236-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7V9J" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Telomeric trinucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7V9C", "evidence_id": "EV-PDB-7V9C-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.5 }, "provenance": { "deposit_id": "7V9C", "doi": "10.1038/s41586-022-05236-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7V9C" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Telomeric Dinucleosome in open state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7V90", "evidence_id": "EV-PDB-7V90-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.5 }, "provenance": { "deposit_id": "7V90", "doi": "10.1038/s41586-022-05236-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7V90" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Telomeric mononucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "histone H3 T3phK4me2 peptide (chains E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LBQ", "evidence_id": "EV-PDB-7LBQ-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.69 }, "provenance": { "deposit_id": "7LBQ", "doi": "10.1091/mbc.E21-06-0283", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LBQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of human Survivin bound to histone H3 T3phK4me2 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "histone H3 T3phK4me1 peptide (chains C,F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LBO", "evidence_id": "EV-PDB-7LBO-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "7LBO", "doi": "10.1091/mbc.E21-06-0283", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LBO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of human Survivin bound to histone H3 T3phK4me1 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -196.15 }, "construct": { "description": "H3K9me3K18ac (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7EBK", "evidence_id": "EV-PDB-7EBK-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.74 }, "provenance": { "deposit_id": "7EBK", "doi": "10.1016/j.stem.2022.05.004", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7EBK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mouse Trim66 PHD-Bromo dual domain complexed with the H3(1-24)K9me3K18ac peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SFG", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7E8D", "evidence_id": "EV-PDB-7E8D-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "7E8D", "doi": "10.1038/s41467-021-26913-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7E8D" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "NSD2 E1099K mutant bound to nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains D,I)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7Y5V", "evidence_id": "EV-PDB-7Y5V-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 6.1 }, "provenance": { "deposit_id": "7Y5V", "doi": "10.1126/science.add8673", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7Y5V" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the dimeric human CAF1LC-H3-H4 complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ADP", "BEF", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains I,M)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7ZI4", "evidence_id": "EV-PDB-7ZI4-8", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "7ZI4", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7ZI4" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human INO80 complex bound to a WT nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8DS8", "evidence_id": "EV-PDB-8DS8-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.84 }, "provenance": { "deposit_id": "8DS8", "doi": "10.1038/s41586-023-06688-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8DS8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of human TNRC18 BAH domain in complex with H3K9me3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAM", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JHF", "evidence_id": "EV-PDB-8JHF-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.68 }, "provenance": { "deposit_id": "8JHF", "doi": "10.1038/s41421-023-00620-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JHF" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Native SUV420H1 bound to 167-bp nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JCD", "evidence_id": "EV-PDB-8JCD-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.14 }, "provenance": { "deposit_id": "8JCD", "doi": "10.1093/nar/gkae825", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JCD" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Human H2BFWTH100R nucleosome with 601 DNA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JCC", "evidence_id": "EV-PDB-8JCC-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.42 }, "provenance": { "deposit_id": "8JCC", "doi": "10.1093/nar/gkae825", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JCC" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Human histone H2B variant H2BFWT Cryo-EM structure with 601 DNA sequence" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JBX", "evidence_id": "EV-PDB-8JBX-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.35 }, "provenance": { "deposit_id": "8JBX", "doi": "10.1093/nar/gkae825", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JBX" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Human canonical 601 DNA nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,C,E,G)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8J6T", "evidence_id": "EV-PDB-8J6T-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 6.6 }, "provenance": { "deposit_id": "8J6T", "doi": "10.1126/science.add8673", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8J6T" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the double CAF-1 bound right-handed Di-tetrasome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,C,E,G)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8J6S", "evidence_id": "EV-PDB-8J6S-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.8 }, "provenance": { "deposit_id": "8J6S", "doi": "10.1126/science.add8673", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8J6S" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the single CAF-1 bound right-handed Di-tetrasome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8IQG", "evidence_id": "EV-PDB-8IQG-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.5 }, "provenance": { "deposit_id": "8IQG", "doi": "10.1126/science.add8673", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8IQG" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the monomeric human CAF1-H3-H4 complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains D,I)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8IQF", "evidence_id": "EV-PDB-8IQF-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.6 }, "provenance": { "deposit_id": "8IQF", "doi": "10.1126/science.add8673", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8IQF" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the dimeric human CAF1-H3-H4 complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1PE", "GOL", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8IJ0", "evidence_id": "EV-PDB-8IJ0-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.52 }, "provenance": { "deposit_id": "8IJ0", "doi": "10.1073/pnas.2304103120", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8IJ0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of GAS41 YEATS domain in complex with H3K9ac peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "branched: alpha-D-glucopyranose-(1-4)-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8IIZ", "evidence_id": "EV-PDB-8IIZ-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "8IIZ", "doi": "10.1073/pnas.2304103120", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8IIZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of MBP fused GAS41 YEATS domain in complex with H3K27ac peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "branched: alpha-D-glucopyranose-(1-4)-alpha-D-glucopyranose-(1-4)-alpha-D-glucopyranose-(1-4)-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8IIY", "evidence_id": "EV-PDB-8IIY-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.15 }, "provenance": { "deposit_id": "8IIY", "doi": "10.1073/pnas.2304103120", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8IIY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of MBP fused GAS41 YEATS domain in complex with H3K14ac peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,M,Q,U)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8IHL", "evidence_id": "EV-PDB-8IHL-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 7.64 }, "provenance": { "deposit_id": "8IHL", "doi": "10.1038/s42003-023-05694-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8IHL" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Overlapping tri-nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains E,K)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8IEJ", "evidence_id": "EV-PDB-8IEJ-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.12 }, "provenance": { "deposit_id": "8IEJ", "doi": "10.1016/j.molcel.2023.08.001", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8IEJ" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "RNF20-RNF40/hRad6A-Ub/nucleosome complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains E,K)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8IEG", "evidence_id": "EV-PDB-8IEG-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.44 }, "provenance": { "deposit_id": "8IEG", "doi": "10.1016/j.molcel.2023.08.001", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8IEG" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Bre1(mRBD-RING)/Rad6-Ub/nucleosome complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "ALA-ARG-KCR-SER-ALA-PRO (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8I60", "evidence_id": "EV-PDB-8I60-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "8I60", "doi": "10.1016/j.molcel.2023.05.022", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8I60" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of GAS41 YEATS domain in complex with histone H3K27cr" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -193.15 }, "construct": { "description": "histone H3Q5his peptide (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8HMX", "evidence_id": "EV-PDB-8HMX-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "8HMX", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8HMX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "WDR5 in complex with histone H3Q5his peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "2OP", "EDO", "GOL", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H3K23la peptide (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8HLY", "evidence_id": "EV-PDB-8HLY-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "8HLY", "doi": "10.1016/j.isci.2023.107757", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8HLY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of SIRT3 in complex with H3K23la peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains a,e)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8HE5", "evidence_id": "EV-PDB-8HE5-18", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 6.95 }, "provenance": { "deposit_id": "8HE5", "doi": "10.1016/j.jmb.2023.168130", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8HE5" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "RNA polymerase II elongation complex bound with Rad26 and Elf1, stalled at SHL(-3.5) of the nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8HAN", "evidence_id": "EV-PDB-8HAN-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.2 }, "provenance": { "deposit_id": "8HAN", "doi": "10.1038/s41467-023-39735-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8HAN" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the CBP catalytic core bound to the H4K12acK16ac nucleosome, class 3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8HAM", "evidence_id": "EV-PDB-8HAM-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.5 }, "provenance": { "deposit_id": "8HAM", "doi": "10.1038/s41467-023-39735-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8HAM" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the CBP catalytic core bound to the H4K12acK16ac nucleosome, class 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8HAL", "evidence_id": "EV-PDB-8HAL-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.4 }, "provenance": { "deposit_id": "8HAL", "doi": "10.1038/s41467-023-39735-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8HAL" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the CBP catalytic core bound to the H4K12acK16ac nucleosome, class 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8HAK", "evidence_id": "EV-PDB-8HAK-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.5 }, "provenance": { "deposit_id": "8HAK", "doi": "10.1038/s41467-023-39735-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8HAK" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the p300 catalytic core bound to the H4K12acK16ac nucleosome, class 4 (4.5 angstrom resolution)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8HAJ", "evidence_id": "EV-PDB-8HAJ-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.8 }, "provenance": { "deposit_id": "8HAJ", "doi": "10.1038/s41467-023-39735-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8HAJ" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the p300 catalytic core bound to the H4K12acK16ac nucleosome, class 2 (4.8 angstrom resolution)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8HAI", "evidence_id": "EV-PDB-8HAI-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.7 }, "provenance": { "deposit_id": "8HAI", "doi": "10.1038/s41467-023-39735-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8HAI" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the p300 catalytic core bound to the H4K12acK16ac nucleosome, class 1 (4.7 angstrom resolution)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8HAH", "evidence_id": "EV-PDB-8HAH-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.9 }, "provenance": { "deposit_id": "8HAH", "doi": "10.1038/s41467-023-39735-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8HAH" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the p300 catalytic core bound to the H4K12acK16ac nucleosome, class 2 (3.9 angstrom resolution)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8HAG", "evidence_id": "EV-PDB-8HAG-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "8HAG", "doi": "10.1038/s41467-023-39735-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8HAG" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the p300 catalytic core bound to the H4K12acK16ac nucleosome, class 1 (3.2 angstrom