{ "conflicts": [], "coverage": { "cells": { "GFP-native": { "af_prediction": 1, "cryoem": 175, "force_spectroscopy": 0, "nmr_shifts": 2, "xray": 482 }, "GFP-unfolded": { "af_prediction": 0, "cryoem": 0, "force_spectroscopy": 22, "nmr_shifts": 0, "xray": 0 } }, "data_levels": { "GFP-native": { "af_prediction": "processed", "cryoem": "processed", "nmr_shifts": "processed", "xray": "processed" }, "GFP-unfolded": { "force_spectroscopy": "reported" } }, "single_method_states": [ "GFP-unfolded" ], "states": [ "GFP-native", "GFP-unfolded" ], "techniques": [ "xray", "cryoem", "nmr_shifts", "force_spectroscopy", "af_prediction" ], "unmapped_evidence": 40 }, "curation": { "as_of": "2026-10-19", "curator": "draft (unreviewed)", "file": "P42212.yaml", "status": "draft" }, "evidence": [ { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "POV" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Isoform 2 of Transient receptor potential cation channel subfamily V member 3,Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/13LJ", "evidence_id": "EV-PDB-13LJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.86 }, "provenance": { "deposit_id": "13LJ", "doi": "10.1038/s41467-026-74687-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/13LJ" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of human TRPV3-G568C Olmsted syndrome mutant in the closed state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "POV" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Isoform 2 of Transient receptor potential cation channel subfamily V member 3,Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/13LL", "evidence_id": "EV-PDB-13LL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.96 }, "provenance": { "deposit_id": "13LL", "doi": "10.1038/s41467-026-74687-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/13LL" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of human TRPV3-Q580P Olmsted syndrome mutant in the closed state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "POV" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Isoform 2 of Transient receptor potential cation channel subfamily V member 3,Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/13LM", "evidence_id": "EV-PDB-13LM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.29 }, "provenance": { "deposit_id": "13LM", "doi": "10.1038/s41467-026-74687-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/13LM" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of human TRPV3-Q580P Olmsted syndrome mutant in the open state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "POV" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Isoform 2 of Transient receptor potential cation channel subfamily V member 3,Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/13LN", "evidence_id": "EV-PDB-13LN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.02 }, "provenance": { "deposit_id": "13LN", "doi": "10.1038/s41467-026-74687-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/13LN" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of human TRPV3-Q580P Olmsted syndrome mutant in the inactivated state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "POV" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Isoform 2 of Transient receptor potential cation channel subfamily V member 3,Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/13LO", "evidence_id": "EV-PDB-13LO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.34 }, "provenance": { "deposit_id": "13LO", "doi": "10.1038/s41467-026-74687-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/13LO" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of human TRPV3-W692G Olmsted syndrome mutant in the open state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "POV" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Isoform 2 of Transient receptor potential cation channel subfamily V member 3,Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/13LP", "evidence_id": "EV-PDB-13LP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.02 }, "provenance": { "deposit_id": "13LP", "doi": "10.1038/s41467-026-74687-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/13LP" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of human TRPV3-W692G Olmsted syndrome mutant in the inactivated state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Isoform 2 of Transient receptor potential cation channel subfamily V member 3,Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/13LQ", "evidence_id": "EV-PDB-13LQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.01 }, "provenance": { "deposit_id": "13LQ", "doi": "10.1038/s41467-026-74687-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/13LQ" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of human TRPV3-G568D Olmsted syndrome mutant in the 4-fold symmetrical open state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "POV" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Isoform 2 of Transient receptor potential cation channel subfamily V member 3,Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/13LS", "evidence_id": "EV-PDB-13LS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.02 }, "provenance": { "deposit_id": "13LS", "doi": "10.1038/s41467-026-74687-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/13LS" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of human TRPV3-G568D Olmsted syndrome mutant in the 2-fold symmetrical closed state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "POV" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Isoform 2 of Transient receptor potential cation channel subfamily V member 3,Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/13LT", "evidence_id": "EV-PDB-13LT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.25 }, "provenance": { "deposit_id": "13LT", "doi": "10.1038/s41467-026-74687-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/13LT" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of human TRPV3-G568D Olmsted syndrome mutant in the 2-fold symmetrical open state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.3, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "PROTEIN (GREEN FLUORESCENT PROTEIN) (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1B9C", "evidence_id": "EV-PDB-1B9C-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "1B9C", "doi": "10.1002/1097-0134(20001201)41:4<429::AID-PROT10>3.0.CO;2-D", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1B9C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Green Fluorescent Protein Mutant F99S, M153T and V163A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "BLUE FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1BFP", "evidence_id": "EV-PDB-1BFP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1BFP", "doi": "10.1021/bi970563w", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1BFP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "BLUE VARIANT OF GREEN FLUORESCENT PROTEIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CV7", "evidence_id": "EV-PDB-1CV7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "1CV7", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CV7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of enhanced cyan-emission variant of GFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.2, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1EMA", "evidence_id": "EV-PDB-1EMA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1EMA", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1EMA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GREEN FLUORESCENT PROTEIN FROM AEQUOREA VICTORIA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1EMC", "evidence_id": "EV-PDB-1EMC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "1EMC", "doi": "10.1038/nsb0597-361", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1EMC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GREEN FLUORESCENT PROTEIN FROM AEQUOREA VICTORIA, MUTANT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1EME", "evidence_id": "EV-PDB-1EME-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "1EME", "doi": "10.1038/nsb0597-361", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1EME" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GREEN FLUORESCENT PROTEIN FROM AEQUOREA VICTORIA, MUTANT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1EMF", "evidence_id": "EV-PDB-1EMF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "1EMF", "doi": "10.1038/nsb0597-361", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1EMF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GREEN FLUORESCENT PROTEIN FROM AEQUOREA VICTORIA, MUTANT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "IOD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1F09", "evidence_id": "EV-PDB-1F09-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.14 }, "provenance": { "deposit_id": "1F09", "doi": "10.1006/jmbi.2000.3905", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1F09" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF THE GREEN FLUORESCENT PROTEIN (GFP) VARIANT YFP-H148Q WITH TWO BOUND IODIDES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1F0B", "evidence_id": "EV-PDB-1F0B-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1F0B", "doi": "10.1006/jmbi.2000.3905", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1F0B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF THE GREEN FLUORESCENT PROTEIN (GFP) VARIANT YFP-H148Q" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 25.85 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1GFL", "evidence_id": "EV-PDB-1GFL-1", "mappings": [ { "confidence": "high", "justification": "Representative native structure; title and UniProt mapping checked against RCSB.", "rule": "curator_assignment", "state_id": "GFP-native", "who": "curator:draft (unreviewed)" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1GFL", "doi": "10.1038/nbt1096-1246", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1GFL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURE OF GREEN FLUORESCENT PROTEIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1H6R", "evidence_id": "EV-PDB-1H6R-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "1H6R", "doi": "10.1093/EMBOJ/20.21.5853", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1H6R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The oxidized state of a redox sensitive variant of green fluorescent protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1HUY", "evidence_id": "EV-PDB-1HUY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "1HUY", "doi": "10.1074/jbc.M102815200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1HUY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF CITRINE, AN IMPROVED YELLOW VARIANT OF GREEN FLUORESCENT PROTEIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JBZ", "evidence_id": "EV-PDB-1JBZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "1JBZ", "doi": "10.1021/bi026609p", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JBZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE ANALYSIS OF A DUAL-WAVELENGTH EMISSION GREEN FLUORESCENT PROTEIN VARIANT AT HIGH PH" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JC0", "evidence_id": "EV-PDB-1JC0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1JC0", "doi": "10.1074/jbc.M312846200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JC0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE ANALYSIS OF A REDOX-SENSITIVE GREEN FLUORESCENT PROTEIN VARIANT IN A REDUCED FORM" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JC1", "evidence_id": "EV-PDB-1JC1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1JC1", "doi": "10.1074/jbc.M312846200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JC1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE ANALYSIS OF A REDOX-SENSITIVE GREEN FLUORESCENT PROTEIN VARIANT IN A OXIDIZED FORM" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 10.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green Fluorescent Protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1KP5", "evidence_id": "EV-PDB-1KP5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "1KP5", "doi": "10.1107/S0907444902010454", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1KP5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Cyclic Green Fluorescent Protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green Fluorescent Protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1KYP", "evidence_id": "EV-PDB-1KYP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "1KYP", "doi": "10.1021/ja0176954", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1KYP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of an Apo Green Fluorescent Protein Zn Biosensor" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green Fluorescent Protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1KYS", "evidence_id": "EV-PDB-1KYS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.44 }, "provenance": { "deposit_id": "1KYS", "doi": "10.1021/ja0176954", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1KYS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of a Zn-bound Green Fluorescent Protein Biosensor" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MYW", "evidence_id": "EV-PDB-1MYW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "1MYW", "doi": "10.1074/jbc.M209524200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MYW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF A YELLOW FLUORESCENT PROTEIN WITH IMPROVED MATURATION AND REDUCED ENVIRONMENTAL SENSITIVITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green Fluorescent Protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1Q4C", "evidence_id": "EV-PDB-1Q4C-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "1Q4C", "doi": "10.1073/pnas.2534352100", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1Q4C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "S65T Q80R T203C Green Fluorescent Protein (GFP) pH 8.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green Fluorescent Protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1Q4D", "evidence_id": "EV-PDB-1Q4D-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.58 }, "provenance": { "deposit_id": "1Q4D", "doi": "10.1073/pnas.2534352100", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1Q4D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "S65T Q80R T203C Green Fluorescent Protein (GFP) pH 5.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green Fluorescent Protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1Q4E", "evidence_id": "EV-PDB-1Q4E-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.38 }, "provenance": { "deposit_id": "1Q4E", "doi": "10.1073/pnas.2534352100", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1Q4E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "S65T Q80R Y145C Green Fluorescent Protein (GFP) pH 8.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "green-fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QXT", "evidence_id": "EV-PDB-1QXT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1QXT", "doi": "10.1073/pnas.2133463100", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QXT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of precyclized intermediate for the green fluorescent protein R96A variant (A)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "green-fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QY3", "evidence_id": "EV-PDB-1QY3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1QY3", "doi": "10.1073/pnas.2133463100", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QY3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of precyclized intermediate for the green fluorescent protein R96A variant (B)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "green-fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QYO", "evidence_id": "EV-PDB-1QYO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1QYO", "doi": "10.1073/pnas.2133463100", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QYO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Anaerobic precylization intermediate crystal structure for S65G Y66G GFP variant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "green-fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QYF", "evidence_id": "EV-PDB-1QYF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "1QYF", "doi": "10.1073/pnas.2133463100", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QYF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of matured green fluorescent protein R96A variant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green Fluorescent Protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1Q73", "evidence_id": "EV-PDB-1Q73-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "1Q73", "doi": "10.1073/pnas.2534352100", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1Q73" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "S65T Q80R Y145C T203C Green Fluorescent Protein (GFP) pH 8.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green Fluorescent Protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1Q4B", "evidence_id": "EV-PDB-1Q4B-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.48 }, "provenance": { "deposit_id": "1Q4B", "doi": "10.1073/pnas.2534352100", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1Q4B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "S65T Q80R Green Fluorescent Protein (GFP) pH 5.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green Fluorescent Protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1Q4A", "evidence_id": "EV-PDB-1Q4A-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "1Q4A", "doi": "10.1073/pnas.2534352100", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1Q4A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "S65T Q80R Green Fluorescent Protein (GFP) pH 8.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CU", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green Fluorescent Protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1KYR", "evidence_id": "EV-PDB-1KYR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "1KYR", "doi": "10.1021/ja0176954", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1KYR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of a Cu-bound Green Fluorescent Protein Zn Biosensor" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JBY", "evidence_id": "EV-PDB-1JBY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1JBY", "doi": "10.1021/bi026609p", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JBY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE ANALYSIS OF A DUAL-WAVELENGTH EMISSION GREEN FLUORESCENT PROTEIN VARIANT AT LOW PH" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1HCJ", "evidence_id": "EV-PDB-1HCJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1HCJ", "doi": "10.1038/NSB739", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1HCJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Photoproduct of the wild-type Aequorea victoria Green Fluorescent Protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1EMM", "evidence_id": "EV-PDB-1EMM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "1EMM", "doi": "10.1038/nsb0597-361", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1EMM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GREEN FLUORESCENT PROTEIN FROM AEQUOREA VICTORIA, MUTANT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1EML", "evidence_id": "EV-PDB-1EML-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "1EML", "doi": "10.1038/nsb0597-361", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1EML" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GREEN FLUORESCENT PROTEIN FROM AEQUOREA VICTORIA, MUTANT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1EMK", "evidence_id": "EV-PDB-1EMK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1EMK", "doi": "10.1038/nsb0597-361", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1EMK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GREEN FLUORESCENT PROTEIN FROM AEQUOREA VICTORIA, MUTANT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "PROTEIN (GREEN FLUORESCENT PROTEIN) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1EMG", "evidence_id": "EV-PDB-1EMG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1EMG", "doi": "10.1021/bi9902182", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1EMG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GREEN FLUORESCENT PROTEIN (65-67 REPLACED BY CRO, S65T SUBSTITUTION, Q80R)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.8, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1EMB", "evidence_id": "EV-PDB-1EMB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.13 }, "provenance": { "deposit_id": "1EMB", "doi": "10.1073/pnas.94.6.2306", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1EMB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GREEN FLUORESCENT PROTEIN (GFP) FROM AEQUOREA VICTORIA, GLN 80 REPLACED WITH ARG" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C4F", "evidence_id": "EV-PDB-1C4F-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.25 }, "provenance": { "deposit_id": "1C4F", "doi": "10.1021/bi9902182", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C4F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GREEN FLUORESCENT PROTEIN S65T AT PH 4.6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "POV" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Isoform 2 of Transient receptor potential cation channel subfamily V member 