{
  "conflicts": [],
  "coverage": {
    "cells": {},
    "data_levels": {},
    "single_method_states": [],
    "states": [],
    "techniques": [
      "nmr_structure",
      "nmr_shifts",
      "force_spectroscopy",
      "af_prediction"
    ],
    "unmapped_evidence": 26
  },
  "curation": {
    "as_of": "",
    "curator": "none",
    "file": "",
    "status": "uncurated"
  },
  "evidence": [
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": 19.85
      },
      "construct": {
        "description": "Protegrin-5 (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + NMR restraints",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/2NC7",
      "evidence_id": "EV-PDB-2NC7-1",
      "mappings": [],
      "molecule_id": "P49934",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "2NC7",
        "doi": "10.1007/s00249-016-1167-5",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/2NC7"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_structure",
      "title": "Antimicrobial peptide protegrin PG-5"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": 19.85
      },
      "construct": {
        "description": "BMRB data: 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=26009",
      "evidence_id": "EV-BMRB-26009",
      "mappings": [],
      "molecule_id": "P49934",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr26009",
        "doi": "10.13018/BMR26009",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=26009"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Antimicrobial peptide protegrin PG-5"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 6.2,
        "salt_mM": null,
        "temperature_c": 26.85
      },
      "construct": {
        "description": "BMRB data: 1H chemical shifts, 13C chemical shifts, 15N chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=5688",
      "evidence_id": "EV-BMRB-5688",
      "mappings": [],
      "molecule_id": "P49934",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr5688",
        "doi": "10.13018/BMR5688",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=5688"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Backbone 1H, 13C, and 15N Chemical Shifts Assignment for the all-trans conformer of the cathelin-like domain of the protegrin-3 precursor"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_silico",
        "ions": [],
        "ligands": [],
        "notes": "Computed prediction; no experimental conditions.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "AlphaFold Monomer v2.0 pipeline, residues 1-149",
        "labels": []
      },
      "data_format": "mmCIF, PAE JSON",
      "data_level": "processed",
      "data_link": "https://alphafold.ebi.ac.uk/entry/P49934",
      "evidence_id": "EV-AFDB-AF-P49934-F1",
      "mappings": [],
      "molecule_id": "P49934",
      "observable": {
        "type": "plddt",
        "uncertainty": null,
        "unit": "pLDDT",
        "value": 81.12
      },
      "provenance": {
        "deposit_id": "AF-P49934-F1",
        "doi": null,
        "licence": "CC BY 4.0",
        "retrieved": "2026-10-19",
        "source": "AlphaFold DB",
        "url": "https://alphafold.ebi.ac.uk/entry/P49934"
      },
      "reader": null,
      "source_kind": "computed",
      "technique": "af_prediction",
      "title": "AlphaFold DB prediction AF-P49934-F1"
    }
  ],
  "models": [],
  "molecule": {
    "components": [],
    "domains": [],
    "gene": "NPG5",
    "identifiers": {
      "genbank": null,
      "isoform": null,
      "nakb": null,
      "pdb": [],
      "rfam": null,
      "rnacentral": null,
      "uniprot": "P49934"
    },
    "ligands": [],
    "modifications": [
      {
        "kind": "ptm",
        "name": "Arginine amide",
        "position": 148,
        "source": "UniProtKB"
      }
    ],
    "molecule_id": "P49934",
    "molecule_type": "protein",
    "name": "Protegrin-5",
    "organism": {
      "name": "Sus scrofa",
      "taxon_id": 9823
    },
    "provenance": {
      "deposit_id": "P49934",
      "doi": null,
      "licence": "CC BY 4.0 (UniProt)",
      "retrieved": "2026-10-19",
      "source": "UniProtKB",
      "url": "https://www.uniprot.org/uniprotkb/P49934/entry"
    },
    "sequence": "METQRASLCLGRWSLWLLLLGLVVPSASAQALSYREAVLRAVDRLNEQSSEANLYRLLELDQPPKADEDPGTPKPVSFTVKETVCPRPTRQPPELCDFKENGRVKQCVGTVTLDQIKDPLDITCNEVQGVRGGRLCYCRPRFCVCVGRG",
    "sequence_length": 149
  },
  "molecule_id": "P49934",
  "states": [],
  "transitions": []
}