resolution)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8H1T", "evidence_id": "EV-PDB-8H1T-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "8H1T", "doi": "10.1038/s41586-023-05841-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8H1T" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of BAP1-ASXL1 bound to chromatosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains a,e)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8H0W", "evidence_id": "EV-PDB-8H0W-16", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.6 }, "provenance": { "deposit_id": "8H0W", "doi": "10.1038/s41467-022-35003-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8H0W" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "RNA polymerase II transcribing a chromatosome (type II)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains a,e)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8H0V", "evidence_id": "EV-PDB-8H0V-16", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.8 }, "provenance": { "deposit_id": "8H0V", "doi": "10.1038/s41467-022-35003-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8H0V" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "RNA polymerase II transcribing a chromatosome (type I)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8GUK", "evidence_id": "EV-PDB-8GUK-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.51 }, "provenance": { "deposit_id": "8GUK", "doi": "10.1038/s41467-024-46910-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8GUK" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Human nucleosome core particle (free form)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8GUJ", "evidence_id": "EV-PDB-8GUJ-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "8GUJ", "doi": "10.1038/s41467-024-46910-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8GUJ" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Bre1-nucleosome complex (Model II)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8GUI", "evidence_id": "EV-PDB-8GUI-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.81 }, "provenance": { "deposit_id": "8GUI", "doi": "10.1038/s41467-024-46910-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8GUI" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Bre1-nucleosome complex (Model I)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8GRM", "evidence_id": "EV-PDB-8GRM-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.05 }, "provenance": { "deposit_id": "8GRM", "doi": "10.1016/j.chempr.2023.01.012", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8GRM" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of PRC1 bound to H2AK119-UbcH5b-Ub nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1,Protein Jade-1 (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8GE0", "evidence_id": "EV-PDB-8GE0-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "8GE0", "doi": "10.1038/s41594-024-01245-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8GE0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of JADE1 PZP domain in complex with Histone H3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8EVJ", "evidence_id": "EV-PDB-8EVJ-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.1 }, "provenance": { "deposit_id": "8EVJ", "doi": "10.1038/s41594-023-01189-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8EVJ" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "CX3CR1 nucleosome bound PU.1 and C/EBPa" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8EVI", "evidence_id": "EV-PDB-8EVI-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.64 }, "provenance": { "deposit_id": "8EVI", "doi": "10.1038/s41594-023-01189-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8EVI" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "CX3CR1 nucleosome and PU.1 complex containing disulfide bond mutations" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8EVH", "evidence_id": "EV-PDB-8EVH-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.85 }, "provenance": { "deposit_id": "8EVH", "doi": "10.1038/s41594-023-01189-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8EVH" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "CX3CR1 nucleosome and wild type PU.1 complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8EVG", "evidence_id": "EV-PDB-8EVG-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.75 }, "provenance": { "deposit_id": "8EVG", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8EVG" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "162bp CX3CR1 nucleosome (further classified with better nucleosome end)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8DK5", "evidence_id": "EV-PDB-8DK5-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.71 }, "provenance": { "deposit_id": "8DK5", "doi": "10.1016/j.molcel.2023.05.030", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8DK5" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of 187bp LIN28b nucleosome with site 0 mutation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7YQK", "evidence_id": "EV-PDB-7YQK-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.38 }, "provenance": { "deposit_id": "7YQK", "doi": "10.1021/jacs.2c06156", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7YQK" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "cryo-EM structure of gammaH2AXK15ub-H4K20me2 nucleosome bound to 53BP1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,C,E,G)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7YOZ", "evidence_id": "EV-PDB-7YOZ-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.3 }, "provenance": { "deposit_id": "7YOZ", "doi": "10.1073/pnas.2206542119", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7YOZ" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of human subnucleosome (intermediate form)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ADP", "BEF", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7Y8R", "evidence_id": "EV-PDB-7Y8R-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.4 }, "provenance": { "deposit_id": "7Y8R", "doi": "10.1038/s41467-022-34859-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7Y8R" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "The nucleosome-bound human PBAF complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,C,E,G)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7Y61", "evidence_id": "EV-PDB-7Y61-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 5.6 }, "provenance": { "deposit_id": "7Y61", "doi": "10.1126/science.add8673", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7Y61" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the two CAF1LCs bound right-handed Di-tetrasome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,C,E,G)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7Y60", "evidence_id": "EV-PDB-7Y60-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.8 }, "provenance": { "deposit_id": "7Y60", "doi": "10.1126/science.add8673", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7Y60" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of human CAF1LC bound right-handed Di-tetrasome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,C,E,G)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7Y5W", "evidence_id": "EV-PDB-7Y5W-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.5 }, "provenance": { "deposit_id": "7Y5W", "doi": "10.1126/science.add8673", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7Y5W" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the left-handed Di-tetrasome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7Y5U", "evidence_id": "EV-PDB-7Y5U-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.8 }, "provenance": { "deposit_id": "7Y5U", "doi": "10.1126/science.add8673", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7Y5U" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the monomeric human CAF1LC-H3-H4 complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7Y00", "evidence_id": "EV-PDB-7Y00-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.96 }, "provenance": { "deposit_id": "7Y00", "doi": "10.1093/pnasnexus/pgac177", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7Y00" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the nucleosome containing 169 base-pair DNA with a p53 target sequence" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JND", "evidence_id": "EV-PDB-8JND-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.66 }, "provenance": { "deposit_id": "8JND", "doi": "10.1038/s41586-024-07196-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JND" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "The cryo-EM structure of the nonameric RAD51 ring bound to the nucleosome with the linker DNA binding" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JNE", "evidence_id": "EV-PDB-8JNE-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.68 }, "provenance": { "deposit_id": "8JNE", "doi": "10.1038/s41586-024-07196-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JNE" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "The cryo-EM structure of the decameric RAD51 ring bound to the nucleosome without the linker DNA binding" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JNF", "evidence_id": "EV-PDB-8JNF-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 6.91 }, "provenance": { "deposit_id": "8JNF", "doi": "10.1038/s41586-024-07196-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JNF" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "The cryo-EM structure of the RAD51 filament bound to the nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ADP", "ALF", "ATP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains M,Q)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8OOP", "evidence_id": "EV-PDB-8OOP-9", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "8OOP", "doi": "10.1126/science.adf6287", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8OOP" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "CryoEM Structure INO80core Hexasome complex composite model state2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8OSK", "evidence_id": "EV-PDB-8OSK-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.6 }, "provenance": { "deposit_id": "8OSK", "doi": "10.1038/s41586-023-06282-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8OSK" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of CLOCK-BMAL1 bound to a nucleosomal E-box at position SHL+5.8 (composite map)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AU", "MG", "XIS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -175.15 }, "construct": { "description": "Histone H3.1 (chains AAA,EEE)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8Q3X", "evidence_id": "EV-PDB-8Q3X-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.301 }, "provenance": { "deposit_id": "8Q3X", "doi": "10.1039/d4ra01617c", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8Q3X" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Nucleosome Core with a Bound Metallopeptide Conjugate (Kaposi Sarcoma Associated Herpesvirus LANA Peptide-Au[I] Compound)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8U13", "evidence_id": "EV-PDB-8U13-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.8 }, "provenance": { "deposit_id": "8U13", "doi": "10.1016/j.molcel.2023.12.036", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8U13" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome core particle ubiquitylated at histone H2A lysine 15 in complex with RNF168-UbcH5c (class 1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8TXX", "evidence_id": "EV-PDB-8TXX-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.7 }, "provenance": { "deposit_id": "8TXX", "doi": "10.1016/j.molcel.2023.12.036", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8TXX" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome core particle ubiquitylated at histone H2A K15 in complex with RNF168 (Class 3)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8TXW", "evidence_id": "EV-PDB-8TXW-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.6 }, "provenance": { "deposit_id": "8TXW", "doi": "10.1016/j.molcel.2023.12.036", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8TXW" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome core particle ubiquitylated at histone H2A K15 in complex with RNF168 (Class 2)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8TXV", "evidence_id": "EV-PDB-8TXV-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.8 }, "provenance": { "deposit_id": "8TXV", "doi": "10.1016/j.molcel.2023.12.036", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8TXV" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome core particle ubiquitylated at histone H2A K15 in complex with RNF168 (Class 1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SYP", "evidence_id": "EV-PDB-8SYP-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "8SYP", "doi": "10.1038/s41594-023-01189-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SYP" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Genomic CX3CR1 nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3 peptided (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SWI", "evidence_id": "EV-PDB-8SWI-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "8SWI", "doi": "10.1128/mbio.01655-23", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SWI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of legAS4 from Legionella pneumophila subsp. pneumophila with histone H3 (1-12)peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SPU", "evidence_id": "EV-PDB-8SPU-4", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "8SPU", "doi": "10.1016/j.molcel.2023.05.030", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SPU" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of ESRRB nucleosome bound OCT4 at site c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SPS", "evidence_id": "EV-PDB-8SPS-4", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "8SPS", "doi": "10.1016/j.molcel.2023.05.030", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SPS" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "High resolution structure of ESRRB nucleosome bound OCT4 at site a and site b" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SNA", "evidence_id": "EV-PDB-8SNA-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.0 }, "provenance": { "deposit_id": "8SNA", "doi": "10.1016/j.molcel.2023.12.036", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SNA" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome core particle in complex with RNF168 and UbcH5c with backside ubiquitin (UbcH5c chemically conjugated to histone H2A) (class 2)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SN9", "evidence_id": "EV-PDB-8SN9-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.9 }, "provenance": { "deposit_id": "8SN9", "doi": "10.1016/j.molcel.2023.12.036", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SN9" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome core particle in complex with RNF168 and UbcH5c with backside ubiquitin (UbcH5c chemically conjugated to histone H2A) (class 1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SN8", "evidence_id": "EV-PDB-8SN8-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.7 }, "provenance": { "deposit_id": "8SN8", "doi": "10.1016/j.molcel.2023.12.036", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SN8" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome core particle in complex with RNF168 and UbcH5c~Ub (UbcH5c chemically conjugated to histone H2A) (class 6)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SN7", "evidence_id": "EV-PDB-8SN7-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.7 }, "provenance": { "deposit_id": "8SN7", "doi": "10.1016/j.molcel.2023.12.036", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SN7" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome core particle in complex with RNF168 and UbcH5c~Ub (UbcH5c chemically conjugated to histone H2A) (class 5)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SN6", "evidence_id": "EV-PDB-8SN6-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.7 }, "provenance": { "deposit_id": "8SN6", "doi": "10.1016/j.molcel.2023.12.036", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SN6" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome core particle in complex with RNF168 and UbcH5c~Ub (UbcH5c chemically conjugated to histone H2A) (class 4)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SN5", "evidence_id": "EV-PDB-8SN5-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.9 }, "provenance": { "deposit_id": "8SN5", "doi": "10.1016/j.molcel.2023.12.036", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SN5" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome core particle in complex with RNF168 and UbcH5c~Ub (UbcH5c chemically conjugated to histone H2A) (class 3)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SN4", "evidence_id": "EV-PDB-8SN4-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.7 }, "provenance": { "deposit_id": "8SN4", "doi": "10.1016/j.molcel.2023.12.036", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SN4" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome core particle in complex with RNF168 and UbcH5c~Ub (UbcH5c chemically conjugated to histone H2A) (class 2)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SN3", "evidence_id": "EV-PDB-8SN3-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.8 }, "provenance": { "deposit_id": "8SN3", "doi": "10.1016/j.molcel.2023.12.036", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SN3" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome core particle in complex with RNF168 and UbcH5c~Ub (UbcH5c chemically conjugated to histone H2A) (class 1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SN2", "evidence_id": "EV-PDB-8SN2-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.6 }, "provenance": { "deposit_id": "8SN2", "doi": "10.1016/j.molcel.2023.12.036", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SN2" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome core particle in complex with RNF168 and UbcH5c (UbcH5c chemically conjugated to histone H2A)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SN1", "evidence_id": "EV-PDB-8SN1-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.3 }, "provenance": { "deposit_id": "8SN1", "doi": "10.1016/j.molcel.2023.12.036", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SN1" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome core particle in complex with RNF168 and UbcH5c~Ub (UbcH5c chemically conjugated to histone H2A. No density for Ub.) (class 6)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SN0", "evidence_id": "EV-PDB-8SN0-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "8SN0", "doi": "10.1016/j.molcel.2023.12.036", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SN0" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome core particle in complex with RNF168 and UbcH5c~Ub (UbcH5c chemically conjugated to histone H2A. No density for Ub.) (class 5)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SMZ", "evidence_id": "EV-PDB-8SMZ-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "8SMZ", "doi": "10.1016/j.molcel.2023.12.036", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SMZ" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome core particle in complex with RNF168 and UbcH5c~Ub (UbcH5c chemically conjugated to histone H2A. No density for Ub.) (Class 4)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SMY", "evidence_id": "EV-PDB-8SMY-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "8SMY", "doi": "10.1016/j.molcel.2023.12.036", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SMY" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome core particle in complex with RNF168 and UbcH5c~Ub (UbcH5c chemically conjugated to histone H2A. No density for Ub.) (class 3)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SMX", "evidence_id": "EV-PDB-8SMX-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "8SMX", "doi": "10.1016/j.molcel.2023.12.036", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SMX" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome core particle in complex with RNF168 and UbcH5c~Ub (UbcH5c chemically conjugated to histone H2A. No density for Ub.) (class 2)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SMW", "evidence_id": "EV-PDB-8SMW-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.3 }, "provenance": { "deposit_id": "8SMW", "doi": "10.1016/j.molcel.2023.12.036", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SMW" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome core particle in complex with RNF168 and UbcH5c~Ub (UbcH5c chemically conjugated to histone H2A. No density for Ub.) (class 1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8RGM", "evidence_id": "EV-PDB-8RGM-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.0 }, "provenance": { "deposit_id": "8RGM", "doi": "10.1016/j.str.2025.02.007", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8RGM" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of nucleosome containing Widom603 DNA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains AAA,EEE,KKK,OOO)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8QKT", "evidence_id": "EV-PDB-8QKT-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.261 }, "provenance": { "deposit_id": "8QKT", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8QKT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of a nucleosome composed of a palindromic 167-base pair blunt-ended DNA fragment" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -175.15 }, "construct": { "description": "Histone H3.1 (chains AAA,EEE)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8Q3M", "evidence_id": "EV-PDB-8Q3M-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.503 }, "provenance": { "deposit_id": "8Q3M", "doi": "10.1039/d4ra01617c", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8Q3M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Nucleosome Core with a Bound Kaposi Sarcoma Associated Herpesvirus LANA Peptide Having a Methionine to Ornithine Substitution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -175.15 }, "construct": { "description": "Histone H3.1 (chains AAA,EEE)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8Q3E", "evidence_id": "EV-PDB-8Q3E-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.174 }, "provenance": { "deposit_id": "8Q3E", "doi": "10.1039/d4ra01617c", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8Q3E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High Resolution Structure of Nucleosome Core with Bound Foamy Virus GAG Peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -175.15 }, "construct": { "description": "Histone H3.1 (chains AAA,EEE)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8Q36", "evidence_id": "EV-PDB-8Q36-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.604 }, "provenance": { "deposit_id": "8Q36", "doi": "10.1039/d4ra01617c", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8Q36" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Nucleosome Core with a Bound Metallopeptide Conjugate (Foamy Virus GAG Peptide-Au[I] Compound)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8OX1", "evidence_id": "EV-PDB-8OX1-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "8OX1", "doi": "10.1126/sciadv.adi4148", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8OX1" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of TRF1core in complex with telomeric nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8OX0", "evidence_id": "EV-PDB-8OX0-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.52 }, "provenance": { "deposit_id": "8OX0", "doi": "10.1126/sciadv.adi4148", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8OX0" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of apo telomeric nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PTD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8OTT", "evidence_id": "EV-PDB-8OTT-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.3 }, "provenance": { "deposit_id": "8OTT", "doi": "10.1038/s41586-023-06282-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8OTT" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "MYC-MAX bound to a nucleosome at SHL+5.8" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PTD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8OTS", "evidence_id": "EV-PDB-8OTS-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.3 }, "provenance": { "deposit_id": "8OTS", "doi": "10.1038/s41586-023-06282-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8OTS" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "OCT4 and MYC-MAX co-bound to a nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8OSL", "evidence_id": "EV-PDB-8OSL-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.9 }, "provenance": { "deposit_id": "8OSL", "doi": "10.1038/s41586-023-06282-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8OSL" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of CLOCK-BMAL1 bound to the native Por enhancer nucleosome (map 2, additional 3D classification and flexible refinement)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8OSJ", "evidence_id": "EV-PDB-8OSJ-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 6.2 }, "provenance": { "deposit_id": "8OSJ", "doi": "10.1038/s41586-023-06282-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8OSJ" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of CLOCK-BMAL1 bound to a nucleosomal E-box at position SHL-6.2 (DNA conformation 1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ADP", "ALF", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains M,Q)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8OOS", "evidence_id": "EV-PDB-8OOS-4", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.29 }, "provenance": { "deposit_id": "8OOS", "doi": "10.1126/science.adf6287", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8OOS" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "CryoEM Structure INO80core Hexasome complex ATPase-hexasome refinement state 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains M,Q)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8OOA", "evidence_id": "EV-PDB-8OOA-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.18 }, "provenance": { "deposit_id": "8OOA", "doi": "10.1126/science.adf6287", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8OOA" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "CryoEM Structure INO80core Hexasome complex Hexasome refinement state1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ADP", "ALF", "ATP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains M,Q)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8OO7", "evidence_id": "EV-PDB-8OO7-9", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "8OO7", "doi": "10.1126/science.adf6287", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8OO7" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "CryoEM Structure INO80core Hexasome complex composite model state1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains Ca,Cb)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8OFF", "evidence_id": "EV-PDB-8OFF-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.4 }, "provenance": { "deposit_id": "8OFF", "doi": "10.1093/nar/gkad793", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8OFF" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of BARD1 ARD-BRCTs in complex with H2AKc15ub nucleosomes (Map1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8KE0", "evidence_id": "EV-PDB-8KE0-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.0 }, "provenance": { "deposit_id": "8KE0", "doi": "10.1038/s41594-025-01493-w", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8KE0" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of H1.2 bound to the nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8KD1", "evidence_id": "EV-PDB-8KD1-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "8KD1", "doi": "10.1038/s41594-025-01493-w", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8KD1" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of nucleosome complexed with one DEK molecule" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8KCY", "evidence_id": "EV-PDB-8KCY-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "8KCY", "doi": "10.1038/s41594-025-01493-w", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8KCY" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of nucleosome complexed with two DEK molecules" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JLA", "evidence_id": "EV-PDB-8JLA-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.44 }, "provenance": { "deposit_id": "8JLA", "doi": "10.1093/nar/gkad754", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JLA" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome lacking N-terminal region of H2A, H2B, H3, and H4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JL9", "evidence_id": "EV-PDB-8JL9-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.65 }, "provenance": { "deposit_id": "8JL9", "doi": "10.1093/nar/gkad754", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JL9" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome with scFv" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAM", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JHG", "evidence_id": "EV-PDB-8JHG-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.58 }, "provenance": { "deposit_id": "8JHG", "doi": "10.1038/s41421-023-00620-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JHG" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Native