3,Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/13LU", "evidence_id": "EV-PDB-13LU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.49 }, "provenance": { "deposit_id": "13LU", "doi": "10.1038/s41467-026-74687-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/13LU" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of human TRPV3-W521S Olmsted syndrome mutant in the closed state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "POV" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Isoform 2 of Transient receptor potential cation channel subfamily V member 3,Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/13LR", "evidence_id": "EV-PDB-13LR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.33 }, "provenance": { "deposit_id": "13LR", "doi": "10.1038/s41467-026-74687-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/13LR" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of human TRPV3-G568D Olmsted syndrome mutant in the 4-fold symmetrical inactivated state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "POV" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Isoform 2 of Transient receptor potential cation channel subfamily V member 3,Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/13LK", "evidence_id": "EV-PDB-13LK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.18 }, "provenance": { "deposit_id": "13LK", "doi": "10.1038/s41467-026-74687-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/13LK" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of human TRPV3-G568C Olmsted syndrome mutant in the open state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "green-fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QYQ", "evidence_id": "EV-PDB-1QYQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1QYQ", "doi": "10.1073/pnas.2133463100", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QYQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of the cyclized S65G Y66G GFP variant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "avermectin-sensitive chloride channel GluCl beta/cyan fluorescent protein fusion (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1RM9", "evidence_id": "EV-PDB-1RM9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.9 }, "provenance": { "deposit_id": "1RM9", "doi": "10.1515/BC.2004.038", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1RM9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Probing the Role of Tryptophans in Aequorea Victoria Green Fluorescent Proteins with an Expanded Genetic Code" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "SIGF1-GFP fusion protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1RMM", "evidence_id": "EV-PDB-1RMM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1RMM", "doi": "10.1515/BC.2004.038", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1RMM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Probing the Role of Tryptophans in Aequorea Victoria Green Fluorescent Proteins with an Expanded Genetic Code" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "wunen-nonfunctional GFP fusion protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1RMO", "evidence_id": "EV-PDB-1RMO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1RMO", "doi": "10.1515/BC.2004.038", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1RMO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Probing the Role of Tryptophans in Aequorea Victoria Green Fluorescent Proteins with an Expanded Genetic Code" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1S6Z", "evidence_id": "EV-PDB-1S6Z-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "1S6Z", "doi": "10.1021/bi0361315", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1S6Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Enhanced Green Fluorescent Protein Containing the Y66L Substitution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1W7S", "evidence_id": "EV-PDB-1W7S-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1W7S", "doi": "10.1074/JBC.M505473200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1W7S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Wild-Type Aequorea victoria Green Fluorescent Protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1W7T", "evidence_id": "EV-PDB-1W7T-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1W7T", "doi": "10.1074/JBC.M505473200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1W7T" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Photoproduct of the Wild-Type Aequorea victoria Green Fluorescent Protein at 100 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1W7U", "evidence_id": "EV-PDB-1W7U-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1W7U", "doi": "10.1074/JBC.M505473200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1W7U" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Photoproduct of the Wild-Type Aequorea victoria Green Fluorescent Protein after structural annealing at 170K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "YELLOW FLUORESCENT PROTEIN (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1YFP", "evidence_id": "EV-PDB-1YFP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "1YFP", "doi": "10.1016/S0969-2126(98)00127-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1YFP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURE OF YELLOW-EMISSION VARIANT OF GFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1YHG", "evidence_id": "EV-PDB-1YHG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "1YHG", "doi": "10.1021/bi0479205", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1YHG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Uncyclized precursor structure of S65G Y66S V68G GFP variant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1YHH", "evidence_id": "EV-PDB-1YHH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "1YHH", "doi": "10.1021/bi0479205", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1YHH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Uncyclized precursor structure of S65A Y66S G67A GFP variant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green Fluorescent Protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1YHI", "evidence_id": "EV-PDB-1YHI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1YHI", "doi": "10.1021/bi0479205", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1YHI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Uncyclized precursor structure of S65A Y66S R96A GFP variant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green Fluorescent Protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1YJ2", "evidence_id": "EV-PDB-1YJ2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "1YJ2", "doi": "10.1021/bi0479205", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1YJ2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Cyclized, non-dehydrated post-translational product for S65A Y66S H148G GFP variant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green Fluorescent Protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1YJF", "evidence_id": "EV-PDB-1YJF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "1YJF", "doi": "10.1021/bi0479205", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1YJF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Cyclized post-translational product for S65A Y66S (GFPhal) green fluorescent protein variant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1Z1P", "evidence_id": "EV-PDB-1Z1P-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1Z1P", "doi": "10.1021/bi0503798", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1Z1P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Y66L variant of Enhanced Green Fluorescent Protein with 412-nm Absorbing Chromophore" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green Fluorescent Protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1Z1Q", "evidence_id": "EV-PDB-1Z1Q-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "1Z1Q", "doi": "10.1021/bi0503798", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1Z1Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Y66L Variant of Enhanced Green Fluorescent Protein with 374-nm Absorbing Chromophore" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "9PE", "YJ0" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,Potassium voltage-gated channel subfamily KQT member 2 (chains B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/24VI", "evidence_id": "EV-PDB-24VI-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.98 }, "provenance": { "deposit_id": "24VI", "doi": "10.15302/vita.2026.05.0032", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/24VI" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human KCNQ2/KCNQ3 heterotetramer (3:1 stoichiometry) in apo state (M2223 apo, without symmetry expansion)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "9PE", "YJ0" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,Potassium voltage-gated channel subfamily KQT member 2 (chains C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/24VM", "evidence_id": "EV-PDB-24VM-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.54 }, "provenance": { "deposit_id": "24VM", "doi": "10.15302/vita.2026.05.0032", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/24VM" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human wild-type KCNQ2/KCNQ3 heterotetramer (2:2 stoichiometry) in apo state (M2233 WT, without symmetry expansion)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "9PE", "YJ0" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,Potassium voltage-gated channel subfamily KQT member 2 (chains B,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/24VR", "evidence_id": "EV-PDB-24VR-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.3 }, "provenance": { "deposit_id": "24VR", "doi": "10.15302/vita.2026.05.0032", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/24VR" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human KCNQ2/KCNQ3 heterotetramer (2:2 stoichiometry) in apo state (M2323 apo, with symmetry expansion)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ADP", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,Potassium transporter 5 (chains A,B)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/25EX", "evidence_id": "EV-PDB-25EX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.66 }, "provenance": { "deposit_id": "25EX", "doi": "10.1016/j.molp.2026.08.017", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/25EX" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the Arabidopsis thaliana potassium transporter 5 in apo state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BMA", "CA", "KIF", "MAN", "NAG", "branched: alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose", "branched: beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,alpha-1,2-Mannosidase (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/29TE", "evidence_id": "EV-PDB-29TE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.46 }, "provenance": { "deposit_id": "29TE", "doi": "10.1101/2025.01.29.635535", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/29TE" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "The complex of A1AT-NHK with the ERAD misfolded glycoprotein checkpoint complex from Chaetomium thermophilum (EDEM:PDI heterodimer)." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "IMD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.6, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2AH8", "evidence_id": "EV-PDB-2AH8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.24 }, "provenance": { "deposit_id": "2AH8", "doi": "10.1110/ps.051734306", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2AH8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "roGFP1-R7. Cystal structure analysis of a rate-enhanced variant of redox-sensitive green fluorescent protein in the oxidized form." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2AHA", "evidence_id": "EV-PDB-2AHA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.98 }, "provenance": { "deposit_id": "2AHA", "doi": "10.1110/ps.051734306", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2AHA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure analysis of a rate-enhanced variant of redox-sensitive green fluorescent protein in the reduced form, roGFP1-R8." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2AWK", "evidence_id": "EV-PDB-2AWK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.15 }, "provenance": { "deposit_id": "2AWK", "doi": "10.1021/bi051388j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2AWK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GFP R96M mature chromophore" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2AWL", "evidence_id": "EV-PDB-2AWL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "2AWL", "doi": "10.1021/bi051388j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2AWL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mature R96K GFP mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACY", "CD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2B3P", "evidence_id": "EV-PDB-2B3P-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "2B3P", "doi": "10.1038/nbt1172", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2B3P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of a superfolder green fluorescent protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 10.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2DUE", "evidence_id": "EV-PDB-2DUE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.24 }, "provenance": { "deposit_id": "2DUE", "doi": "10.1021/bi7009037", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2DUE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "crystal structure of a green fluorescent protein variant S65T/H148D at pH 10" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2DUG", "evidence_id": "EV-PDB-2DUG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "2DUG", "doi": "10.1021/bi7009037", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2DUG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "crystal structure of a green fluorescent protein S65T/H148N at pH 5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2DUH", "evidence_id": "EV-PDB-2DUH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "2DUH", "doi": "10.1021/bi7009037", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2DUH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "crystal structure of a green fluorescent protein variant S65T/H148N at pH 9.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2EMO", "evidence_id": "EV-PDB-2EMO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "2EMO", "doi": "10.1038/nsb0597-361", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2EMO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GREEN FLUORESCENT PROTEIN FROM AEQUOREA VICTORIA, MUTANT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2FWQ", "evidence_id": "EV-PDB-2FWQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "2FWQ", "doi": "10.1021/ja0552693", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2FWQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Reduced enolate chromophore intermediate for Y66H GFP variant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2FZU", "evidence_id": "EV-PDB-2FZU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "2FZU", "doi": "10.1021/ja0552693", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2FZU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Reduced enolate chromophore intermediate for GFP variant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2G16", "evidence_id": "EV-PDB-2G16-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2G16", "doi": "10.1021/ja056635l", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2G16" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of S65A Y66S GFP variant after backbone fragmentation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2G16", "evidence_id": "EV-PDB-2G16-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2G16", "doi": "10.1021/ja056635l", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2G16" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of S65A Y66S GFP variant after backbone fragmentation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2G2S", "evidence_id": "EV-PDB-2G2S-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "2G2S", "doi": "10.1021/ja056635l", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2G2S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of S65G Y66S GFP variant after spontaneous peptide hydrolysis" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2G2S", "evidence_id": "EV-PDB-2G2S-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "2G2S", "doi": "10.1021/ja056635l", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2G2S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of S65G Y66S GFP variant after spontaneous peptide hydrolysis" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2G3D", "evidence_id": "EV-PDB-2G3D-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "2G3D", "doi": "10.1021/ja056635l", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2G3D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of S65G Y66A GFP variant after spontaneous peptide hydrolysis" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2G3D", "evidence_id": "EV-PDB-2G3D-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "2G3D", "doi": "10.1021/ja056635l", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2G3D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of S65G Y66A GFP variant after spontaneous peptide hydrolysis" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2EMN", "evidence_id": "EV-PDB-2EMN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "2EMN", "doi": "10.1038/nsb0597-361", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2EMN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GREEN FLUORESCENT PROTEIN FROM AEQUOREA VICTORIA, MUTANT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2EMD", "evidence_id": "EV-PDB-2EMD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2EMD", "doi": "10.1038/nsb0597-361", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2EMD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GREEN FLUORESCENT PROTEIN FROM AEQUOREA VICTORIA, MUTANT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2DUI", "evidence_id": "EV-PDB-2DUI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.36 }, "provenance": { "deposit_id": "2DUI", "doi": "10.1021/bi7009037", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2DUI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "crystal structure of a green fluorescent protein variant H148D at pH 9" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2DUF", "evidence_id": "EV-PDB-2DUF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "2DUF", "doi": "10.1021/bi7009037", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2DUF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "crystal structure of a green fluorescent protein variant S65T/H148D at pH 5.6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2B3Q", "evidence_id": "EV-PDB-2B3Q-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "2B3Q", "doi": "10.1038/nbt1172", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2B3Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of a well-folded variant of green fluorescent protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2AWM", "evidence_id": "EV-PDB-2AWM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "2AWM", "doi": "10.1021/bi051388j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2AWM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GFP R96A chromophore maturation recovery mutant R96A Q183R" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "green-fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2AWJ", "evidence_id": "EV-PDB-2AWJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "2AWJ", "doi": "10.1021/bi051388j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2AWJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GFP R96M pre-cyclized intermediate in chromophore formation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "9PE", "YJ0" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,Potassium voltage-gated channel subfamily KQT member 2 (chains D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/24VS", "evidence_id": "EV-PDB-24VS-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.51 }, "provenance": { "deposit_id": "24VS", "doi": "10.15302/vita.2026.05.0032", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/24VS" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human KCNQ2/KCNQ3 heterotetramer (1:3 stoichiometry) in apo state (M2333 apo, with symmetry expansion)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "9PE", "YJ0" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,Potassium voltage-gated channel subfamily KQT member 2 (chains C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/24VQ", "evidence_id": "EV-PDB-24VQ-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.48 }, "provenance": { "deposit_id": "24VQ", "doi": "10.15302/vita.2026.05.0032", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/24VQ" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human KCNQ2/KCNQ3 heterotetramer (2:2 stoichiometry) in apo state (M2233 apo, with symmetry expansion)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "9PE", "YJ0" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,Potassium voltage-gated channel subfamily KQT member 2 (chains B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/24VP", "evidence_id": "EV-PDB-24VP-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.26 }, "provenance": { "deposit_id": "24VP", "doi": "10.15302/vita.2026.05.0032", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/24VP" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human KCNQ2/KCNQ3 heterotetramer (3:1 stoichiometry) in apo state (M2223 apo, with symmetry expansion)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "9PE", "YJ0" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,Potassium voltage-gated channel subfamily KQT member 2 (chains D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/24VO", "evidence_id": "EV-PDB-24VO-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.64 }, "provenance": { "deposit_id": "24VO", "doi": "10.15302/vita.2026.05.0032", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/24VO" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human wild-type KCNQ2/KCNQ3 heterotetramer (1:3 stoichiometry) in apo state (M2333 WT, without symmetry expansion)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "9PE", "YJ0" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,Potassium voltage-gated channel subfamily KQT member 2 (chains B,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/24VN", "evidence_id": "EV-PDB-24VN-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.58 }, "provenance": { "deposit_id": "24VN", "doi": "10.15302/vita.2026.05.0032", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/24VN" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human wild-type KCNQ2/KCNQ3 heterotetramer (2:2 stoichiometry) in apo state (M2323 WT, without symmetry expansion)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "9PE", "YJ0" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,Potassium voltage-gated channel subfamily KQT member 2 (chains B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/24VL", "evidence_id": "EV-PDB-24VL-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.05 }, "provenance": { "deposit_id": "24VL", "doi": "10.15302/vita.2026.05.0032", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/24VL" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human wild-type KCNQ2/KCNQ3 heterotetramer (3:1 stoichiometry) in apo state (M2223 WT, without symmetry expansion)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "SIGF1-GFP fusion protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1RRX", "evidence_id": "EV-PDB-1RRX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1RRX", "doi": "10.1002/cbic.200300818", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1RRX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystallographic Evidence for Isomeric Chromophores in 3-Fluorotyrosyl-Green Fluorescent Protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "SIGF1-GFP fusion protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1RMP", "evidence_id": "EV-PDB-1RMP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "1RMP", "doi": "10.1515/BC.2004.038", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1RMP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Probing the Role of Tryptophans in Aequorea Victoria Green Fluorescent Proteins with an Expanded Genetic Code" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2H9W", "evidence_id": "EV-PDB-2H9W-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.82 }, "provenance": { "deposit_id": "2H9W", "doi": "10.1021/bi602646r", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2H9W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Green fluorescent protein ground states: the influence of a second protonation site near the chromophore" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein mutant 3 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2Q6P", "evidence_id": "EV-PDB-2Q6P-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "2Q6P", "doi": "10.1371/journal.pone.0001680", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2Q6P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The Chemical Control of Protein Folding: Engineering a Superfolder Green Fluorescent Protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DPW", "evidence_id": "EV-PDB-3DPW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.59 }, "provenance": { "deposit_id": "3DPW", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DPW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 1 Atmosphere Number 1: Structure 1 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DPX", "evidence_id": "EV-PDB-3DPX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "3DPX", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DPX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 5000 Atmospheres: Structure 26 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DPZ", "evidence_id": "EV-PDB-3DPZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "3DPZ", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DPZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 4000 Atmospheres Number 3: Structure 25 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DQ1", "evidence_id": "EV-PDB-3DQ1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "3DQ1", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DQ1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 4000 Atmospheres Number 2: Structure 24 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DQ2", "evidence_id": "EV-PDB-3DQ2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "3DQ2", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DQ2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 4000 Atmospheres Number 1: Structure 23 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DQ3", "evidence_id": "EV-PDB-3DQ3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "3DQ3", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DQ3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 2500 Atmospheres: Structure 22 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DQ4", "evidence_id": "EV-PDB-3DQ4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.47 }, "provenance": { "deposit_id": "3DQ4", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DQ4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 2000 Atmospheres Number 2: Structure 20 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DQ5", "evidence_id": "EV-PDB-3DQ5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "3DQ5", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DQ5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 1960 Atmospheres: Structure 19 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DQ6", "evidence_id": "EV-PDB-3DQ6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "3DQ6", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DQ6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 1920 Atmospheres Number 2: Structure 18 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3CD9", "evidence_id": "EV-PDB-3CD9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.502 }, "provenance": { "deposit_id": "3CD9", "doi": "10.1021/bi800498g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3CD9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Development of a family of redox-sensitive green fluorescent protein indicators for use in relatively oxidizing subcellular environments" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3CD1", "evidence_id": "EV-PDB-3CD1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.312 }, "provenance": { "deposit_id": "3CD1", "doi": "10.1021/bi800498g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3CD1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Development of a family of redox-sensitive green fluorescent protein indicators for use in relatively oxidizing subcellular environments" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3CBE", "evidence_id": "EV-PDB-3CBE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.488 }, "provenance": { "deposit_id": "3CBE", "doi": "10.1021/bi800498g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3CBE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Development of a family of redox-sensitive green fluorescent protein indicators for use in relatively oxidizing subcellular environments" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3CB9", "evidence_id": "EV-PDB-3CB9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.31 }, "provenance": { "deposit_id": "3CB9", "doi": "10.1021/bi800498g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3CB9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Development of a family of redox-sensitive green fluorescent protein indicators for use in relatively oxidizing subcellular environments" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "yeast enhanced green fluorescent protein,Ubiquitin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3AI5", "evidence_id": "EV-PDB-3AI5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "3AI5", "doi": "10.1107/S0907444910032944", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3AI5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of yeast enhanced green fluorescent protein-ubiquitin fusion protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "yeast enhanced green fluorescent protein,DNA polymerase iota (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3AI4", "evidence_id": "EV-PDB-3AI4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "3AI4", "doi": "10.1107/S0907444910032944", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3AI4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of yeast enhanced green fluorescent protein - mouse polymerase iota ubiquitin binding motif fusion protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Mechanosensitive ion channel protein 2, chloroplastic,Green fluorescent protein (chains A,B,C,D,E,F,G)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/38RX", "evidence_id": "EV-PDB-38RX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "38RX", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/38RX" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of wild-type Arabidopsis thaliana mechanosensitive channel of small conductance-like protein 2 (MSL2) in chloroplast lipid nanodiscs." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Mechanosensitive ion channel protein 2, chloroplastic,Green fluorescent protein (chains A,B,C,D,E,F,G)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/38RK", "evidence_id": "EV-PDB-38RK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "38RK", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/38RK" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the L274A mutant of the Arabidopsis thaliana mechanosensitive channel of small conductance-like protein 2 (MSL2) in DOPC lipid nanodiscs." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Mechanosensitive ion channel protein 2, chloroplastic,Green fluorescent protein (chains A,B,C,D,E,F,G)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/38OA", "evidence_id": "EV-PDB-38OA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "38OA", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/38OA" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of wild-type Arabidopsis thaliana mechanosensitive channel of small conductance-like protein 2 (MSL2) in DOPC lipid nanodiscs." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "ATP-dependent RNA helicase DDX1,Green fluorescent protein (chains D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/31FW", "evidence_id": "EV-PDB-31FW-4", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.3 }, "provenance": { "deposit_id": "31FW", "doi": "10.1038/s41467-026-77450-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/31FW" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Human tRNA ligase complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "PROTEIN (GREEN FLUORESCENT PROTEIN) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2YFP", "evidence_id": "EV-PDB-2YFP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "2YFP", "doi": "10.1016/S0969-2126(98)00127-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2YFP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURE OF YELLOW-EMISSION VARIANT OF GFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2YE1", "evidence_id": "EV-PDB-2YE1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.63 }, "provenance": { "deposit_id": "2YE1", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2YE1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the cyan fluorescent proteinmTurquoise-GL (K206A mutant)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.75, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2YE0", "evidence_id": "EV-PDB-2YE0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.47 }, "provenance": { "deposit_id": "2YE0", "doi": "10.1038/NCOMMS1738", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2YE0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the cyan fluorescent protein mTurquoise (K206A mutant)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.75, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2YDZ", "evidence_id": "EV-PDB-2YDZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.59 }, "provenance": { "deposit_id": "2YDZ", "doi": "10.1038/NCOMMS1738", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2YDZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the cyan fluorescent protein SCFP3A (K206A mutant)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2Y0G", "evidence_id": "EV-PDB-2Y0G-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "2Y0G", "doi": "10.1016/J.JSB.2011.02.004", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2Y0G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of Enhanced Green Fluorescent Protein (EGFP)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EOH", "IPA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2WUR", "evidence_id": "EV-PDB-2WUR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.9 }, "provenance": { "deposit_id": "2WUR", "doi": "10.1021/JA1010652", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2WUR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Atomic resolution structure of GFP measured on a rotating anode" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2WSO", "evidence_id": "EV-PDB-2WSO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.15 }, "provenance": { "deposit_id": "2WSO", "doi": "10.1021/BI901093W", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2WSO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Cerulean Fluorescent Protein at physiological pH" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2WSN", "evidence_id": "EV-PDB-2WSN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.37 }, "provenance": { "deposit_id": "2WSN", "doi": "10.1021/BI901093W", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2WSN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Enhanced Cyan Fluorescent Protein at physiological pH" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2QZ0", "evidence_id": "EV-PDB-2QZ0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "2QZ0", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2QZ0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mature Q183E variant of Green Fluorescent Protein Chromophore" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2QU1", "evidence_id": "EV-PDB-2QU1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "2QU1", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2QU1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of a Cyclized GFP Variant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2QT2", "evidence_id": "EV-PDB-2QT2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.31 }, "provenance": { "deposit_id": "2QT2", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2QT2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Cyclized-Dehydrated Intermediate of GFP Variant Q183E in Chromophore Maturation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2QRF", "evidence_id": "EV-PDB-2QRF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "2QRF", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2QRF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Green Fluorescent Protein: Cyclized-only Intermediate of Chromophore Maturation in the Q183E variant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Cerulean Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2Q57", "evidence_id": "EV-PDB-2Q57-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2Q57", "doi": "10.1021/bi602664c", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2Q57" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of Cerulean GFP: A tryptophan-based chromophore useful for fluorescence lifetime imaging" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -123.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2OKY", "evidence_id": "EV-PDB-2OKY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "2OKY", "doi": "10.1110/ps.073358908", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2OKY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "A non-invasive GFP-based biosensor for mercury ions" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -123.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C,D,E,F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2OKW", "evidence_id": "EV-PDB-2OKW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "2OKW", "doi": "10.1110/ps.073358908", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2OKW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "A non-invasive GFP-based biosensor for mercury ions" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "IOD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2O2B", "evidence_id": "EV-PDB-2O2B-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.94 }, "provenance": { "deposit_id": "2O2B", "doi": "10.1529/biophysj.106.102319", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2O2B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Spectroscopic and Structural Study of the Heterotropic Linkage between Halide and Proton Ion Binding to Gfp Proteins: E2(GFP)-I Complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BR" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2O29", "evidence_id": "EV-PDB-2O29-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2O29", "doi": "10.1529/biophysj.106.102319", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2O29" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Spectroscopic and Structural Study of the Heterotropic Linkage between Halide and Proton Ion Binding to Gfp Proteins: E2(GFP)-BR Complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2O24", "evidence_id": "EV-PDB-2O24-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "2O24", "doi": "10.1529/biophysj.106.102319", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2O24" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Spectroscopic and Structural Study of the Heterotropic Linkage between Halide and Proton Ion Binding to Gfp Proteins: E2(GFP)-Cl Complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 10.