{ "conflicts": [], "coverage": { "cells": {}, "data_levels": {}, "single_method_states": [], "states": [], "techniques": [ "xray", "cryoem", "nmr_shifts", "saxs_sans", "force_spectroscopy", "af_prediction" ], "unmapped_evidence": 34 }, "curation": { "as_of": "", "curator": "none", "file": "", "status": "uncurated" }, "evidence": [ { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "CDL", "CU", "FES", "FMN", "HEA", "HEC", "HEM", "MG", "NAI", "SF4", "SMA", "UQ1", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "CYTOCHROME C (chains Y)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2YBB", "evidence_id": "EV-PDB-2YBB-33", "mappings": [], "molecule_id": "P62894", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 19.0 }, "provenance": { "deposit_id": "2YBB", "doi": "10.1038/EMBOJ.2011.324", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2YBB" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Fitted model for bovine mitochondrial supercomplex I1III2IV1 by single particle cryo-EM (EMD-1876)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ATP", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Cytochrome c (chains H,I,J,K,L,M,N)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3J2T", "evidence_id": "EV-PDB-3J2T-2", "mappings": [], "molecule_id": "P62894", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 9.5 }, "provenance": { "deposit_id": "3J2T", "doi": "10.1021/bi301721g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3J2T" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "An improved model of the human apoptosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEC", "NO3", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Cytochrome c (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6FF5", "evidence_id": "EV-PDB-6FF5-1", "mappings": [], "molecule_id": "P62894", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.74 }, "provenance": { "deposit_id": "6FF5", "doi": "10.1007/s10534-018-0090-x", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6FF5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of bovine heart cytochrome c at high ionic strength" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DTP", "HEC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Cytochrome c (chains H,I,J,K,L,M,N)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5JUY", "evidence_id": "EV-PDB-5JUY-2", "mappings": [], "molecule_id": "P62894", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.1 }, "provenance": { "deposit_id": "5JUY", "doi": "10.7554/eLife.17755", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5JUY" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Active human apoptosome with procaspase-9" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Cytochrome c (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2B4Z", "evidence_id": "EV-PDB-2B4Z-1", "mappings": [], "molecule_id": "P62894", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "2B4Z", "doi": "10.1002/prot.21452", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2B4Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of cytochrome C from bovine heart at 1.5 A resolution." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.68, "salt_mM": null, "temperature_c": 35.85 }, "construct": { "description": "BMRB data: 13C chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1108", "evidence_id": "EV-BMRB-1108", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1108", "doi": "10.13018/BMR1108", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1108" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Studies of Individual Carbon Sites of Proteins in Solution by Natural Abundance Carbon 13 Nuclear Magnetic Resonance Spectroscopy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.9, "salt_mM": null, "temperature_c": 35.85 }, "construct": { "description": "BMRB data: 13C chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1109", "evidence_id": "EV-BMRB-1109", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1109", "doi": "10.13018/BMR1109", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1109" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Studies of Individual Carbon Sites of Proteins in Solution by Natural Abundance Carbon 13 Nuclear Magnetic Resonance Spectroscopy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.7, "salt_mM": null, "temperature_c": 35.85 }, "construct": { "description": "BMRB data: 13C chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1110", "evidence_id": "EV-BMRB-1110", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1110", "doi": "10.13018/BMR1110", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1110" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Studies of Individual Carbon Sites of Proteins in Solution by Natural Abundance Carbon 13 Nuclear Magnetic Resonance Spectroscopy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.7, "salt_mM": null, "temperature_c": 10.85 }, "construct": { "description": "BMRB data: 13C chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1111", "evidence_id": "EV-BMRB-1111", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1111", "doi": "10.13018/BMR1111", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1111" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Studies of Individual Carbon Sites of Proteins in Solution by Natural Abundance Carbon 13 Nuclear Magnetic Resonance Spectroscopy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.7, "salt_mM": null, "temperature_c": 35.85 }, "construct": { "description": "BMRB data: 13C chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1112", "evidence_id": "EV-BMRB-1112", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1112", "doi": "10.13018/BMR1112", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1112" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Studies of Individual Carbon Sites of Proteins in Solution by Natural Abundance Carbon 13 Nuclear Magnetic Resonance Spectroscopy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.7, "salt_mM": null, "temperature_c": 10.85 }, "construct": { "description": "BMRB data: 13C chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1114", "evidence_id": "EV-BMRB-1114", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1114", "doi": "10.13018/BMR1114", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1114" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Studies