SUV420H1 bound to 167-bp nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8U14", "evidence_id": "EV-PDB-8U14-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.9 }, "provenance": { "deposit_id": "8U14", "doi": "10.1016/j.molcel.2023.12.036", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8U14" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome core particle ubiquitylated at histone H2A lysine 15 in complex with RNF168-UbcH5c (class 2)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8UBJ", "evidence_id": "EV-PDB-8UBJ-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "8UBJ", "doi": "10.1016/j.molcel.2026.05.020", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8UBJ" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of NRCAM nucleosome aided by scFv (3D Flex map)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8VG1", "evidence_id": "EV-PDB-8VG1-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.48 }, "provenance": { "deposit_id": "8VG1", "doi": "10.1016/j.molcel.2024.07.016", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8VG1" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of FoxA1 and GATA4 in complex with ALBN1 nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "H3K36me3-modified histone H3 (chains I)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8VNV", "evidence_id": "EV-PDB-8VNV-8", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "8VNV", "doi": "10.1038/s41594-024-01452-x", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8VNV" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "PRC2_AJ1-450 bound to H3K36me3 with histone H3 tail engaged" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ADP", "ATP" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains C,G)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8X15", "evidence_id": "EV-PDB-8X15-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "8X15", "doi": "10.1038/s41421-023-00640-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8X15" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of nucleosome-bound SRCAP-C in the apo state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ADP", "ATP", "BEF", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains C,G)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8X19", "evidence_id": "EV-PDB-8X19-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "8X19", "doi": "10.1038/s41421-023-00640-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8X19" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of nucleosome-bound SRCAP-C in the ADP-BeFx-bound state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ADP", "ATP" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains C,G)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8X1C", "evidence_id": "EV-PDB-8X1C-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "8X1C", "doi": "10.1038/s41421-023-00640-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8X1C" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of nucleosome-bound SRCAP-C in the ADP-bound state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8XBT", "evidence_id": "EV-PDB-8XBT-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.12 }, "provenance": { "deposit_id": "8XBT", "doi": "10.1038/s41586-024-07196-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8XBT" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "The cryo-EM structure of the octameric RAD51 ring bound to the nucleosome with the linker DNA binding" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8YBJ", "evidence_id": "EV-PDB-8YBJ-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.38 }, "provenance": { "deposit_id": "8YBJ", "doi": "10.1111/gtc.13143", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8YBJ" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of human nucleosome core particle composed of the Widom 601 DNA sequence" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains M,Q)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9GE4", "evidence_id": "EV-PDB-9GE4-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.52 }, "provenance": { "deposit_id": "9GE4", "doi": "10.1093/nar/gkag138", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9GE4" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "CryoEM structure of the human INO80 core- H2A.Z nucleosome complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ADP", "ATP", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains M,Q)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9GCG", "evidence_id": "EV-PDB-9GCG-9", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.43 }, "provenance": { "deposit_id": "9GCG", "doi": "10.1093/nar/gkag138", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9GCG" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "CryoEM structure of the human INO80 core- H2A.Z nucleosome complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9FH9", "evidence_id": "EV-PDB-9FH9-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "9FH9", "doi": "10.1038/s44318-024-00194-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9FH9" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of CyclinB1 N-terminus bound to the NCP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9FGQ", "evidence_id": "EV-PDB-9FGQ-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "9FGQ", "doi": "10.1038/s44318-024-00194-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9FGQ" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of human APC3loop 375-381 bound to the NCP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MES" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains Q,R,S,T,U,V,W,X,Y,Z,a,b,c,d,e,f)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9EHI", "evidence_id": "EV-PDB-9EHI-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "9EHI", "doi": "10.1016/j.str.2025.04.010", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9EHI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of ENL YEATS in complex with histone H3 methacrylated at K18" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9ECP", "evidence_id": "EV-PDB-9ECP-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.91 }, "provenance": { "deposit_id": "9ECP", "doi": "10.1101/2025.10.10.681767", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9ECP" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of the native human NCP purified from HEK293 cells" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF/IHM", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9A9W", "evidence_id": "EV-PDB-9A9W-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "9A9W", "doi": "10.1016/j.molcel.2025.06.027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9A9W" }, "reader": null, "source_kind": "deposit", "technique": "integrative", "title": "USP7 bound to a nucleosome/p53 complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains G,H)", "labels": [] }, "data_format": "mmCIF/IHM", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9A8I", "evidence_id": "EV-PDB-9A8I-5", "mappings": [], "molecule_id": "P68431", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "9A8I", "doi": "10.1073/pnas.2318601121", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9A8I" }, "reader": null, "source_kind": "deposit", "technique": "integrative", "title": "Integrative structure of the human WDR76-SPIN1-Nucleosome complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF/IHM", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9A3P", "evidence_id": "EV-PDB-9A3P-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "9A3P", "doi": "10.1038/s41586-023-06282-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9A3P" }, "reader": null, "source_kind": "deposit", "technique": "integrative", "title": "CLOCK-BMAL1 bound to the native Por nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF/IHM", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9A3O", "evidence_id": "EV-PDB-9A3O-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "9A3O", "doi": "10.1038/s41586-023-06282-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9A3O" }, "reader": null, "source_kind": "deposit", "technique": "integrative", "title": "CLOCK-BMAL1 bound to a nucleosome at SHL -6.2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "H3 (chains X,x)", "labels": [] }, "data_format": "mmCIF/IHM", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9A0K", "evidence_id": "EV-PDB-9A0K-13", "mappings": [], "molecule_id": "P68431", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "9A0K", "doi": "10.1016/j.cell.2020.09.051", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9A0K" }, "reader": null, "source_kind": "deposit", "technique": "integrative", "title": "A structural model of the endogenoushuman SWI/SNF (BAF) complex bound to the nucleosome informs disease mechanisms" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8YV8", "evidence_id": "EV-PDB-8YV8-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "8YV8", "doi": "10.1126/sciadv.adp5753", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8YV8" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of CDCA7 bound to nucleosome including hemimethylated CpG site in Widom601 positioning sequence." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "CL", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -175.15 }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8YTI", "evidence_id": "EV-PDB-8YTI-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "8YTI", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8YTI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Nucleosome-H1x Linker Histone Assembly (sticky-169a DNA fragment)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8YNY", "evidence_id": "EV-PDB-8YNY-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.52 }, "provenance": { "deposit_id": "8YNY", "doi": "10.1038/s41467-024-54768-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8YNY" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of Cas9-sgRNA ribonucleoprotein bound to nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains C,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8YJM", "evidence_id": "EV-PDB-8YJM-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.15 }, "provenance": { "deposit_id": "8YJM", "doi": "10.1007/s11427-024-2560-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8YJM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of human SPT16 MD-CTD and MCM2 HBD chaperoning a histone H3-H4 tetramer and a single chain H2B-H2A chimera" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains C,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8YJF", "evidence_id": "EV-PDB-8YJF-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.4 }, "provenance": { "deposit_id": "8YJF", "doi": "10.1007/s11427-024-2560-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8YJF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of human SPT16 MD-CTD and MCM2 HBD chaperoning a histone H3-H4 tetramer and an H2A-H2B dimer" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8YBK", "evidence_id": "EV-PDB-8YBK-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.69 }, "provenance": { "deposit_id": "8YBK", "doi": "10.1111/gtc.13143", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8YBK" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome containing the H3.1 E97K mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8Y3F", "evidence_id": "EV-PDB-8Y3F-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.54 }, "provenance": { "deposit_id": "8Y3F", "doi": "10.1093/pnasnexus/pgae484", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8Y3F" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the overlapping di-nucleosome (intermediate form1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8Y3E", "evidence_id": "EV-PDB-8Y3E-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 5.32 }, "provenance": { "deposit_id": "8Y3E", "doi": "10.1093/pnasnexus/pgae484", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8Y3E" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the overlapping di-nucleosome (open form)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8Y3D", "evidence_id": "EV-PDB-8Y3D-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 5.1 }, "provenance": { "deposit_id": "8Y3D", "doi": "10.1093/pnasnexus/pgae484", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8Y3D" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the overlapping di-nucleosome (intermediate form2)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8Y3C", "evidence_id": "EV-PDB-8Y3C-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 5.21 }, "provenance": { "deposit_id": "8Y3C", "doi": "10.1093/pnasnexus/pgae484", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8Y3C" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the overlapping di-nucleosome (closed form)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains a,e)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8XVS", "evidence_id": "EV-PDB-8XVS-16", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.1 }, "provenance": { "deposit_id": "8XVS", "doi": "10.1038/s41467-025-59580-x", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8XVS" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "RNA polymerase II elongation complex with downstream nucleosome extracted from human nuclei" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains a,e)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8XRJ", "evidence_id": "EV-PDB-8XRJ-16", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.6 }, "provenance": { "deposit_id": "8XRJ", "doi": "10.1038/s41467-025-59580-x", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8XRJ" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "RNA polymerase II elongation complex with upstream nucleosome extracted from human nuclei" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8XBW", "evidence_id": "EV-PDB-8XBW-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.89 }, "provenance": { "deposit_id": "8XBW", "doi": "10.1038/s41586-024-07196-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8XBW" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "The cryo-EM structure of the RAD51 N-terminal lobe domain bound to the histone H4 tail of the nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8XBU", "evidence_id": "EV-PDB-8XBU-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.24 }, "provenance": { "deposit_id": "8XBU", "doi": "10.1038/s41586-024-07196-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8XBU" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "The cryo-EM structure of the decameric RAD51 ring bound to the nucleosome with the linker DNA binding" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8WG5", "evidence_id": "EV-PDB-8WG5-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.05 }, "provenance": { "deposit_id": "8WG5", "doi": "10.1038/s41594-024-01342-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8WG5" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of USP16 bound to H2AK119Ub nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains a,e)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8W9F", "evidence_id": "EV-PDB-8W9F-5", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.4 }, "provenance": { "deposit_id": "8W9F", "doi": "10.1126/sciadv.adk7678", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8W9F" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the Rpd3S-nucleosome complex from budding yeast in State 3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains a,e)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8W9E", "evidence_id": "EV-PDB-8W9E-5", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.6 }, "provenance": { "deposit_id": "8W9E", "doi": "10.1126/sciadv.adk7678", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8W9E" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the Rpd3S-nucleosome complex from budding yeast in State 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains a,e)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8W9D", "evidence_id": "EV-PDB-8W9D-5", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.9 }, "provenance": { "deposit_id": "8W9D", "doi": "10.1126/sciadv.adk7678", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8W9D" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the Rpd3S-nucleosome complex from budding yeast in State 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3 (chains I)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8VML", "evidence_id": "EV-PDB-8VML-4", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.5 }, "provenance": { "deposit_id": "8VML", "doi": "10.1038/s41594-024-01452-x", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8VML" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "PRC2_AJ1-450 bound to H3K4me3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains B)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8VMI", "evidence_id": "EV-PDB-8VMI-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "8VMI", "doi": "10.1038/s41594-024-01452-x", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8VMI" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "PRC2_AJ119-450 bound to H3K4me3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8VLR", "evidence_id": "EV-PDB-8VLR-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "8VLR", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8VLR" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of native H2AK119bu nucleosome at 2.6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8VG2", "evidence_id": "EV-PDB-8VG2-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.04 }, "provenance": { "deposit_id": "8VG2", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8VG2" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of FoxA1 and GATA4 in complex with H14 chromatosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8VG0", "evidence_id": "EV-PDB-8VG0-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.07 }, "provenance": { "deposit_id": "8VG0", "doi": "10.1016/j.molcel.2024.07.016", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8VG0" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of GATA4 in complex with ALBN1 nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8VFZ", "evidence_id": "EV-PDB-8VFZ-5", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.1 }, "provenance": { "deposit_id": "8VFZ", "doi": "10.1016/j.molcel.2024.07.016", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8VFZ" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of FoxA1 in complex with ALBN1 nucleosome (class 2)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8VFY", "evidence_id": "EV-PDB-8VFY-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.89 }, "provenance": { "deposit_id": "8VFY", "doi": "10.1016/j.molcel.2024.07.016", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8VFY" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of FoxA1 in complex with ALBN1 nucleosome (class 1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8VFX", "evidence_id": "EV-PDB-8VFX-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.65 }, "provenance": { "deposit_id": "8VFX", "doi": "10.1016/j.molcel.2024.07.016", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8VFX" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of 186bp ALBN1 nucleosome aided by scFv" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8UPF", "evidence_id": "EV-PDB-8UPF-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "8UPF", "doi": "10.1016/j.molcel.2023.12.036", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8UPF" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human nucleosome core particle in complex with RNF168-UbcH5c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8UBL", "evidence_id": "EV-PDB-8UBL-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "8UBL", "doi": "10.1016/j.molcel.2026.05.020", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8UBL" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of Ascl1/E12a in complex with NRCAM nucleosome (3D Flex map)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8UBK", "evidence_id": "EV-PDB-8UBK-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "8UBK", "doi": "10.1016/j.molcel.2026.05.020", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8UBK" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of Ascl1/E12a in complex with NRCAM nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8U9S", "evidence_id": "EV-PDB-8U9S-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "8U9S", "doi": "10.1016/j.molcel.2026.05.020", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8U9S" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of NRCAM nucleosome aided by scFv" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ADP", "ATP", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains M,Q)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9GE5", "evidence_id": "EV-PDB-9GE5-9", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.35 }, "provenance": { "deposit_id": "9GE5", "doi": "10.1093/nar/gkag138", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9GE5" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "CryoEM structure of the human INO80-Hexasome complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains M,Q)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9GEL", "evidence_id": "EV-PDB-9GEL-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.86 }, "provenance": { "deposit_id": "9GEL", "doi": "10.1093/nar/gkag138", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9GEL" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "CryoEM structure of the human INO80-Hexasome complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ADP", "ATP" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains M,Q)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9GEV", "evidence_id": "EV-PDB-9GEV-6", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.47 }, "provenance": { "deposit_id": "9GEV", "doi": "10.1093/nar/gkag138", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9GEV" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "CryoEM structure of the human INO80 core-nucleosome complex state N-6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains M,Q)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9GF6", "evidence_id": "EV-PDB-9GF6-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.8 }, "provenance": { "deposit_id": "9GF6", "doi": "10.1093/nar/gkag138", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9GF6" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "CryoEM structure of the human INO80 core-nucleosome complex state N-6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ADP", "ATP", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains M,Q)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9GFB", "evidence_id": "EV-PDB-9GFB-9", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.55 }, "provenance": { "deposit_id": "9GFB", "doi": "10.1093/nar/gkag138", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9GFB" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "CryoEM structure of the human INO80 core-nucleosome complex state N-7" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains M)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9GFM", "evidence_id": "EV-PDB-9GFM-4", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.8 }, "provenance": { "deposit_id": "9GFM", "doi": "10.1093/nar/gkag138", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9GFM" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "CryoEM structure of the human INO80 core-nucleosome complex state N-7" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains Q)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9GFM", "evidence_id": "EV-PDB-9GFM-8", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.8 }, "provenance": { "deposit_id": "9GFM", "doi": "10.1093/nar/gkag138", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9GFM" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "CryoEM structure of the human INO80 core-nucleosome complex state N-7" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9IGW", "evidence_id": "EV-PDB-9IGW-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.32 }, "provenance": { "deposit_id": "9IGW", "doi": "10.1038/s41467-025-67376-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9IGW" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Ku70/80 bound to 147 bp nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9IGX", "evidence_id": "EV-PDB-9IGX-5", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.56 }, "provenance": { "deposit_id": "9IGX", "doi": "10.1038/s41467-025-67376-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9IGX" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Ku70/80 bound to 153 bp nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9J8M", "evidence_id": "EV-PDB-9J8M-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.82 }, "provenance": { "deposit_id": "9J8M", "doi": "10.1038/s41467-025-56823-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9J8M" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of BAF-Lamin A/C IgF-nucleosome complex (High mobility complex)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,a,e)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9J8N", "evidence_id": "EV-PDB-9J8N-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 7.14 }, "provenance": { "deposit_id": "9J8N", "doi": "10.1038/s41467-025-56823-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9J8N" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of BAF-Lamin A/C IgF-nucleosome complex (Low mobility complex)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,a,e)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9J8O", "evidence_id": "EV-PDB-9J8O-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.05 }, "provenance": { "deposit_id": "9J8O", "doi": "10.1038/s41467-025-56823-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9J8O" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of BAF-Lamin A/C IgF-H1-nucleosome complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9J8W", "evidence_id": "EV-PDB-9J8W-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.38 }, "provenance": { "deposit_id": "9J8W", "doi": "10.1038/s41467-025-65486-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9J8W" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of NCP-UV-DDB complex containing CPD" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9JC6", "evidence_id": "EV-PDB-9JC6-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.34 }, "provenance": { "deposit_id": "9JC6", "doi": "10.1093/nar/gkaf825", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9JC6" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Human H2BW2 nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,L,P)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9MLL", "evidence_id": "EV-PDB-9MLL-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.7 }, "provenance": { "deposit_id": "9MLL", "doi": "10.1093/nar/gkaf1028", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9MLL" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "GammaH2AX containing nucleosomes, Parallel stack" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9MLN", "evidence_id": "EV-PDB-9MLN-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.3 }, "provenance": { "deposit_id": "9MLN", "doi": "10.1093/nar/gkaf1028", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9MLN" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "GammaH2AX containing nucleosome, Canonical (Class 1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9MLR", "evidence_id": "EV-PDB-9MLR-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "9MLR", "doi": "10.1093/nar/gkaf1028", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9MLR" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "GammaH2AX containing nucleosome, Half-wrapped (Class 2)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9MLS", "evidence_id": "EV-PDB-9MLS-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.6 }, "provenance": { "deposit_id": "9MLS", "doi": "10.1093/nar/gkaf1028", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9MLS" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "GammaH2AX containing nucleosome, Extended (Class 3)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9MMK", "evidence_id": "EV-PDB-9MMK-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "9MMK", "doi": "10.1093/nar/gkaf1028", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9MMK" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "H2AX containing nucleosome, Canonical (Class 1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,L,P)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9MMM", "evidence_id": "EV-PDB-9MMM-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.0 }, "provenance": { "deposit_id": "9MMM", "doi": "10.1093/nar/gkaf1028", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9MMM" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "H2AX containing nucleosomes, Parallel stack" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,L,P)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9MMO", "evidence_id": "EV-PDB-9MMO-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.9 }, "provenance": { "deposit_id": "9MMO", "doi": "10.1093/nar/gkaf1028", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9MMO" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "H2AX containing nucleosomes, Right offset stack" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9MMT", "evidence_id": "EV-PDB-9MMT-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.4 }, "provenance": { "deposit_id": "9MMT", "doi": "10.1093/nar/gkaf1028", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9MMT" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "H2AX containing nucleosome, Unwrapped (Class 2)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9Q8X", "evidence_id": "EV-PDB-9Q8X-5", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.94 }, "provenance": { "deposit_id": "9Q8X", "doi": "10.1038/s41467-025-67376-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9Q8X" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Ku70/80 bound to a 153 bp H2AX nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9Q9F", "evidence_id": "EV-PDB-9Q9F-8", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.54 }, "provenance": { "deposit_id": "9Q9F", "doi": "10.1038/s41467-025-67376-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9Q9F" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "DNA-PK bound to a 153 bp H2AX nucleosome model 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9QCR", "evidence_id": "EV-PDB-9QCR-6", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.37 }, "provenance": { "deposit_id": "9QCR", "doi": "10.1038/s41467-025-67376-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9QCR" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "DNA-PK bound to 153 bp H2AX nucleosome model 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,a,e)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9QCS", "evidence_id": "EV-PDB-9QCS-4", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.38 }, "provenance": { "deposit_id": "9QCS", "doi": "10.1038/s41467-025-67376-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9QCS" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Ku80 mediated DNA-PK dimer bound to 153 bp H2AX nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,a,e)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9QMS", "evidence_id": "EV-PDB-9QMS-5", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 5.0 }, "provenance": { "deposit_id": "9QMS", "doi": "10.1038/s41467-025-67376-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9QMS" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "DNA-PK bound to 153 bp H2AX nucleosome with ATPyS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9R04", "evidence_id": "EV-PDB-9R04-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.2 }, "provenance": { "deposit_id": "9R04", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9R04" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "p53 bound to the nucleosome at position SHL-5.7 (crosslinked sample)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9R2M", "evidence_id": "EV-PDB-9R2M-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.5 }, "provenance": { "deposit_id": "9R2M", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9R2M" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "p53 bound to nucleosome at position SHL+5.9 (non-crosslinked sample, composite map)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9R2P", "evidence_id": "EV-PDB-9R2P-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.18 }, "provenance": { "deposit_id": "9R2P", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9R2P" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "p53 bound to nucleosome at position SHL+5.9 (crosslinked sample)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9R2Q", "evidence_id": "EV-PDB-9R2Q-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "9R2Q", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9R2Q" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "p53 bound to nucleosome at position SHL-5.7 (non-crosslinked sample)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "COA", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9R2U", "evidence_id": "EV-PDB-9R2U-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "9R2U", "doi": "10.1016/j.molcel.2026.09.019", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9R2U" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Drosophila MSL HAT nucleosome complex H4K16ac post-catalytic state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9R2W", "evidence_id": "EV-PDB-9R2W-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.4 }, "provenance": { "deposit_id": "9R2W", "doi": "10.1016/j.molcel.2026.09.019", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9R2W" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Drosophila MSL HAT nucleosome complex H3K36me3 reader state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "COA", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9R2Y", "evidence_id": "EV-PDB-9R2Y-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.4 }, "provenance": { "deposit_id": "9R2Y", "doi": "10.1016/j.molcel.2026.09.019", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9R2Y" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Drosophila MSL HAT nucleosome complex H4K16ac postcatalytic H3K36me3 reader state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PTD", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RL4", "evidence_id": "EV-PDB-9RL4-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.5 }, "provenance": { "deposit_id": "9RL4", "doi": "10.1016/j.molcel.2026.01.021", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RL4" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL-6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RMC", "evidence_id": "EV-PDB-9RMC-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.2 }, "provenance": { "deposit_id": "9RMC", "doi": "10.1016/j.molcel.2026.01.021", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RMC" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL+6 class 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RN1", "evidence_id": "EV-PDB-9RN1-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 5.9 }, "provenance": { "deposit_id": "9RN1", "doi": "10.1016/j.molcel.2026.01.021", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RN1" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of BAF-nucleosome complex with OCT4-SOX2 at SHL+6 in ADP-bound state, BAF47 bound to ATPase lobe 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RN2", "evidence_id": "EV-PDB-9RN2-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.1 }, "provenance": { "deposit_id": "9RN2", "doi": "10.1016/j.molcel.2026.01.021", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RN2" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL+6 class 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains a,c,e,g)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9UJS", "evidence_id": "EV-PDB-9UJS-16", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.62 }, "provenance": { "deposit_id": "9UJS", "doi": "10.1016/j.jbc.2026.111340", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9UJS" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "RNA polymerase II elongation complex stalled at SHL(-4) of the H3-H4 octasome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains B)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9UZ7", "evidence_id": "EV-PDB-9UZ7-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.24 }, "provenance": { "deposit_id": "9UZ7", "doi": "10.1093/procel/pwaf094", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9UZ7" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the nucleosome core particle with site-specific DNA-histone crosslinking" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9UZ7", "evidence_id": "EV-PDB-9UZ7-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.24 }, "provenance": { "deposit_id": "9UZ7", "doi": "10.1093/procel/pwaf094", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9UZ7" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the nucleosome core particle with site-specific DNA-histone crosslinking" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9V6Q", "evidence_id": "EV-PDB-9V6Q-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.6 }, "provenance": { "deposit_id": "9V6Q", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9V6Q" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of two cPRC1 complexes bound to opposite faces of an endogenous 147-bp mono-nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9V6S", "evidence_id": "EV-PDB-9V6S-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "9V6S", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9V6S" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of a single cPRC1 complex engaged on one face of an endogenous 147-bp mononucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9V6X", "evidence_id": "EV-PDB-9V6X-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.0 }, "provenance": { "deposit_id": "9V6X", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9V6X" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the cPRC1 complex bound to an endogenous 184-bp mono-nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9V8L", "evidence_id": "EV-PDB-9V8L-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 6.6 }, "provenance": { "deposit_id": "9V8L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9V8L" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the cPRC1-di-nucleosome (loose) complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,M)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9V9H", "evidence_id": "EV-PDB-9V9H-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.5 }, "provenance": { "deposit_id": "9V9H", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9V9H" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the cPRC1-di-nucleosome (tight) complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,M)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9V9P", "evidence_id": "EV-PDB-9V9P-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.4 }, "provenance": { "deposit_id": "9V9P", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9V9P" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the cPRC1-di-nucleosome (CBX7) complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "GOL", "MYR", "NAD", "PEG", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9VEM", "evidence_id": "EV-PDB-9VEM-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.57 }, "provenance": { "deposit_id": "9VEM", "doi": "10.1039/d5cb00169b", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9VEM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SIRT2 structure in complex with H3K18myr peptide and native NAD: pre-catalysis state 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "GOL", "MYR", "NAD", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9VEW", "evidence_id": "EV-PDB-9VEW-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.68 }, "provenance": { "deposit_id": "9VEW", "doi": "10.1039/d5cb00169b", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9VEW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SIRT2 structure in complex with H3K18myr peptide and native NAD: pre-catalysis state 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains e,g)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9UJT", "evidence_id": "EV-PDB-9UJT-16", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 6.54 }, "provenance": { "deposit_id": "9UJT", "doi": "10.1016/j.jbc.2026.111340", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9UJT" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "RNA polymerase II elongation complex stalled at SHL(-0.5) of the H3-H4 octasome (tetrasome)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9Q80", "evidence_id": "EV-PDB-9Q80-5", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.39 }, "provenance": { "deposit_id": "9Q80", "doi": "10.1038/s41467-025-67376-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9Q80" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Ku70/80 with Ku70 linker and SAP domain bound to a 153 bp H2AX nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,L,P)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9MMN", "evidence_id": "EV-PDB-9MMN-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.6 }, "provenance": { "deposit_id": "9MMN", "doi": "10.1093/nar/gkaf1028", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9MMN" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "H2AX containing nucleosomes, Left offset stack" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "MYR", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9VG0", "evidence_id": "EV-PDB-9VG0-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.61 }, "provenance": { "deposit_id": "9VG0", "doi": "10.1039/d5cb00169b", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9VG0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SIRT2 structure in complex with H3K18myr peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "MYR", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9VG3", "evidence_id": "EV-PDB-9VG3-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.15 }, "provenance": { "deposit_id": "9VG3", "doi": "10.1039/d5cb00169b", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9VG3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SIRT2 structure in complex with H3K18myr peptide: pre NAD binding state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "NCA", "YDD", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9VGE", "evidence_id": "EV-PDB-9VGE-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.56 }, "provenance": { "deposit_id": "9VGE", "doi": "10.1039/d5cb00169b", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9VGE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SIRT2 demyristoylation intermediate I structure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "MYR", "NAD", "PEG", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9VGZ", "evidence_id": "EV-PDB-9VGZ-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.34 }, "provenance": { "deposit_id": "9VGZ", "doi": "10.1039/d5cb00169b", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9VGZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SIRT2-F96A structure in complex with H3K18myr peptide and native NAD" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9W6E", "evidence_id": "EV-PDB-9W6E-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.7 }, "provenance": { "deposit_id": "9W6E", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9W6E" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of a stacked human nucleosome core particle dimer assembled with DNA truncated at SHL-4.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,O,U,Y)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9W6F", "evidence_id": "EV-PDB-9W6F-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.56 }, "provenance": { "deposit_id": "9W6F", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9W6F" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of a stacked human nucleosome core particle trimer assembled with DNA truncated at SHL-4.