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "YELLOW FLUORESCENT PROTEIN GLUTAREDOXIN FUSION PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2JAD", "evidence_id": "EV-PDB-2JAD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "2JAD", "doi": "10.1107/S0907444906051675", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2JAD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Yellow fluorescent protein - glutaredoxin fusion protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2HRS", "evidence_id": "EV-PDB-2HRS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "2HRS", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2HRS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of L42H V224H design intermediate for GFP metal ion reporter" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2HQZ", "evidence_id": "EV-PDB-2HQZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "2HQZ", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2HQZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of L42H design intermediate for GFP metal ion reporter" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green Fluorescent Protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2HJO", "evidence_id": "EV-PDB-2HJO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "2HJO", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2HJO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of V224H design intermediate for GFP metal ion reporter" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2HGY", "evidence_id": "EV-PDB-2HGY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.05 }, "provenance": { "deposit_id": "2HGY", "doi": "10.1021/ja063983u", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2HGY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of S65A Y66F E222A GFP variant after cyclization and carbon-carbon bond cleavage" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2HGD", "evidence_id": "EV-PDB-2HGD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "2HGD", "doi": "10.1021/ja063983u", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2HGD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of S65A Y66F GFP variant with an oxidized chromophore" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2HFC", "evidence_id": "EV-PDB-2HFC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "2HFC", "doi": "10.1021/ja063983u", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2HFC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of S65T Y66F R96A GFP variant in precursor state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2HCG", "evidence_id": "EV-PDB-2HCG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "2HCG", "doi": "10.1021/ja063983u", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2HCG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of S65T Y66F GFP variant after cyclization, carbon-carbon bond cleavage, and oxygen incorporation reactions" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2H6V", "evidence_id": "EV-PDB-2H6V-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.47 }, "provenance": { "deposit_id": "2H6V", "doi": "10.1529/biophysj.106.102319", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2H6V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Spectroscopic and structural study of the heterotropic linkage between halide and proton ion binding to GFP proteins- E2(GFP) APO FORM" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2G6E", "evidence_id": "EV-PDB-2G6E-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "2G6E", "doi": "10.1021/ja056635l", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2G6E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of cyclized F64L S65A Y66S GFP variant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2G5Z", "evidence_id": "EV-PDB-2G5Z-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2G5Z", "doi": "10.1021/ja056635l", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2G5Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of S65G Y66S GFP variant after spontaneous peptide hydrolysis and decarboxylation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2G5Z", "evidence_id": "EV-PDB-2G5Z-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2G5Z", "doi": "10.1021/ja056635l", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2G5Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of S65G Y66S GFP variant after spontaneous peptide hydrolysis and decarboxylation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DQ7", "evidence_id": "EV-PDB-3DQ7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.23 }, "provenance": { "deposit_id": "3DQ7", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DQ7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 1920 Atmospheres Number 1: Structure 17 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DQ9", "evidence_id": "EV-PDB-3DQ9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "3DQ9", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DQ9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 1500 Atmospheres Number 1: Structure 15 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DQA", "evidence_id": "EV-PDB-3DQA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.44 }, "provenance": { "deposit_id": "3DQA", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DQA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 1250 Atmospheres Number 4: Structure 14 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DQC", "evidence_id": "EV-PDB-3DQC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.49 }, "provenance": { "deposit_id": "3DQC", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DQC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 1250 Atmospheres Number 3: Structure 13 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DQE", "evidence_id": "EV-PDB-3DQE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.43 }, "provenance": { "deposit_id": "3DQE", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DQE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 1250 Atmospheres Number 1: Structure 11 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DQI", "evidence_id": "EV-PDB-3DQI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.42 }, "provenance": { "deposit_id": "3DQI", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DQI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 1000 Atmospheres Number 4: Structure 8 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DQJ", "evidence_id": "EV-PDB-3DQJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.51 }, "provenance": { "deposit_id": "3DQJ", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DQJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 1000 Atmospheres Number 3: Structure 7 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DQK", "evidence_id": "EV-PDB-3DQK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "3DQK", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DQK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 1000 Atmospheres Number 2: Structure 6 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DQM", "evidence_id": "EV-PDB-3DQM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.44 }, "provenance": { "deposit_id": "3DQM", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DQM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 750 Atmospheres: Structure 4 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DQN", "evidence_id": "EV-PDB-3DQN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.44 }, "provenance": { "deposit_id": "3DQN", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DQN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 500 Atmospheres: Structure 3 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3EVP", "evidence_id": "EV-PDB-3EVP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.453 }, "provenance": { "deposit_id": "3EVP", "doi": "10.1016/j.str.2008.10.008", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3EVP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "crystal structure of circular-permutated EGFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -195.95 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3G9A", "evidence_id": "EV-PDB-3G9A-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.614 }, "provenance": { "deposit_id": "3G9A", "doi": "10.1038/nsmb.1727", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3G9A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Green fluorescent protein bound to minimizer nanobody" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3GEX", "evidence_id": "EV-PDB-3GEX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "3GEX", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3GEX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "1.6 angstrom crystal structure of fluorescent protein Cypet" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -195.95 }, "construct": { "description": "Green Fluorescent Protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3K1K", "evidence_id": "EV-PDB-3K1K-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.15 }, "provenance": { "deposit_id": "3K1K", "doi": "10.1038/nsmb.1727", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3K1K" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Green fluorescent protein bound to enhancer nanobody" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "IPA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3OGO", "evidence_id": "EV-PDB-3OGO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "3OGO", "doi": "10.1002/pro.519", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3OGO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the GFP:GFP-nanobody complex at 2.8 A resolution in spacegroup P21212" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SSH", "evidence_id": "EV-PDB-3SSH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.277 }, "provenance": { "deposit_id": "3SSH", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SSH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Engineered high-affinity halide-binding protein derived from YFP: chloride complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "IOD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SSL", "evidence_id": "EV-PDB-3SSL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.449 }, "provenance": { "deposit_id": "3SSL", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SSL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Engineered high-affinity halide-binding protein derived from YFP: iodide complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "F" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SSV", "evidence_id": "EV-PDB-3SSV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.861 }, "provenance": { "deposit_id": "3SSV", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SSV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Engineered low-affinity halide-binding protein derived from YFP: fluoride complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "IOD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SSY", "evidence_id": "EV-PDB-3SSY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.769 }, "provenance": { "deposit_id": "3SSY", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SSY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Engineered low-affinity halide-binding protein derived from YFP: iodide complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SVC", "evidence_id": "EV-PDB-3SVC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.31 }, "provenance": { "deposit_id": "3SVC", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SVC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Engineered medium-affinity halide-binding protein derived from YFP: chloride complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BR", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SVD", "evidence_id": "EV-PDB-3SVD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.78 }, "provenance": { "deposit_id": "3SVD", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SVD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Engineered medium-affinity halide-binding protein derived from YFP: bromide complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Cytochrome b562 integral fusion with enhanced green fluorescent protein (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3U8P", "evidence_id": "EV-PDB-3U8P-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.75 }, "provenance": { "deposit_id": "3U8P", "doi": "10.1021/ja301987h", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3U8P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Cytochrome b562 integral fusion with EGFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3UFZ", "evidence_id": "EV-PDB-3UFZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "3UFZ", "doi": "10.1093/nar/gks786", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3UFZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of a Trp-less green fluorescent protein translated by the universal genetic code" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3UG0", "evidence_id": "EV-PDB-3UG0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.093 }, "provenance": { "deposit_id": "3UG0", "doi": "10.1093/nar/gks786", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3UG0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of a Trp-less green fluorescent protein translated by the simplified genetic code" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green Fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3W1C", "evidence_id": "EV-PDB-3W1C-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "3W1C", "doi": "10.1371/journal.pone.0073212", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3W1C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of a pressure sensitive YFP variant YFP-G1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein,ATPase WRNIP1 (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3VHT", "evidence_id": "EV-PDB-3VHT-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "3VHT", "doi": "10.1111/febs.13734", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3VHT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of GFP-Wrnip1 UBZ domain fusion protein in complex with ubiquitin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3VHT", "evidence_id": "EV-PDB-3VHT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "3VHT", "doi": "10.1111/febs.13734", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3VHT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of GFP-Wrnip1 UBZ domain fusion protein in complex with ubiquitin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Yellow fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3V3D", "evidence_id": "EV-PDB-3V3D-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "3V3D", "doi": "10.1021/ja400098b", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3V3D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of an eYFP single mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BR" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SVE", "evidence_id": "EV-PDB-3SVE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.492 }, "provenance": { "deposit_id": "3SVE", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SVE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Engineered low-affinity halide-binding protein derived from YFP: bromide complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SVB", "evidence_id": "EV-PDB-3SVB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "3SVB", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SVB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Engineered medium-affinity halide-binding protein derived from YFP: fluoride complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "FMT", "IOD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SV5", "evidence_id": "EV-PDB-3SV5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.53 }, "provenance": { "deposit_id": "3SV5", "doi": "10.1523/JNEUROSCI.4616-11.2013", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SV5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Engineered medium-affinity halide-binding protein derived from YFP: iodide complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "FMT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3ST0", "evidence_id": "EV-PDB-3ST0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.19 }, "provenance": { "deposit_id": "3ST0", "doi": "10.1523/JNEUROSCI.4616-11.2013", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3ST0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Engineered medium-affinity halide-binding protein derived from YFP: halide-free" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SST", "evidence_id": "EV-PDB-3SST-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.403 }, "provenance": { "deposit_id": "3SST", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SST" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Engineered low-affinity halide-binding protein derived from YFP: chloride complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SSP", "evidence_id": "EV-PDB-3SSP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.628 }, "provenance": { "deposit_id": "3SSP", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SSP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Engineered low-affinity halide-binding protein derived from YFP: halide-free" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BR" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SSK", "evidence_id": "EV-PDB-3SSK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.361 }, "provenance": { "deposit_id": "3SSK", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SSK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Engineered high-affinity halide-binding protein derived from YFP: bromide complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SS0", "evidence_id": "EV-PDB-3SS0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.492 }, "provenance": { "deposit_id": "3SS0", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SS0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Engineered high-affinity halide-binding protein derived from YFP: fluoride complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SRY", "evidence_id": "EV-PDB-3SRY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.159 }, "provenance": { "deposit_id": "3SRY", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SRY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Engineered high-affinity halide-binding protein derived from YFP: halide-free" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3P28", "evidence_id": "EV-PDB-3P28-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "3P28", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3P28" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of a Circular Permutant of Green Fluorescent Protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3LA1", "evidence_id": "EV-PDB-3LA1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.29 }, "provenance": { "deposit_id": "3LA1", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3LA1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High resolution crystal structure of CyPet mutant A167I" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3I19", "evidence_id": "EV-PDB-3I19-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.36 }, "provenance": { "deposit_id": "3I19", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3I19" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "1.4 Angstrom Crystal Structure of Fluorescent Protein Cypet" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3GJ2", "evidence_id": "EV-PDB-3GJ2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "3GJ2", "doi": "10.1021/ja808851n", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3GJ2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Photoactivated state of PA-GFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3GJ1", "evidence_id": "EV-PDB-3GJ1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "3GJ1", "doi": "10.1021/ja808851n", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3GJ1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Non photoactivated state of PA-GFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Myosin light chain kinase, Green fluorescent protein, Calmodulin-1 chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3EVR", "evidence_id": "EV-PDB-3EVR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "3EVR", "doi": "10.1016/j.str.2008.10.008", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3EVR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Calcium bound monomeric GCAMP2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "yellow fluorescence protein (chains A,B,C,D,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3ED8", "evidence_id": "EV-PDB-3ED8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "3ED8", "doi": "10.1515/BC.2009.008", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3ED8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Application of the superfolder YFP bimolecular fluorescence complementation for studying protein-protein interactions in vitro" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DQU", "evidence_id": "EV-PDB-3DQU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.42 }, "provenance": { "deposit_id": "3DQU", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DQU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 2000 Atmospheres Number 1: Structure 20 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DQO", "evidence_id": "EV-PDB-3DQO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "3DQO", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DQO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 1 Atmosphere Number 2: Structure 2 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DQL", "evidence_id": "EV-PDB-3DQL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.47 }, "provenance": { "deposit_id": "3DQL", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DQL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 1000 Atmospheres Number 1: Structure 5 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DQH", "evidence_id": "EV-PDB-3DQH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "3DQH", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DQH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 1000 Atmospheres Number 5: Structure 9 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DQF", "evidence_id": "EV-PDB-3DQF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.46 }, "provenance": { "deposit_id": "3DQF", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DQF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 1000 Atmospheres Number 6: Structure 10 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DQD", "evidence_id": "EV-PDB-3DQD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "3DQD", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DQD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 1250 Atmospheres Number 2: Structure 12 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DQ8", "evidence_id": "EV-PDB-3DQ8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.51 }, "provenance": { "deposit_id": "3DQ8", "doi": "10.1073/pnas.0802252105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DQ8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Yellow Fluorescent Protein Citrine Frozen at 1500 Atmospheres Number 2: Structure 16 in a Series of 26 High Pressure Structures" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.25, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4AS8", "evidence_id": "EV-PDB-4AS8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.02 }, "provenance": { "deposit_id": "4AS8", "doi": "10.1107/S0907444912037900", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4AS8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the cyan fluorescent protein Cerulean cryoprotected with ethylene glycol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4B5Y", "evidence_id": "EV-PDB-4B5Y-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "4B5Y", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4B5Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the cyan fluorescent protein mTurquoise-GL (K206A mutant) in space group C222(1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN, APOPTOSIS REGULATOR BAX (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4BDU", "evidence_id": "EV-PDB-4BDU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.998 }, "provenance": { "deposit_id": "4BDU", "doi": "10.1016/J.CELL.2012.12.031", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4BDU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Bax BH3-in-Groove dimer (GFP)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "PEG", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4EUL", "evidence_id": "EV-PDB-4EUL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "4EUL", "doi": "10.1371/journal.pone.0047132", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4EUL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of enhanced Green Fluorescent Protein to 1.35A resolution reveals alternative conformations for Glu222" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.9, "salt_mM": null, "temperature_c": -183.15 }, "construct": { "description": "Green fluorescent protein (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4GES", "evidence_id": "EV-PDB-4GES-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.23 }, "provenance": { "deposit_id": "4GES", "doi": "10.1002/anie.201204962", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4GES" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "crystal structure of GFP-TYR151PYZ with an unnatural amino acid incorporation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "RCaMP, Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4IK1", "evidence_id": "EV-PDB-4IK1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "4IK1", "doi": "10.1007/s13238-013-2103-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4IK1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High resolution structure of GCaMPJ at pH 8.