of Individual Carbon Sites of Proteins in Solution by Natural Abundance Carbon 13 Nuclear Magnetic Resonance Spectroscopy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 5.5, "salt_mM": null, "temperature_c": 35.85 }, "construct": { "description": "BMRB data: 13C chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1116", "evidence_id": "EV-BMRB-1116", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1116", "doi": "10.13018/BMR1116", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1116" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Studies of Individual Carbon Sites of Proteins in Solution by Natural Abundance Carbon 13 Nuclear Magnetic Resonance Spectroscopy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.2, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1170", "evidence_id": "EV-BMRB-1170", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1170", "doi": "10.13018/BMR1170", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1170" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Assignment of Proton Resonances, Identification of Secondary Structural Elements, and Analysis of Backbone Chemical Shifts for the C102T Variant of Yeast Iso-1-cytochrome c and Horse Cytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 5.5, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "BMRB data: 13C chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1404", "evidence_id": "EV-BMRB-1404", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1404", "doi": "10.13018/BMR1404", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1404" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "A systematic approach towards the complete assignment of 13C resonances for horse ferrocytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.0, "salt_mM": null, "temperature_c": 29.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=17847", "evidence_id": "EV-BMRB-17847", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr17847", "doi": "10.13018/BMR17847", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=17847" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Backbone 1H, 13C, and 15N chemical shift assignments of oxidized horse heart cytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.0, "salt_mM": null, "temperature_c": 29.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=17848", "evidence_id": "EV-BMRB-17848", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr17848", "doi": "10.13018/BMR17848", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=17848" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Backbone 1H, 13C, and 15N chemical shift assignments of reduced horse heart cytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.0, "salt_mM": null, "temperature_c": 56.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=2366", "evidence_id": "EV-BMRB-2366", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr2366", "doi": "10.13018/BMR2366", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=2366" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Nuclear Magnetic Resonance Studies of Metal Substituted Horse Cytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.0, "salt_mM": null, "temperature_c": 56.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=2367", "evidence_id": "EV-BMRB-2367", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr2367", "doi": "10.13018/BMR2367", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=2367" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Nuclear Magnetic Resonance Studies of Metal Substituted Horse Cytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.0, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=2368", "evidence_id": "EV-BMRB-2368", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr2368", "doi": "10.13018/BMR2368", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=2368" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Nuclear Magnetic Resonance Studies of Metal Substituted Horse Cytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 5.7, "salt_mM": null, "temperature_c": 39.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=243", "evidence_id": "EV-BMRB-243", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr243", "doi": "10.13018/BMR243", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=243" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Two-Dimensional 1H NMR Studies of Cytochrome c: Assignment of the N-Terminal Helix" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 5.7, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=244", "evidence_id": "EV-BMRB-244", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr244", "doi": "10.13018/BMR244", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=244" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Two-Dimensional 1H NMR Studies of Cytochrome c: Assignment of the N-Terminal Helix" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 5.7, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=274", "evidence_id": "EV-BMRB-274", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr274", "doi": "10.13018/BMR274", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=274" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Proton Resonance Assignments of Horse Ferricytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 5.7, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=285", "evidence_id": "EV-BMRB-285", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr285", "doi": "10.13018/BMR285", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=285" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Assignment of paramagnetically shifted resonances in the 1H NMR spectrum of horse ferricytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 5.7, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=286", "evidence_id": "EV-BMRB-286", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr286", "doi": "10.13018/BMR286", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=286" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Assignment of paramagnetically shifted resonances in the 1H NMR spectrum of horse ferricytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.8, "salt_mM": null, "temperature_c": 29.