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,O,U,Y,e,i)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9W6G", "evidence_id": "EV-PDB-9W6G-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.02 }, "provenance": { "deposit_id": "9W6G", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9W6G" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of a stacked human nucleosome core particle tetramer assembled with DNA truncated at SHL-4.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9W6H", "evidence_id": "EV-PDB-9W6H-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 7.61 }, "provenance": { "deposit_id": "9W6H", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9W6H" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of a stacked human nucleosome core particle dimer (type 3) assembled with DNA truncated at SHL-5.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9W6I", "evidence_id": "EV-PDB-9W6I-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 7.61 }, "provenance": { "deposit_id": "9W6I", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9W6I" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of a stacked human nucleosome core particle dimer (type 4) assembled with DNA truncated at SHL-5.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9W6J", "evidence_id": "EV-PDB-9W6J-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 7.62 }, "provenance": { "deposit_id": "9W6J", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9W6J" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of a stacked human nucleosome core particle dimer (type 1, top NCP) assembled with DNA truncated at SHL-5.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9W6K", "evidence_id": "EV-PDB-9W6K-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.71 }, "provenance": { "deposit_id": "9W6K", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9W6K" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of a stacked human nucleosome core particle dimer (type 1&2, bottom NCP) assembled with DNA truncated at SHL-5.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9W6L", "evidence_id": "EV-PDB-9W6L-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 6.26 }, "provenance": { "deposit_id": "9W6L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9W6L" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of a stacked human nucleosome core particle dimer (type 2, top NCP) assembled with DNA truncated at SHL-5.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9W6M", "evidence_id": "EV-PDB-9W6M-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.86 }, "provenance": { "deposit_id": "9W6M", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9W6M" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of a stacked human nucleosome core particle dimer (type 5, top NCP) assembled with DNA truncated at SHL-5.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9W6N", "evidence_id": "EV-PDB-9W6N-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 7.61 }, "provenance": { "deposit_id": "9W6N", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9W6N" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of a stacked human nucleosome core particle dimer (type 5, bottom NCP) assembled with DNA truncated at SHL-5.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9W6O", "evidence_id": "EV-PDB-9W6O-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.08 }, "provenance": { "deposit_id": "9W6O", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9W6O" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of a stacked human nucleosome core particle dimer (type 6, top NCP) assembled with DNA truncated at SHL-5.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,O,U,Y)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9W6Q", "evidence_id": "EV-PDB-9W6Q-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.43 }, "provenance": { "deposit_id": "9W6Q", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9W6Q" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of a stacked human nucleosome core particle trimer assembled with DNA truncated at SHL-5.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9W6T", "evidence_id": "EV-PDB-9W6T-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 7.61 }, "provenance": { "deposit_id": "9W6T", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9W6T" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of a stacked human nucleosome core particle dimer (type 5) assembled with DNA truncated at SHL-5.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9W72", "evidence_id": "EV-PDB-9W72-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 7.62 }, "provenance": { "deposit_id": "9W72", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9W72" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of a stacked human nucleosome core particle dimer (type 1) assembled with DNA truncated at SHL-5.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9W73", "evidence_id": "EV-PDB-9W73-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 6.26 }, "provenance": { "deposit_id": "9W73", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9W73" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of a stacked human nucleosome core particle dimer (type 2) assembled with DNA truncated at SHL-5.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NAG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9XSF", "evidence_id": "EV-PDB-9XSF-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.39 }, "provenance": { "deposit_id": "9XSF", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9XSF" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of H4S47GlcNAc nucleosome at 3.39 angstrom" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9YL3", "evidence_id": "EV-PDB-9YL3-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.5 }, "provenance": { "deposit_id": "9YL3", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9YL3" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "State 1 MLL4FC bound to a nucleosome premodified with H2BK120ub and H4K16ac" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9YLE", "evidence_id": "EV-PDB-9YLE-5", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.63 }, "provenance": { "deposit_id": "9YLE", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9YLE" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "State 3 MLL4FC bound to a nucleosome premodified with H2BK120ub and H4K16ac" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAH", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9YLY", "evidence_id": "EV-PDB-9YLY-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.77 }, "provenance": { "deposit_id": "9YLY", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9YLY" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "MLL4FC bound to a nucleosome with p53 RE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAH", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9YM8", "evidence_id": "EV-PDB-9YM8-4", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.43 }, "provenance": { "deposit_id": "9YM8", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9YM8" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "State 2 focused on PHD FYR of MLL4FC bound to a nucleosome premodified with H2BK120ub and H4K16ac" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SAH", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9YMF", "evidence_id": "EV-PDB-9YMF-4", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.45 }, "provenance": { "deposit_id": "9YMF", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9YMF" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "State 2 focused on H3 N terminal tail of MLL4FC bound to a nucleosome premodified with H2BK120ub and H4K16ac" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9ZEO", "evidence_id": "EV-PDB-9ZEO-3", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "9ZEO", "doi": "10.1093/nar/gkag693", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9ZEO" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Competition for different elements of the nucleosome acidic patch yields distinct functional outcomes. VHH 1G1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E,K,O)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9W71", "evidence_id": "EV-PDB-9W71-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 5.52 }, "provenance": { "deposit_id": "9W71", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9W71" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of a stacked human nucleosome core particle dimer (type 6) assembled with DNA truncated at SHL-5.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Histone H3.1 (chains A,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9W6P", "evidence_id": "EV-PDB-9W6P-1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 5.52 }, "provenance": { "deposit_id": "9W6P", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9W6P" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of a stacked human nucleosome core particle dimer (type 6, bottom NCP) assembled with DNA truncated at SHL-5.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MYR", "NAD", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histone H3.1 (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9VH0", "evidence_id": "EV-PDB-9VH0-2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.41 }, "provenance": { "deposit_id": "9VH0", "doi": "10.1039/d5cb00169b", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9VH0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SIRT2-H187A structure in complex with H3K18myr peptide and native NAD" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=11115", "evidence_id": "EV-BMRB-11115", "mappings": [], "molecule_id": "P68431", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr11115", "doi": "10.13018/BMR11115", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=11115" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Complex structure of the zf-CW domain and the H3K4me3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.0, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=17569", "evidence_id": "EV-BMRB-17569", "mappings": [], "molecule_id": "P68431", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr17569", "doi": "10.13018/BMR17569", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=17569" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Solution structure of the ADD domain of ATRX complexed with histone tail H3 1-15 K9me3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.4, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=17808", "evidence_id": "EV-BMRB-17808", "mappings": [], "molecule_id": "P68431", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr17808", "doi": "10.13018/BMR17808", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=17808" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Structure of PHD domain of UHRF1 in complex with H3 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=18764", "evidence_id": "EV-BMRB-18764", "mappings": [], "molecule_id": "P68431", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr18764", "doi": "10.13018/BMR18764", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=18764" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Phf19 links methylated lysine 36 of histone H3 to regulation of Polycomb activity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.0, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=18813", "evidence_id": "EV-BMRB-18813", "mappings": [], "molecule_id": "P68431", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr18813", "doi": "10.13018/BMR18813", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=18813" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "The solution structure of human PHF1 in complex with H3K36me3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.4, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=26059", "evidence_id": "EV-BMRB-26059", "mappings": [], "molecule_id": "P68431", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr26059", "doi": "10.13018/BMR26059", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=26059" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Solution NMR structures of AF9 yeats domain in complex with histon H3 acetylation at K18" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.4, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=26060", "evidence_id": "EV-BMRB-26060", "mappings": [], "molecule_id": "P68431", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr26060", "doi": "10.13018/BMR26060", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=26060" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Solution NMR structures of AF9 yeats domain in complex with histone H3 crotonylation at K18" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=30177", "evidence_id": "EV-BMRB-30177", "mappings": [], "molecule_id": "P68431", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr30177", "doi": "10.13018/BMR30177", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=30177" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Solution NMR structure of PHF20 PHD domain in complex with a histone H3K4me2 peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=30501", "evidence_id": "EV-BMRB-30501", "mappings": [], "molecule_id": "P68431", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr30501", "doi": "10.13018/BMR30501", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=30501" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Solution structure of ZZZ3 ZZ domain in complex with histone H3 tail" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=30502", "evidence_id": "EV-BMRB-30502", "mappings": [], "molecule_id": "P68431", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr30502", "doi": "10.13018/BMR30502", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=30502" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Solution structure of ZZZ3 ZZ domain in complex with histone H3K4ac peptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=30809", "evidence_id": "EV-BMRB-30809", "mappings": [], "molecule_id": "P68431", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr30809", "doi": "10.13018/BMR30809", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=30809" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Solution structure of the PHD1 domain of histone demethylase KDM5A in complex with a histone H3(1-10) peptide" }, { "conditions": { "applied_force_pn": null, "buffer": "20 mM Tris, 300 mM NaCl, 1 mM β-mercaptoethanol", "environment": "in_vitro", "ions": [], "ligands": [ "partner: Histone H4", "partner: Peptidyl-prolyl cis-trans isomerase FKBP43" ], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 14.1 nm.", "ph": 7.5, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "Histone H3.1 with Peptidyl-prolyl cis-trans isomerase FKBP43, Histone H4", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDNS7/", "evidence_id": "EV-SASBDB-SASDNS7", "mappings": [], "molecule_id": "P68431", "observable": { "type": "radius_of_gyration", "uncertainty": 0.047, "unit": "nm", "value": 4.41 }, "provenance": { "deposit_id": "SASDNS7", "doi": "10.1016/j.bbagrm.2022.194872", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDNS7/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "The plant nucleoplasmin AtFKBP43 needs its extended arms for histone interaction." }, { "conditions": { "applied_force_pn": null, "buffer": "20 mM Tris, 150 mM NaCl, 2 mM β-mercaptoethanol", "environment": "in_vitro", "ions": [], "ligands": [ "partner: Histone H4", "partner: PfNPM A3 (1-170)" ], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 13.82 nm.", "ph": 7.5, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "Histone H3.1 with PfNPM A3 (1-170), Histone H4", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDVU2/", "evidence_id": "EV-SASBDB-SASDVU2", "mappings": [], "molecule_id": "P68431", "observable": { "type": "radius_of_gyration", "uncertainty": 0.181, "unit": "nm", "value": 4.89 }, "provenance": { "deposit_id": "SASDVU2", "doi": null, "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDVU2/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Plasmodium falciparum nucleoplasmin (PfNPM)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_silico", "ions": [], "ligands": [], "notes": "Computed prediction; no experimental conditions.