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "RCaMP, Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4IK3", "evidence_id": "EV-PDB-4IK3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.007 }, "provenance": { "deposit_id": "4IK3", "doi": "10.1007/s13238-013-2103-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4IK3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High resolution structure of GCaMP3 at pH 8.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "RCaMP, Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4IK4", "evidence_id": "EV-PDB-4IK4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.01 }, "provenance": { "deposit_id": "4IK4", "doi": "10.1007/s13238-013-2103-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4IK4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High resolution structure of GCaMP3 at pH 5.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "RCaMP, Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4IK5", "evidence_id": "EV-PDB-4IK5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "4IK5", "doi": "10.1007/s13238-013-2103-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4IK5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High resolution structure of Delta-REST-GCaMP3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "RCaMP, Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4IK8", "evidence_id": "EV-PDB-4IK8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "4IK8", "doi": "10.1007/s13238-013-2103-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4IK8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High resolution structure of GCaMP3 dimer form 1 at pH 7.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "PEG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "RCaMP, Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4IK9", "evidence_id": "EV-PDB-4IK9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "4IK9", "doi": "10.1007/s13238-013-2103-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4IK9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High resolution structure of GCaMP3 dimer form 2 at pH 7.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "SO4", "TRS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.3, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4J88", "evidence_id": "EV-PDB-4J88-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.08 }, "provenance": { "deposit_id": "4J88", "doi": "10.1002/anie.201301490", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4J88" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Dark-state structure of sfGFP containing the unnatural amino acid p-azido-phenylalanine at residue 66" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "SO4", "TRS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.3, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4J8A", "evidence_id": "EV-PDB-4J8A-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.26 }, "provenance": { "deposit_id": "4J8A", "doi": "10.1002/anie.201301490", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4J8A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Irradiated-state structure of sfGFP containing the unnatural amino acid p-azido-phenylalanine at residue 145" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CS", "HQY" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -73.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C,D,E,F,G,H)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4JFG", "evidence_id": "EV-PDB-4JFG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.001 }, "provenance": { "deposit_id": "4JFG", "doi": "10.1002/anie.201301307", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4JFG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of sfGFP-66-HqAla" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "D12", "PGT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4JRB", "evidence_id": "EV-PDB-4JRB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.414 }, "provenance": { "deposit_id": "4JRB", "doi": "10.1016/j.jaci.2013.06.014", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4JRB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Cockroach Allergen Bla g 1 Tandem Repeat as a EGFP fusion" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "EPE", "NA", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4KA9", "evidence_id": "EV-PDB-4KA9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.58 }, "provenance": { "deposit_id": "4KA9", "doi": "10.1016/j.str.2014.03.014", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4KA9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure analysis of single amino acid deletion mutations in EGFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "SO4", "TRS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4KAG", "evidence_id": "EV-PDB-4KAG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.12 }, "provenance": { "deposit_id": "4KAG", "doi": "10.1107/S139900471401267X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4KAG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure analysis of a single amino acid deletion mutation in EGFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4KEX", "evidence_id": "EV-PDB-4KEX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "4KEX", "doi": "10.1107/S139900471401267X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4KEX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure analysis of a single amino acid deletion mutation in EGFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.3, "salt_mM": null, "temperature_c": null }, "construct": { "description": "fluorescent protein GFP1-9 (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4KF5", "evidence_id": "EV-PDB-4KF5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.599 }, "provenance": { "deposit_id": "4KF5", "doi": "10.1107/S0907444913024608", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4KF5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Split GFP complexed with engineered sfCherry with an insertion of GFP fragment" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4KW4", "evidence_id": "EV-PDB-4KW4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.746 }, "provenance": { "deposit_id": "4KW4", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4KW4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Green Fluorescent Protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4KW9", "evidence_id": "EV-PDB-4KW9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "4KW9", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4KW9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Green Fluorescent Protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACY" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "EGFP-based Calcium Sensor CatchER (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4L13", "evidence_id": "EV-PDB-4L13-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.66 }, "provenance": { "deposit_id": "4L13", "doi": "10.1107/S0907444913021306", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4L13" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Ligand Free EGFP-based Calcium Sensor CatchER" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LQT", "evidence_id": "EV-PDB-4LQT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "4LQT", "doi": "10.1021/ja407644b", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LQT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "1.10A resolution crystal structure of a superfolder green fluorescent protein (W57A) mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LQU", "evidence_id": "EV-PDB-4LQU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "4LQU", "doi": "10.1021/ja407644b", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LQU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "1.60A resolution crystal structure of a superfolder green fluorescent protein (W57G) mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C,D,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LW5", "evidence_id": "EV-PDB-4LW5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.55 }, "provenance": { "deposit_id": "4LW5", "doi": "10.1002/pro.2421", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LW5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of all-trans green fluorescent protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -123.15 }, "construct": { "description": "Green fluorescent protein, chimeric construct,GFP-like fluorescent chromoprotein FP506, related (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NDJ", "evidence_id": "EV-PDB-4NDJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "4NDJ", "doi": "10.1016/j.jmb.2015.06.006", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NDJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of a computational designed engrailed homeodomain variant fused with YFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -123.15 }, "construct": { "description": "E23P-YFP, GFP-like fluorescent chromoprotein FP506, related, chimeric construct, (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NDK", "evidence_id": "EV-PDB-4NDK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "4NDK", "doi": "10.1016/j.jmb.2015.06.006", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NDK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of a computational designed engrailed homeodomain variant fused with YFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4P1Q", "evidence_id": "EV-PDB-4P1Q-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "4P1Q", "doi": "10.1002/cbic.201402075", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4P1Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GREEN FLUORESCENT PROTEIN E222H VARIANT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myosin-7,Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4P7H", "evidence_id": "EV-PDB-4P7H-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "4P7H", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4P7H" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Human beta-Cardiac Myosin Motor Domain::GFP chimera" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "2OW", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myosin-7,Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4PA0", "evidence_id": "EV-PDB-4PA0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.25 }, "provenance": { "deposit_id": "4PA0", "doi": "10.1038/ncomms8974", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4PA0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Omecamtiv Mercarbil binding site on the Human Beta-Cardiac Myosin Motor Domain" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CAC", "MPD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein,Bcl-2 homologous antagonist/killer (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4U2V", "evidence_id": "EV-PDB-4U2V-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "4U2V", "doi": "10.1016/j.molcel.2014.07.016", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4U2V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Bak BH3-in-Groove dimer (GFP)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "ClpB protein, putative,Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4XBI", "evidence_id": "EV-PDB-4XBI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.013 }, "provenance": { "deposit_id": "4XBI", "doi": "10.1002/pro.2739", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4XBI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure Of A Malarial Protein Involved in Proteostasis" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PE5" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein, mAb LCDR3, Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4XGY", "evidence_id": "EV-PDB-4XGY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.494 }, "provenance": { "deposit_id": "4XGY", "doi": "10.1107/S2053230X15008845", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4XGY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GFP based antibody (fluorobody)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4XL5", "evidence_id": "EV-PDB-4XL5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "4XL5", "doi": "10.1042/BSR20150080", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4XL5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of bGFP-A / EGFP complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4PFE", "evidence_id": "EV-PDB-4PFE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.603 }, "provenance": { "deposit_id": "4PFE", "doi": "10.1002/anie.201506686", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4PFE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of vsfGFP-0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MES", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "mKalama1 (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4ORN", "evidence_id": "EV-PDB-4ORN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.71 }, "provenance": { "deposit_id": "4ORN", "doi": "10.1039/c5cp00887e", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4ORN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Blue Fluorescent Protein mKalama1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4OGS", "evidence_id": "EV-PDB-4OGS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.21 }, "provenance": { "deposit_id": "4OGS", "doi": "10.1039/c4cp00311j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4OGS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of GFP S205A/T203V at 2.2 A resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "K", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4N3D", "evidence_id": "EV-PDB-4N3D-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.34 }, "provenance": { "deposit_id": "4N3D", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4N3D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the dimeric variant EGFP-K162Q in P61 space group" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "EGFP-based Calcium Sensor CatchER (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4L1I", "evidence_id": "EV-PDB-4L1I-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "4L1I", "doi": "10.1107/S0907444913021306", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4L1I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of EGFP-based Calcium Sensor CatchER complexed with Ca" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "EGFP-based Calcium Sensor CatchER (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4L12", "evidence_id": "EV-PDB-4L12-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.78 }, "provenance": { "deposit_id": "4L12", "doi": "10.1107/S0907444913021306", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4L12" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of EGFP-based Calcium Sensor CatchER complexed with Gd" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NI" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4KW8", "evidence_id": "EV-PDB-4KW8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.459 }, "provenance": { "deposit_id": "4KW8", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4KW8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Green Fluorescent Protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "SO4", "TRS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4J89", "evidence_id": "EV-PDB-4J89-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "4J89", "doi": "10.1002/anie.201301490", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4J89" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Different photochemical events of a genetically encoded aryl azide define and modulate GFP fluorescence" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "TRS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4H48", "evidence_id": "EV-PDB-4H48-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "4H48", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4H48" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "1.45 angstrom CyPet Structure at pH7.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4H47", "evidence_id": "EV-PDB-4H47-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "4H47", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4H47" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "1.9 angstrom CyPet structure at pH5.2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "CU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.9, "salt_mM": null, "temperature_c": -183.15 }, "construct": { "description": "green fluorescent protein (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4GF6", "evidence_id": "EV-PDB-4GF6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "4GF6", "doi": "10.1002/anie.201204962", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4GF6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "crystal structure of GFP with cuprum bound at the Incorporated metal Chelating Amino Acid PYZ151" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "GOL", "PEG", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4EN1", "evidence_id": "EV-PDB-4EN1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.62 }, "provenance": { "deposit_id": "4EN1", "doi": "10.1107/S0907444913001546", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4EN1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The 1.62A structure of a FRET-optimized Cerulean Fluorescent Protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4AR7", "evidence_id": "EV-PDB-4AR7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.23 }, "provenance": { "deposit_id": "4AR7", "doi": "10.1107/S1744309112028667", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4AR7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the cyan fluorescent protein mTurquoise" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ADP", "ALF", "CA", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "UNCONVENTIONAL MYOSIN-VI, GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4ANJ", "evidence_id": "EV-PDB-4ANJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "4ANJ", "doi": "10.1016/J.MOLCEL.2012.07.034", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4ANJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "MYOSIN VI (MDinsert2-GFP fusion) PRE-POWERSTROKE STATE (MG.ADP.AlF4)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.25, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3ZTF", "evidence_id": "EV-PDB-3ZTF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.31 }, "provenance": { "deposit_id": "3ZTF", "doi": "10.1038/NCOMMS1738", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3ZTF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray Structure of the Cyan Fluorescent Protein mTurquoise2 (K206A mutant)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green Fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3W1D", "evidence_id": "EV-PDB-3W1D-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "3W1D", "doi": "10.1371/journal.pone.0073212", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3W1D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of a pressure sensitive YFP variant YFP-G3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5DPG", "evidence_id": "EV-PDB-5DPG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "5DPG", "doi": "10.1107/S2059798315022858", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5DPG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "sfGFP mutant - 133 p-cyano-L-phenylalanine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "pnGFP1.5-Y.Cro,Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5F9G", "evidence_id": "EV-PDB-5F9G-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.772 }, "provenance": { "deposit_id": "5F9G", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5F9G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "pnGFP1.5-Y.Cro: circularly permuted green fluorescent protein (with a tyrosine-derived chromophore)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5JZL", "evidence_id": "EV-PDB-5JZL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "5JZL", "doi": "10.1038/s41598-017-18045-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5JZL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The Structure of Monomeric Ultra Stable Green Fluorescent Protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DB5", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5NI3", "evidence_id": "EV-PDB-5NI3-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.28 }, "provenance": { "deposit_id": "5NI3", "doi": "10.1002/advs.202003167", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5NI3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "sfGFP 204-204 mutant dimer" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DB5", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5NI3", "evidence_id": "EV-PDB-5NI3-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.28 }, "provenance": { "deposit_id": "5NI3", "doi": "10.1002/advs.202003167", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5NI3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "sfGFP 204-204 mutant dimer" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DB5", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5NI3", "evidence_id": "EV-PDB-5NI3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.28 }, "provenance": { "deposit_id": "5NI3", "doi": "10.1002/advs.202003167", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5NI3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "sfGFP 204-204 mutant dimer" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DB5", "EDO", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5NHN", "evidence_id": "EV-PDB-5NHN-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.96 }, "provenance": { "deposit_id": "5NHN", "doi": "10.1038/s42004-019-0185-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5NHN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Super-Folder Green Fluorescent Protein Artificiall dimer linked via 148 position" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DB5", "EDO", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5NHN", "evidence_id": "EV-PDB-5NHN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.96 }, "provenance": { "deposit_id": "5NHN", "doi": "10.1038/s42004-019-0185-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5NHN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Super-Folder Green Fluorescent Protein Artificiall dimer linked via 148 position" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AE4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5N9O", "evidence_id": "EV-PDB-5N9O-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.53 }, "provenance": { "deposit_id": "5N9O", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5N9O" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "EGFP(enhanced green fluorescent protein) mutant - L232H" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "IMD", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5MSE", "evidence_id": "EV-PDB-5MSE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.66 }, "provenance": { "deposit_id": "5MSE", "doi": "10.1016/j.cell.2018.05.045", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5MSE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GFP nuclear transport receptor mimic 3B8" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CIT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains B,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5MAK", "evidence_id": "EV-PDB-5MAK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "5MAK", "doi": "10.1038/s41598-017-15711-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5MAK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GFP-binding DARPin fusion gc_R7" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "PEG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains B,D,F,H)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5MAD", "evidence_id": "EV-PDB-5MAD-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.53 }, "provenance": { "deposit_id": "5MAD", "doi": "10.1038/s41598-017-15711-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5MAD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GFP-binding DARPin 3G61" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains B,D,F,H)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5MA9", "evidence_id": "EV-PDB-5MA9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.57 }, "provenance": { "deposit_id": "5MA9", "doi": "10.1038/s41598-017-15711-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5MA9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GFP-binding DARPin fusion gc_R11" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains B,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5MA8", "evidence_id": "EV-PDB-5MA8-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.35 }, "provenance": { "deposit_id": "5MA8", "doi": "10.1038/s41598-017-15711-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5MA8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GFP-binding DARPin 3G124nc" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5MA6", "evidence_id": "EV-PDB-5MA6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "5MA6", "doi": "10.1038/s41598-017-15711-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5MA6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GFP-binding DARPin 3G124nc" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CIT", "EDO", "IPA", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains B,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5MA5", "evidence_id": "EV-PDB-5MA5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "5MA5", "doi": "10.1038/s41598-017-15711-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5MA5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GFP-binding DARPin fusion gc_K11" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5MA4", "evidence_id": "EV-PDB-5MA4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "5MA4", "doi": "10.1038/s41598-017-15711-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5MA4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GFP-binding DARPin fusion gc_K7" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5MA3", "evidence_id": "EV-PDB-5MA3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5MA3", "doi": "10.1038/s41598-017-15711-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5MA3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GFP-binding DARPin fusion gc_R11" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5LEM", "evidence_id": "EV-PDB-5LEM-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.98 }, "provenance": { "deposit_id": "5LEM", "doi": "10.1038/s41598-017-11472-x", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5LEM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of DARPin-DARPin rigid fusion, variant DD_Off7_11_3G124 in complex with Maltose-binding Protein and Green Fluorescent Protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains C,F,I)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5LEL", "evidence_id": "EV-PDB-5LEL-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "5LEL", "doi": "10.1038/s41598-017-11472-x", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5LEL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of DARPin-DARPin rigid fusion, variant DD_Off7_10_3G124 in complex with Maltose-binding Protein and Green Fluorescent Protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein, Bcl-2 homologous antagonist/killer (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KTG", "evidence_id": "EV-PDB-5KTG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.802 }, "provenance": { "deposit_id": "5KTG", "doi": "10.1038/srep30763", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KTG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of mouse Bak BH3-in-groove homodimer (GFP)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "GOL", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5JZK", "evidence_id": "EV-PDB-5JZK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "5JZK", "doi": "10.1038/s41598-017-18045-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5JZK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The Structure of Ultra Stable Green Fluorescent Protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein,HsdR (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5J3N", "evidence_id": "EV-PDB-5J3N-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.45 }, "provenance": { "deposit_id": "5J3N", "doi": "10.1074/jbc.RA118.003978", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5J3N" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "C-terminal domain of EcoR124I HsdR subunit fused with the pH-sensitive GFP variant ratiometric pHluorin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5J2O", "evidence_id": "EV-PDB-5J2O-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "5J2O", "doi": "10.1107/S2053230X16008311", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5J2O" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the cyan fluorescence protein Cerulean S175G mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MLT", "UMQ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5HZO", "evidence_id": "EV-PDB-5HZO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.49 }, "provenance": { "deposit_id": "5HZO", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5HZO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GFP mutant S205G" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5HW9", "evidence_id": "EV-PDB-5HW9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "5HW9", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5HW9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Filamentous Assembly of Green Fluorescent Protein Supported by a C-terminal fusion of 18-residues, viewed in space group P21" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MPD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5HGE", "evidence_id": "EV-PDB-5HGE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.863 }, "provenance": { "deposit_id": "5HGE", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5HGE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Filamentous Assembly of Green Fluorescent Protein Supported by a C-terminal fusion of 18-residues, viewed in space group P212121" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5HBD", "evidence_id": "EV-PDB-5HBD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "5HBD", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5HBD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Filamentous Assembly of Green Fluorescent Protein Supported by a C-terminal fusion of 18-residues, viewed in space group C2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "EDO", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -180.0 }, "construct": { "description": "Green fluorescent protein,Extracellular streptodornase D (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5FGU", "evidence_id": "EV-PDB-5FGU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.896 }, "provenance": { "deposit_id": "5FGU", "doi": "10.1093/nar/gkw143", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5FGU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Sda1 nuclease apoprotein as an EGFP fixed-arm fusion" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5EHU", "evidence_id": "EV-PDB-5EHU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "5EHU", "doi": "10.1002/chem.201503908", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5EHU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "sfGFP mutant with unnatural amino acid 4-azidoethoxy-L-phenylalanine incorporated at the 149 site" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5DU0", "evidence_id": "EV-PDB-5DU0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.35 }, "provenance": { "deposit_id": "5DU0", "doi": "10.1038/srep18459", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5DU0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of rsFolder in the non-fluorescent off-state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PEG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5DTZ", "evidence_id": "EV-PDB-5DTZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "5DTZ", "doi": "10.1038/srep18459", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5DTZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of rsFolder in the fluorescent on-state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.1, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5DTY", "evidence_id": "EV-PDB-5DTY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "5DTY", "doi": "10.1038/srep18459", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5DTY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of rsEGFP2 in the non-fluorescent off-state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.1, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5DTX", "evidence_id": "EV-PDB-5DTX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "5DTX", "doi": "10.1038/srep18459", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5DTX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of rsEGFP2 in the fluorescent on-state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green/cyan WasCFP_pH10 at pH 10.0 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5DRG", "evidence_id": "EV-PDB-5DRG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.14 }, "provenance": { "deposit_id": "5DRG", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5DRG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Green/cyan WasCFP at pH 10.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "WasCFP-pH5.5 at pH 5.5 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5DRF", "evidence_id": "EV-PDB-5DRF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.14 }, "provenance": { "deposit_id": "5DRF", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5DRF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Green/cyan WasCFP-pH5.5 at pH 5.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 2.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "WasCFP_pH2 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5DQM", "evidence_id": "EV-PDB-5DQM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "5DQM", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5DQM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Green/cyan WasCFP at pH 2.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "WasCFP_pH2 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5DQB", "evidence_id": "EV-PDB-5DQB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "5DQB", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5DQB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Green/cyan WasCFP at pH 8.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5DPJ", "evidence_id": "EV-PDB-5DPJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "5DPJ", "doi": "10.1107/S2059798315022858", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5DPJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "sfGFP double mutant - 133/149 p-ethynyl-L-phenylalanine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C,D,E,F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5DPI", "evidence_id": "EV-PDB-5DPI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.54 }, "provenance": { "deposit_id": "5DPI", "doi": "10.1107/S2059798315022858", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5DPI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "sfGFP double mutant - 133/149 p-cyano-L-phenylalanine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CO2", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5DPH", "evidence_id": "EV-PDB-5DPH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.42 }, "provenance": { "deposit_id": "5DPH", "doi": "10.1107/S2059798315022858", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5DPH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "sfGFP mutant - 149 p-cyano-L-phenylalanine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GLY", "NAG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Glycine receptor subunit beta,Green fluorescent protein (chains E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5BKG", "evidence_id": "EV-PDB-5BKG-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.8 }, "provenance": { "deposit_id": "5BKG", "doi": "10.1016/j.neuron.2021.08.019", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5BKG" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cyro-EM structure of human Glycine Receptor alpha2-beta heteromer, glycine bound, (semi)open state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GLY", "NAG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Glycine receptor subunit beta,Green fluorescent protein (chains E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5BKF", "evidence_id": "EV-PDB-5BKF-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.6 }, "provenance": { "deposit_id": "5BKF", "doi": "10.1016/j.neuron.2021.08.019", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5BKF" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cyro-EM structure of human Glycine Receptor alpha2-beta heteromer, Glycine bound, desensitized state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C,D,E,F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5B61", "evidence_id": "EV-PDB-5B61-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.115 }, "provenance": { "deposit_id": "5B61", "doi": "10.1002/1873-3468.12534", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5B61" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Extra-superfolder GFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GREEN FLUORESCENT PROTEIN (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5AQB", "evidence_id": "EV-PDB-5AQB-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.37 }, "provenance": { "deposit_id": "5AQB", "doi": "10.1016/J.JMB.2016.03.002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5AQB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DARPin-based Crystallization Chaperones exploit Molecular Geometry as a Screening Dimension in Protein Crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4ZF5", "evidence_id": "EV-PDB-4ZF5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "4ZF5", "doi": "10.1021/acscentsci.5b00160", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4ZF5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Green Fluorescent Protein (GFP); S65T, Y66(Cl2Y), H148D; circular permutant ( 50-51)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4ZF4", "evidence_id": "EV-PDB-4ZF4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.823 }, "provenance": { "deposit_id": "4ZF4", "doi": "10.1021/acscentsci.5b00160", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4ZF4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Green Fluorescent Protein (GFP); S65T, Y66(Cl1Y), H148D; circular permutant (50-51)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4ZF3", "evidence_id": "EV-PDB-4ZF3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "4ZF3", "doi": "10.1021/acscentsci.5b00160", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4ZF3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Green Fluorescent Protein (GFP); S65T, H148D; circular permutant ( 50-51)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein,Tax1-binding protein 1 (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4Z4M", "evidence_id": "EV-PDB-4Z4M-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.15 }, "provenance": { "deposit_id": "4Z4M", "doi": "10.1111/febs.13734", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4Z4M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of GFP-TAX1BP1 UBZ2 domain fusion protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein,Tax1-binding protein 1 (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4Z4K", "evidence_id": "EV-PDB-4Z4K-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "4Z4K", "doi": "10.1111/febs.13734", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4Z4K" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of GFP-TAX1BP1 UBZ1+2 domain fusion protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4XVP", "evidence_id": "EV-PDB-4XVP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.4 }, "provenance": { "deposit_id": "4XVP", "doi": "10.1042/BSR20150080", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4XVP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of bGFP-C / EGFP complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "rsGreen0.7 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4XOW", "evidence_id": "EV-PDB-4XOW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "4XOW", "doi": "10.1021/acsnano.5b04129", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4XOW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of rsGreen0.7 in the green-on-state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "rsGreen0.7 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4XOV", "evidence_id": "EV-PDB-4XOV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "4XOV", "doi": "10.1021/acsnano.5b04129", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4XOV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of rsGreen0.7 in the green-off-state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5O89", "evidence_id": "EV-PDB-5O89-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5O89", "doi": "10.1038/nchem.2853", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5O89" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of rsEGFP2 in the fluorescent on-state determined by SFX" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5O8B", "evidence_id": "EV-PDB-5O8B-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5O8B", "doi": "10.1038/nchem.2853", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5O8B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Difference-refined excited-state structure of rsEGFP2 1ps following 400nm-laser irradiation of the off-state." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5O8C", "evidence_id": "EV-PDB-5O8C-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5O8C", "doi": "10.1038/nchem.2853", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5O8C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Composite structure of rsEGFP2 1ps following 400nm-laser irradiation of the off-state." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5OX9", "evidence_id": "EV-PDB-5OX9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.56 }, "provenance": { "deposit_id": "5OX9", "doi": "10.1021/acs.biochem.7b01088", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5OX9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Cyan Fluorescent Protein SCFP3A at pH 4.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5OXB", "evidence_id": "EV-PDB-5OXB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.38 }, "provenance": { "deposit_id": "5OXB", "doi": "10.1021/acs.biochem.7b01088", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5OXB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of blue-light irradiated Cerulean" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5OXC", "evidence_id": "EV-PDB-5OXC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.02 }, "provenance": { "deposit_id": "5OXC", "doi": "10.1021/acs.biochem.7b01088", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5OXC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Cerulean Fluorescent Protein at 1.02 Angstrom resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5WJ2", "evidence_id": "EV-PDB-5WJ2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.409 }, "provenance": { "deposit_id": "5WJ2", "doi": "10.1016/j.str.2017.12.006", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5WJ2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the green fluorescent protein Clover" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5WJ4", "evidence_id": "EV-PDB-5WJ4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.631 }, "provenance": { "deposit_id": "5WJ4", "doi": "10.1016/j.str.2017.12.006", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5WJ4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of redox-sensitive green fluorescent protein Clover mutant roClover1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -73.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5Z6Y", "evidence_id": "EV-PDB-5Z6Y-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.87 }, "provenance": { "deposit_id": "5Z6Y", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5Z6Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of sfYFP48S95C66BPA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6AA2", "evidence_id": "EV-PDB-6AA2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "6AA2", "doi": "10.1016/j.bbagen.2019.01.016", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6AA2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of ReQy1 (oxidized form)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "MPD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6AS9", "evidence_id": "EV-PDB-6AS9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "6AS9", "doi": "10.1038/s41594-018-0096-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6AS9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Filamentous Assembly of Green Fluorescent Protein Supported by a C-terminal fusion of 18-residues, viewed in space group P212121 form 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NHE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6B7R", "evidence_id": "EV-PDB-6B7R-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.73 }, "provenance": { "deposit_id": "6B7R", "doi": "10.1021/jacs.7b10680", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6B7R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Truncated strand 11-less green fluorescent protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein,Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6B7T", "evidence_id": "EV-PDB-6B7T-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.91 }, "provenance": { "deposit_id": "6B7T", "doi": "10.1021/jacs.7b10680", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6B7T" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Truncated strand 10-less green fluorescent protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CO2" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6B9C", "evidence_id": "EV-PDB-6B9C-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.695 }, "provenance": { "deposit_id": "6B9C", "doi": "10.1107/S2059798321006525", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6B9C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Superfolder Green Fluorescent Protein with 4-nitro-L-phenylalanine at the chromophore (position 66)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "superfolder green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6DQ0", "evidence_id": "EV-PDB-6DQ0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.048 }, "provenance": { "deposit_id": "6DQ0", "doi": "10.1107/S2053230X1801169X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6DQ0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "sfGFP D133 mutated to 4-nitro-L-phenylalanine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "sfGFP (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6DQ1", "evidence_id": "EV-PDB-6DQ1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.598 }, "provenance": { "deposit_id": "6DQ1", "doi": "10.1107/S2053230X1801169X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6DQ1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "sfGFP N149 mutated to 4-nitro-L-phenylalanine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "iNicSnFR 1.0, a genetically encoded nicotine biosensor,Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6EFR", "evidence_id": "EV-PDB-6EFR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "6EFR", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6EFR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of iNicSnFR 1.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "FMT", "GOL", "PG4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein,Optimized Ratiometric Calcium Sensor,Green fluorescent protein,Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6GEL", "evidence_id": "EV-PDB-6GEL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.51 }, "provenance": { "deposit_id": "6GEL", "doi": "10.1126/sciadv.aaw4988", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6GEL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The structure of TWITCH-2B" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MPD", "MRD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6GO9", "evidence_id": "EV-PDB-6GO9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.672 }, "provenance": { "deposit_id": "6GO9", "doi": "10.1021/acs.jpcb.8b07260", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6GO9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of GFPmut2 crystallized at pH 6 and transferred to pH 7" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6GQH", "evidence_id": "EV-PDB-6GQH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "6GQH", "doi": "10.1021/acs.jpcb.8b07260", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6GQH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of GFPmut2 crystallized at pH 8.5 and transferred to pH 6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6GRM", "evidence_id": "EV-PDB-6GRM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "6GRM", "doi": "10.1021/acs.jpcb.8b07260", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6GRM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of GFPmut2 crystallized at pH 6 and transferred to pH 9" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "EDO", "GOL", "NA", "TLA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myosin light chain kinase 2, skeletal/cardiac muscle,Unconventional myosin-X,Green fluorescent protein,Calmodulin-1 (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6HR1", "evidence_id": "EV-PDB-6HR1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.901 }, "provenance": { "deposit_id": "6HR1", "doi": "10.1016/j.str.2021.09.002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6HR1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the YFPnano fusion protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6HUT", "evidence_id": "EV-PDB-6HUT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.29 }, "provenance": { "deposit_id": "6HUT", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6HUT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GFP8 - a stabilized variant of cycle-3 GFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6IR6", "evidence_id": "EV-PDB-6IR6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.642 }, "provenance": { "deposit_id": "6IR6", "doi": "10.1038/s41598-019-41309-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6IR6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Green fluorescent protein variant GFPuv with the native lysine residue at the C-terminus" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "LDO", "MES", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6IR7", "evidence_id": "EV-PDB-6IR7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.277 }, "provenance": { "deposit_id": "6IR7", "doi": "10.1038/s41598-019-41309-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6IR7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Green fluorescent protein variant GFPuv with the modification to 6-hydroxynorleucine at the C-terminus" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ADP", "BEF", "MG", "PGV" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein (chains G)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6ITC", "evidence_id": "EV-PDB-6ITC-6", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.45 }, "provenance": { "deposit_id": "6ITC", "doi": "10.1038/s41467-019-10918-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6ITC" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of a substrate engaged SecA-SecY protein translocation machine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -217.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6JGH", "evidence_id": "EV-PDB-6JGH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.94 }, "provenance": { "deposit_id": "6JGH", "doi": "10.1107/S205225251900246X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6JGH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the F99S/M153T/V163A/T203I variant of GFP at 0.94 A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -217.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6JGJ", "evidence_id": "EV-PDB-6JGJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.78 }, "provenance": { "deposit_id": "6JGJ", "doi": "10.1107/S205225251900246X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6JGJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the F99S/M153T/V163A/E222Q variant of GFP at 0.78 A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.1, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6KKZ", "evidence_id": "EV-PDB-6KKZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.9 }, "provenance": { "deposit_id": "6KKZ", "doi": "10.1107/S2059798319014608", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6KKZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the S65T/F99S/M153T/V163A variant of perdeuterated GFP at pD 8.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.1, "salt_mM": null, "temperature_c": -223.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6KL1", "evidence_id": "EV-PDB-6KL1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.851 }, "provenance": { "deposit_id": "6KL1", "doi": "10.1107/S2059798319014608", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6KL1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the S65T/F99S/M153T/V163A variant of non-deuterated GFP at pD 8.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6KRG", "evidence_id": "EV-PDB-6KRG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "6KRG", "doi": "10.1038/s41467-020-18433-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6KRG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of sfGFP Y182TMSiPhe" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6L27", "evidence_id": "EV-PDB-6L27-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.77 }, "provenance": { "deposit_id": "6L27", "doi": "10.1021/acs.jpclett.9b03252", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6L27" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray crystal structure of the mutant green fluorescent protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMP" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Chimera of Cyclic nucleotide-gated potassium channel mll3241 and Yellow fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6M63", "evidence_id": "EV-PDB-6M63-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.25 }, "provenance": { "deposit_id": "6M63", "doi": "10.1038/s41467-022-32994-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6M63" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of a cAMP sensor G-Flamp1." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein (chains a,b,c,d,e,f,g,h,i,j,k,l,m,n,o)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6MB2", "evidence_id": "EV-PDB-6MB2-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 5.0 }, "provenance": { "deposit_id": "6MB2", "doi": "10.1038/celldisc.2015.13", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6MB2" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the PYD filament of AIM2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "GFP-17 (chains b,d,f,h,j,l,n,p)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6MDR", "evidence_id": "EV-PDB-6MDR-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.47 }, "provenance": { "deposit_id": "6MDR", "doi": "10.1038/s41557-018-0196-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6MDR" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the Ceru+32/GFP-17 protomer" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Ceru+32 (chains a,c,e,g,i,k,m,o)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6MDR", "evidence_id": "EV-PDB-6MDR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.47 }, "provenance": { "deposit_id": "6MDR", "doi": "10.1038/s41557-018-0196-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6MDR" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the Ceru+32/GFP-17 protomer" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Chimera protein of NLR family CARD domain-containing protein 4 and EGFP (chains A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,a,b,c,d,e)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6MKS", "evidence_id": "EV-PDB-6MKS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.4 }, "provenance": { "deposit_id": "6MKS", "doi": "10.1074/jbc.RA118.006050", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6MKS" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of NLRC4-CARD filament" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6LR7", "evidence_id": "EV-PDB-6LR7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.67 }, "provenance": { "deposit_id": "6LR7", "doi": "10.1038/s41598-020-62606-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6LR7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of GFPuv complexed with the nanobody LaG16 at 1.67 Angstron resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CIT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Fusion protein of Green fluorescent protein and Sensor histidine kinase CitA (chains B,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6LNP", "evidence_id": "EV-PDB-6LNP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.993 }, "provenance": { "deposit_id": "6LNP", "doi": "10.1021/acscentsci.0c00518", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6LNP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of citrate Biosensor" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.6, "salt_mM": null, "temperature_c": -223.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6KL0", "evidence_id": "EV-PDB-6KL0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.798 }, "provenance": { "deposit_id": "6KL0", "doi": "10.1107/S2059798319014608", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6KL0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the S65T/F99S/M153T/V163A variant of perdeuterated GFP at pD 7.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -217.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6JGI", "evidence_id": "EV-PDB-6JGI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.85 }, "provenance": { "deposit_id": "6JGI", "doi": "10.1107/S205225251900246X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6JGI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the S65T/F99S/M153T/V163A variant of GFP at 0.85 A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6GQG", "evidence_id": "EV-PDB-6GQG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.792 }, "provenance": { "deposit_id": "6GQG", "doi": "10.1021/acs.jpcb.8b07260", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6GQG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of GFPmut2 crystallized at pH 8.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MPD", "MRD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6GO8", "evidence_id": "EV-PDB-6GO8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.648 }, "provenance": { "deposit_id": "6GO8", "doi": "10.1021/acs.jpcb.8b07260", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6GO8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of GFPmut2 crystallized at pH 6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "FMT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein,Optimized Ratiometric Calcium Sensor,Green fluorescent protein,Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6GEZ", "evidence_id": "EV-PDB-6GEZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.47 }, "provenance": { "deposit_id": "6GEZ", "doi": "10.1126/sciadv.aaw4988", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6GEZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE STRUCTURE OF TWITCH-2B N532F" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6FWW", "evidence_id": "EV-PDB-6FWW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.131 }, "provenance": { "deposit_id": "6FWW", "doi": "10.1021/acs.molpharmaceut.8b00341", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6FWW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GFP/KKK. A redesigned GFP with improved solubility" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6FLL", "evidence_id": "EV-PDB-6FLL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.79 }, "provenance": { "deposit_id": "6FLL", "doi": "10.1021/acschembio.8b00267", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6FLL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPECTROSCOPIC AND STRUCTURAL STUDY OF QW, A EGFP MUTANT SHOWING PHOTOSWITCHING PROPERTIES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6AA6", "evidence_id": "EV-PDB-6AA6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.39 }, "provenance": { "deposit_id": "6AA6", "doi": "10.1016/j.bbagen.2019.01.016", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6AA6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of ReQy1 (reduced form)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5WJ3", "evidence_id": "EV-PDB-5WJ3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.351 }, "provenance": { "deposit_id": "5WJ3", "doi": "10.1016/j.str.2017.12.006", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5WJ3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of green fluorescent protein Clover mutant S147C/Q204C" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PO4", "SEY" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5T3I", "evidence_id": "EV-PDB-5T3I-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "5T3I", "doi": "10.1038/srep37123", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5T3I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "cyan fluorescence protein soaked with selenourea for 5 min" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5OXA", "evidence_id": "EV-PDB-5OXA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.16 }, "provenance": { "deposit_id": "5OXA", "doi": "10.1021/acs.biochem.7b01088", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5OXA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the S205A mutant of the Cyan Fluorescent Protein Cerulean at pH 7.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5OX8", "evidence_id": "EV-PDB-5OX8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.29 }, "provenance": { "deposit_id": "5OX8", "doi": "10.1021/acs.biochem.7b01088", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5OX8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Enhanced Cyan Fluorescent Protein at pH 5.