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=316", "evidence_id": "EV-BMRB-316", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr316", "doi": "10.13018/BMR316", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=316" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Proton NMR studies of horse ferricytochrome c Completion of the assignment of the well resolved hyperfine shifted resonances" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.8, "salt_mM": null, "temperature_c": 29.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=317", "evidence_id": "EV-BMRB-317", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr317", "doi": "10.13018/BMR317", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=317" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Proton NMR studies of horse ferricytochrome c Completion of the assignment of the well resolved hyperfine shifted resonances" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=4189", "evidence_id": "EV-BMRB-4189", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr4189", "doi": "10.13018/BMR4189", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=4189" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Solution Structure of Reduced Horse Heart Cytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts, 13C chemical shifts, 15N chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=4805", "evidence_id": "EV-BMRB-4805", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr4805", "doi": "10.13018/BMR4805", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=4805" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H, 13C and 15N chemical shifts of bovine ferric cytochrome b5 in complex with horse heart ferric cytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts, 13C chemical shifts, 15N chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=4808", "evidence_id": "EV-BMRB-4808", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr4808", "doi": "10.13018/BMR4808", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=4808" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H, 13C and 15N chemical shifts of bovine ferrous cytochrome b5 in complex with horse heart ferrous cytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts, 13C chemical shifts, 15N chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=4809", "evidence_id": "EV-BMRB-4809", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr4809", "doi": "10.13018/BMR4809", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=4809" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H, 13C and 15N chemical shifts of bovine ferrous cytochrome b5-N17D in complex with horse heart ferrous cytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts, 13C chemical shifts, 15N chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=4810", "evidence_id": "EV-BMRB-4810", "mappings": [], "molecule_id": "P62894", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr4810", "doi": "10.13018/BMR4810", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=4810" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H, 13C and 15N chemical shifts of bovine ferric cytochrome b5 in complex with horse heart ferric cytochrome c" }, { "conditions": { "applied_force_pn": null, "buffer": "TRIS 50mM", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample.", "ph": 7.4, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "Cytochrome C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDCS8/", "evidence_id": "EV-SASBDB-SASDCS8", "mappings": [], "molecule_id": "P62894", "observable": { "type": "radius_of_gyration", "uncertainty": 0.07, "unit": "nm", "value": 1.34 }, "provenance": { "deposit_id": "SASDCS8", "doi": null, "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDCS8/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "A high flux setup for millisecond-scale small-angle X-ray scattering studies on macromolecular solutions" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_silico", "ions": [], "ligands": [], "notes": "Computed prediction; no experimental conditions.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "AlphaFold Monomer v2.0 pipeline, residues 1-105", "labels": [] }, "data_format": "mmCIF, PAE JSON", "data_level": "processed", "data_link": "https://alphafold.ebi.ac.uk/entry/P62894", "evidence_id": "EV-AFDB-AF-P62894-F1", "mappings": [], "molecule_id": "P62894", "observable": { "type": "plddt", "uncertainty": null, "unit": "pLDDT", "value": 97.81 }, "provenance": { "deposit_id": "AF-P62894-F1", "doi": null, "licence": "CC BY 4.0", "retrieved": "2026-10-19", "source": "AlphaFold DB", "url": "https://alphafold.ebi.ac.uk/entry/P62894" }, "reader": null, "source_kind": "computed", "technique": "af_prediction", "title": "AlphaFold DB prediction AF-P62894-F1" } ], "models": [], "molecule": { "components": [], "domains": [], "gene": "CYCS", "identifiers": { "genbank": null, "isoform": null, "nakb": null, "pdb": [], "rfam": null, "rnacentral": null, "uniprot": "P62894" }, "ligands": [ "heme c" ], "modifications": [ { "kind": "ptm", "name": "N-acetylglycine", "position": 2, "source": "UniProtKB" }, { "kind": "ptm", "name": "Phosphotyrosine", "position": 49, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-succinyllysine", "position": 56, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-acetyllysine; alternate", "position": 73, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-succinyllysine; alternate", "position": 73, "source": "UniProtKB" }, { "kind": "ptm", "name": "Phosphotyrosine", "position": 98, "source": "UniProtKB" }, { "kind": "ptm", "name": "N6-acetyllysine", "position": 100, "source": "UniProtKB" } ], "molecule_id": "P62894", "molecule_type": "protein", "name": "Cytochrome c", "organism": { "name": "Bos taurus", "taxon_id": 9913 }, "provenance": { "deposit_id": "P62894", "doi": null, "licence": "CC BY 4.0 (UniProt)", "retrieved": "2026-10-19", "source": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P62894/entry" }, "sequence": "MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITWGEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE", "sequence_length": 105 }, "molecule_id": "P62894", "states": [], "transitions": [] }