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "AlphaFold Monomer v2.0 pipeline, residues 1-136", "labels": [] }, "data_format": "mmCIF, PAE JSON", "data_level": "processed", "data_link": "https://alphafold.ebi.ac.uk/entry/P68431", "evidence_id": "EV-AFDB-AF-P68431-F1", "mappings": [], "molecule_id": "P68431", "observable": { "type": "plddt", "uncertainty": null, "unit": "pLDDT", "value": 86.06 }, "provenance": { "deposit_id": "AF-P68431-F1", "doi": null, "licence": "CC BY 4.0", "retrieved": "2026-10-19", "source": "AlphaFold DB", "url": "https://alphafold.ebi.ac.uk/entry/P68431" }, "reader": null, "source_kind": "computed", "technique": "af_prediction", "title": "AlphaFold DB prediction AF-P68431-F1" } ], "models": [], "molecule": { "components": [], "domains": [], "gene": "H3C1", "identifiers": { "genbank": null, "isoform": null, "nakb": null, "pdb": [], "rfam": null, "rnacentral": null, "uniprot": "P68431" }, "ligands": [], "modifications": [ { "kind": "ptm", "name": "Asymmetric dimethylarginine; by PRMT6; alternate", "position": 3, "source": "UniProtKB" }, { "kind": "ptm", "name": "Citrulline; alternate", "position": 3, "source": "UniProtKB" }, { "kind": "ptm", "name": "Phosphothreonine; by HASPIN and VRK1", "position": 4, "source": "UniProtKB" }, { "kind": "ptm", "name": "Allysine; alternate", "position": 5, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6,N6,N6-trimethyllysine; alternate", "position": 5, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6,N6-dimethyllysine; alternate", "position": 5, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-(2-hydroxyisobutyryl)lysine; alternate", "position": 5, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-(beta-hydroxybutyryl)lysine; alternate", "position": 5, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-acetyllysine; alternate", "position": 5, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-benzoyllysine; alternate", "position": 5, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-crotonyllysine; alternate", "position": 5, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-methacryllysine; alternate", "position": 5, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-methyllysine; alternate", "position": 5, "source": "UniProtKB" }, { "kind": "ptm", "name": "5-glutamyl dopamine; alternate", "position": 6, "source": "UniProtKB" }, { "kind": "ptm", "name": "5-glutamyl serotonin; alternate", "position": 6, "source": "UniProtKB" }, { "kind": "ptm", "name": "Phosphothreonine; by PKC", "position": 7, "source": "UniProtKB" }, { "kind": "ptm", "name": "Citrulline; alternate", "position": 9, "source": "UniProtKB" }, { "kind": "ptm", "name": "Symmetric dimethylarginine; by PRMT5; alternate", "position": 9, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6,N6,N6-trimethyllysine; alternate", "position": 10, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6,N6-dimethyllysine; alternate", "position": 10, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-(2-hydroxyisobutyryl)lysine; alternate", "position": 10, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-(beta-hydroxybutyryl)lysine; alternate", "position": 10, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-acetyllysine; alternate", "position": 10, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-benzoyllysine; alternate", "position": 10, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-butyryllysine; alternate", "position": 10, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-crotonyllysine; alternate", "position": 10, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-isonicotinyllysine; alternate", "position": 10, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-lactoyllysine; alternate", "position": 10, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-methyllysine; alternate", "position": 10, "source": "UniProtKB" }, { "kind": "ptm", "name": "ADP-ribosylserine; alternate", "position": 11, "source": "UniProtKB" }, { "kind": "ptm", "name": "Phosphoserine; alternate; by AURKB, AURKC, RPS6KA3, RPS6KA4 and RPS6KA5", "position": 11, "source": "UniProtKB" }, { "kind": "ptm", "name": "Phosphothreonine; by PKC and CHEK1", "position": 12, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-(2-hydroxyisobutyryl)lysine; alternate", "position": 15, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-(beta-hydroxybutyryl)lysine; alternate", "position": 15, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-acetyllysine; alternate", "position": 15, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-benzoyllysine; alternate", "position": 15, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-glutaryllysine; alternate", "position": 15, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-lactoyllysine; alternate", "position": 15, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-succinyllysine; alternate", "position": 15, "source": "UniProtKB" }, { "kind": "ptm", "name": "Asymmetric dimethylarginine; by CARM1; alternate", "position": 18, "source": "UniProtKB" }, { "kind": "ptm", "name": "Citrulline; alternate", "position": 18, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-(2-hydroxyisobutyryl)lysine; alternate", "position": 19, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-(beta-hydroxybutyryl)lysine; alternate", "position": 19, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-acetyllysine; alternate", "position": 19, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-benzoyllysine; alternate", "position": 19, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-butyryllysine; alternate", "position": 19, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-crotonyllysine; alternate", "position": 19, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-glutaryllysine; alternate", "position": 19, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-lactoyllysine; alternate", "position": 19, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-methacryllysine; alternate", "position": 19, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-methyllysine; alternate", "position": 19, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-(2-hydroxyisobutyryl)lysine; alternate", "position": 24, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-(beta-hydroxybutyryl)lysine; alternate", "position": 24, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-acetyllysine; alternate", "position": 24, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-benzoyllysine; alternate", "position": 24, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-butyryllysine; alternate", "position": 24, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-crotonyllysine; alternate", "position": 24, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-glutaryllysine; alternate", "position": 24, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-isonicotinyllysine; alternate", "position": 24, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-lactoyllysine; alternate", "position": 24, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-methacryllysine; alternate", "position": 24, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-methyllysine; alternate", "position": 24, "source": "UniProtKB" }, { "kind": "ptm", "name": "Citrulline", "position": 27, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6,N6,N6-trimethyllysine; alternate", "position": 28, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6,N6-dimethyllysine; alternate", "position": 28, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-(2-hydroxyisobutyryl)lysine; alternate", "position": 28, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-(beta-hydroxybutyryl)lysine; alternate", "position": 28, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-acetyllysine; alternate", "position": 28, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-crotonyllysine; alternate", "position": 28, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-glutaryllysine; alternate", "position": 28, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-lactoyllysine; alternate", "position": 28, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-methyllysine; alternate", "position": 28, "source": "UniProtKB" }, { "kind": "ptm", "name": "ADP-ribosylserine; alternate", "position": 29, "source": "UniProtKB" }, { "kind": "ptm", "name": "Phosphoserine; alternate; by AURKB, AURKC and RPS6KA5", "position": 29, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6,N6,N6-trimethyllysine; alternate", "position": 37, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6,N6-dimethyllysine; alternate", "position": 37, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-(2-hydroxyisobutyryl)lysine; alternate", "position": 37, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-acetyllysine; alternate", "position": 37, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-isonicotinyllysine; alternate", "position": 37, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-methyllysine; alternate", "position": 37, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-isonicotinyllysine; alternate", "position": 38, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-methyllysine; alternate", "position": 38, "source": "UniProtKB" }, { "kind": "ptm", "name": "Phosphotyrosine", "position": 42, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6,N6,N6-trimethyllysine; alternate", "position": 57, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-(2-hydroxyisobutyryl)lysine; alternate", "position": 57, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-(beta-hydroxybutyryl)lysine; alternate", "position": 57, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-acetyllysine; alternate", "position": 57, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-crotonyllysine; alternate", "position": 57, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-glutaryllysine; alternate", "position": 57, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-lactoyllysine; alternate", "position": 57, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-methacryllysine; alternate", "position": 57, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-methyllysine; by EHMT2; alternate", "position": 57, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-succinyllysine; alternate", "position": 57, "source": "UniProtKB" }, { "kind": "ptm", "name": "Phosphoserine", "position": 58, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-(2-hydroxyisobutyryl)lysine; alternate", "position": 65, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-methyllysine; alternate", "position": 65, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6,N6,N6-trimethyllysine; alternate", "position": 80, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6,N6-dimethyllysine; alternate", "position": 80, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-(2-hydroxyisobutyryl)lysine; alternate", "position": 80, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-(beta-hydroxybutyryl)lysine; alternate", "position": 80, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-acetyllysine; alternate", "position": 80, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-glutaryllysine; alternate", "position": 80, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-isonicotinyllysine; alternate", "position": 80, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-lactoyllysine; alternate", "position": 80, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-methacryllysine; alternate", "position": 80, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-methyllysine; alternate", "position": 80, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-succinyllysine; alternate", "position": 80, "source": "UniProtKB" }, { "kind": "ptm", "name": "Phosphothreonine", "position": 81, "source": "UniProtKB" }, { "kind": "ptm", "name": "Phosphoserine", "position": 87, "source": "UniProtKB" }, { "kind": "ptm", "name": "Phosphothreonine", "position": 108, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-acetyllysine; alternate", "position": 116, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-glutaryllysine; alternate", "position": 116, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-(2-hydroxyisobutyryl)lysine; alternate", "position": 123, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-(beta-hydroxybutyryl)lysine; alternate", "position": 123, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-acetyllysine; alternate", "position": 123, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-glutaryllysine; alternate", "position": 123, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-isonicotinyllysine; alternate", "position": 123, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-methacryllysine; alternate", "position": 123, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-methyllysine; alternate", "position": 123, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-succinyllysine; alternate", "position": 123, "source": "UniProtKB" } ], "molecule_id": "P68431", "molecule_type": "protein", "name": "Histone H3.1", "organism": { "name": "Homo sapiens", "taxon_id": 9606 }, "provenance": { "deposit_id": "P68431", "doi": null, "licence": "CC BY 4.0 (UniProt)", "retrieved": "2026-10-19", "source": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P68431/entry" }, "sequence": "MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA", "sequence_length": 136 }, "molecule_id": "P68431", "states": [], "transitions": [] }