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "NA", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6OA8", "evidence_id": "EV-PDB-6OA8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.37 }, "provenance": { "deposit_id": "6OA8", "doi": "10.1107/S2059798321006525", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6OA8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Superfolder Green Fluorescent Protein with 4-cyano-L-phenylalanine at the chromophore (position 66)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (GFP); S65T, Y66(3-ClY); ih circular permutant (50-51) (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6OFL", "evidence_id": "EV-PDB-6OFL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "6OFL", "doi": "10.1021/jacs.9b07152", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6OFL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of green fluorescent protein (GFP); S65T, Y66(3-ClY); ih circular permutant (50-51)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (GFP); S65T, Y66(3-CH3Y); ih circular permutant (50-51) (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6OFM", "evidence_id": "EV-PDB-6OFM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.48 }, "provenance": { "deposit_id": "6OFM", "doi": "10.1021/jacs.9b07152", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6OFM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of green fluorescent protein (GFP); S65T, Y66(3-CH3Y); ih circular permutant (50-51)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (GFP); S65T, T203(3-OMeY); ih circular permutant (50-51) (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6OFN", "evidence_id": "EV-PDB-6OFN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.649 }, "provenance": { "deposit_id": "6OFN", "doi": "10.1021/jacs.9b07152", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6OFN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of green fluorescent protein (GFP); S65T, T203(3-OMeY); ih circular permutant (50-51)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (GFP); s10 circular permutant (194-195) (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6OFO", "evidence_id": "EV-PDB-6OFO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.603 }, "provenance": { "deposit_id": "6OFO", "doi": "10.1021/jacs.9b07152", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6OFO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of split green fluorescent protein (GFP); s10 circular permutant (194-195)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Crystal structure of Green Fluorescent Protein (GFP); S65T, H148D with globally incorporated 3-F1Y; circular permutant (50-51) (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6OG8", "evidence_id": "EV-PDB-6OG8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.599 }, "provenance": { "deposit_id": "6OG8", "doi": "10.1021/acs.jpcb.0c07730", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6OG8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Green Fluorescent Protein (GFP); S65T, H148D with globally incorporated 3-F1Y; circular permutant (50-51)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Crystal structure of Green Fluorescent Protein (GFP); S65T, Y66(3,5-F2Y), H148D; circular permutant (50-51) (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6OG9", "evidence_id": "EV-PDB-6OG9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.798 }, "provenance": { "deposit_id": "6OG9", "doi": "10.1021/acs.jpcb.0c07730", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6OG9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Green Fluorescent Protein (GFP); S65T, Y66(3,5-F2Y), H148D; circular permutant (50-51)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Crystal structure of Green Fluorescent Protein (GFP); S65T, Y66(3-Br1Y), H148D; circular permutant (50-51) (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6OGA", "evidence_id": "EV-PDB-6OGA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "6OGA", "doi": "10.1021/acs.jpcb.0c07730", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6OGA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Green Fluorescent Protein (GFP); S65T, Y66(3-Br1Y), H148D; circular permutant (50-51)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Crystal structure of Green Fluorescent Protein (GFP); S65T, Y66(3-I1Y), H148D; circular permutant (50-51) (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6OGB", "evidence_id": "EV-PDB-6OGB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "6OGB", "doi": "10.1021/acs.jpcb.0c07730", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6OGB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Green Fluorescent Protein (GFP); S65T, Y66(3-I1Y), H148D; circular permutant (50-51)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Crystal structure of Green Fluorescent Protein (GFP); S65T, Y66(2,3-F2Y), H148D; circular permutant (50-51) (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6OGC", "evidence_id": "EV-PDB-6OGC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.178 }, "provenance": { "deposit_id": "6OGC", "doi": "10.1021/acs.jpcb.0c07730", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6OGC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Green Fluorescent Protein (GFP); S65T, Y66(2,3-F2Y), H148D; circular permutant (50-51)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.1, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6PFR", "evidence_id": "EV-PDB-6PFR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.51 }, "provenance": { "deposit_id": "6PFR", "doi": "10.1021/jacs.9b08356", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6PFR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "rsEGFP2 with a chlorinated chromophore in the fluorescent on-state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.1, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6PFS", "evidence_id": "EV-PDB-6PFS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.759 }, "provenance": { "deposit_id": "6PFS", "doi": "10.1021/jacs.9b08356", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6PFS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "rsEGFP2 with a chlorinated chromophore in the fluorescent on-state in a contracted unit cell" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QQ8", "evidence_id": "EV-PDB-6QQ8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.46 }, "provenance": { "deposit_id": "6QQ8", "doi": "10.1107/S205225251900616X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QQ8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Cryogenic temperature structure of the fluorescent protein Cerulean recorded after an accumulated dose of 290 kGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CO2" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QQ9", "evidence_id": "EV-PDB-6QQ9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.82 }, "provenance": { "deposit_id": "6QQ9", "doi": "10.1107/S205225251900616X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QQ9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Cryogenic temperature structure of the fluorescent protein Cerulean recorded after an accumulated dose of 5.8 MGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QQA", "evidence_id": "EV-PDB-6QQA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.66 }, "provenance": { "deposit_id": "6QQA", "doi": "10.1107/S205225251900616X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QQA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature structure of the fluorescent protein Cerulean recorded after an accumulated dose of 21 kGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QQB", "evidence_id": "EV-PDB-6QQB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.45 }, "provenance": { "deposit_id": "6QQB", "doi": "10.1107/S205225251900616X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QQB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature structure of the fluorescent protein Cerulean recorded after an accumulated dose of 147 kGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "CU", "MPD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains B,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QUH", "evidence_id": "EV-PDB-6QUH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "6QUH", "doi": "10.1107/S2059798320013741", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QUH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GHK tagged GFP variant crystal form II at 1.34A wavelength" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CU", "GOL", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains B,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QUI", "evidence_id": "EV-PDB-6QUI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.94 }, "provenance": { "deposit_id": "6QUI", "doi": "10.1107/S2059798320013741", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QUI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GHK tagged GFP variant at 17Kev" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CU", "GOL", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains B,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QUJ", "evidence_id": "EV-PDB-6QUJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.68 }, "provenance": { "deposit_id": "6QUJ", "doi": "10.1107/S2059798320013741", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QUJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GHK tagged GFP variant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6T39", "evidence_id": "EV-PDB-6T39-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "6T39", "doi": "10.1038/s41467-020-14537-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6T39" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of rsEGFP2 in its off-state determined by SFX" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6T3A", "evidence_id": "EV-PDB-6T3A-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "6T3A", "doi": "10.1038/s41467-020-14537-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6T3A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Difference-refined structure of rsEGFP2 10 ns following 400-nm laser irradiation of the off-state determined by SFX" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PTD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,POU domain, class 5, transcription factor 1 (chains K)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6T90", "evidence_id": "EV-PDB-6T90-8", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.05 }, "provenance": { "deposit_id": "6T90", "doi": "10.1126/science.abb0074", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6T90" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "OCT4-SOX2-bound nucleosome - SHL-6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "C176 mGFP (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6UHK", "evidence_id": "EV-PDB-6UHK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "6UHK", "doi": "10.1016/j.chempr.2020.03.002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6UHK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of C176 mGFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.1, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6UN4", "evidence_id": "EV-PDB-6UN4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.499 }, "provenance": { "deposit_id": "6UN4", "doi": "10.1016/j.jphotochem.2020.112738", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6UN4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of rsEGFP2, Y67(3-ClY), Y107(3-ClY)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein,Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6UN5", "evidence_id": "EV-PDB-6UN5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.36 }, "provenance": { "deposit_id": "6UN5", "doi": "10.1021/acs.jpcb.0c07730", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6UN5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of green fluorescent protein (GFP); S65T, Y66(2,3,5-F3Y); ih circular permutant (50-51)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6UN7", "evidence_id": "EV-PDB-6UN7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "6UN7", "doi": "10.1021/acs.jpcb.0c07730", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6UN7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of green fluorescent protein (GFP); S65T, Y66(3-OMeY); ih circular permutant (50-51)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "6OU", "9Z9", "NAG", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Sodium channel protein type 5 subunit alpha,Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6UZ3", "evidence_id": "EV-PDB-6UZ3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.5 }, "provenance": { "deposit_id": "6UZ3", "doi": "10.1016/j.cell.2019.11.041", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6UZ3" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cardiac sodium channel" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein, CALHM1,CALMH2 chimera (chains A,B,C,D,E,F,G,H,I,J,K)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6VAL", "evidence_id": "EV-PDB-6VAL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.87 }, "provenance": { "deposit_id": "6VAL", "doi": "10.1038/s41594-019-0369-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6VAL" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of an undecameric chicken CALHM1 and human CALHM2 chimera" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,CALHM1 chimera (chains A,B,C,D,E,F,G,H)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6VAM", "evidence_id": "EV-PDB-6VAM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.63 }, "provenance": { "deposit_id": "6VAM", "doi": "10.1038/s41594-019-0369-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6VAM" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of octameric chicken CALHM1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein GFP (chains A,B,C,D,E,F,G,H)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6VIO", "evidence_id": "EV-PDB-6VIO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.6 }, "provenance": { "deposit_id": "6VIO", "doi": "10.1021/acs.jpcb.1c00649", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6VIO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of eYFP His148Ser" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ADP", "AGS", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein (chains S)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6WRF", "evidence_id": "EV-PDB-6WRF-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.14 }, "provenance": { "deposit_id": "6WRF", "doi": "10.7554/eLife.61496", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6WRF" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "ClpX-ClpP complex bound to GFP-ssrA, recognition complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AGS", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein, + ssrA tag (chains S)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6WSG", "evidence_id": "EV-PDB-6WSG-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.16 }, "provenance": { "deposit_id": "6WSG", "doi": "10.7554/eLife.61496", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6WSG" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "ClpX-ClpP complex bound to ssrA-tagged GFP, intermediate complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Vitamin K epoxide reductase-like protein, termini restrained by green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6WV9", "evidence_id": "EV-PDB-6WV9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.35 }, "provenance": { "deposit_id": "6WV9", "doi": "10.1126/science.abc5667", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6WV9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Takifugu rubripes VKOR-like with vitamin K1 in noncatalytic state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Vitamin K epoxide reductase-like protein, termini restrained by green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6WVA", "evidence_id": "EV-PDB-6WVA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.35 }, "provenance": { "deposit_id": "6WVA", "doi": "10.1126/science.abc5667", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6WVA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Takifugu rubripes VKOR-like with vitamin K1 epoxide at non-catalytic state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "OLC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein, Protein jagunal homolog 1 chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6WVD", "evidence_id": "EV-PDB-6WVD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.25 }, "provenance": { "deposit_id": "6WVD", "doi": "10.1126/sciadv.abe3717", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6WVD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Human JAGN1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "6OU", "9Z9", "K4D", "NAG", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Sodium channel protein type 5 subunit alpha,Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6UZ0", "evidence_id": "EV-PDB-6UZ0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.24 }, "provenance": { "deposit_id": "6UZ0", "doi": "10.1016/j.cell.2019.11.041", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6UZ0" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cardiac sodium channel with flecainide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6UN6", "evidence_id": "EV-PDB-6UN6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "6UN6", "doi": "10.1021/acs.jpcb.0c07730", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6UN6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of green fluorescent protein (GFP); S65T, Y66(3-NO2Y); ih circular permutant (50-51)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "C148 mGFP-scDNA-2 (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6UHR", "evidence_id": "EV-PDB-6UHR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "6UHR", "doi": "10.1016/j.chempr.2020.03.002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6UHR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of C148 mGFP-scDNA-2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "UNL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "C148 mGFP-cDNA-3 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6UHQ", "evidence_id": "EV-PDB-6UHQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.85 }, "provenance": { "deposit_id": "6UHQ", "doi": "10.1016/j.chempr.2020.03.002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6UHQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of C148 mGFP-cDNA-3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "C148 mGFP-ncDNA-1 (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6UHP", "evidence_id": "EV-PDB-6UHP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.9 }, "provenance": { "deposit_id": "6UHP", "doi": "10.1016/j.chempr.2020.03.002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6UHP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of C148 mGFP-ncDNA-1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "UNL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "C148 mGFP-cDNA-2 (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6UHO", "evidence_id": "EV-PDB-6UHO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "6UHO", "doi": "10.1016/j.chempr.2020.03.002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6UHO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of C148 mGFP-cDNA-2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "UNL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "C148 mGFP-cDNA-1 (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6UHN", "evidence_id": "EV-PDB-6UHN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.92 }, "provenance": { "deposit_id": "6UHN", "doi": "10.1016/j.chempr.2020.03.002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6UHN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of C148 mGFP-cDNA-1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "C148 mGFP (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6UHM", "evidence_id": "EV-PDB-6UHM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "6UHM", "doi": "10.1016/j.chempr.2020.03.002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6UHM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of a Physical Mixture of C148 mGFP and scDNA-1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "UNL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "C148 mGFP-scDNA-1 (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6UHL", "evidence_id": "EV-PDB-6UHL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.91 }, "provenance": { "deposit_id": "6UHL", "doi": "10.1016/j.chempr.2020.03.002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6UHL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of C148 mGFP-scDNA-1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "C148 mGFP (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6UHJ", "evidence_id": "EV-PDB-6UHJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "6UHJ", "doi": "10.1016/j.chempr.2020.03.002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6UHJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray Structure of C148 mGFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "OXY", "SO4", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6SM0", "evidence_id": "EV-PDB-6SM0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.91 }, "provenance": { "deposit_id": "6SM0", "doi": "10.1039/d0sc06693a", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6SM0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Venus 66 p-Azido-L-Phenylalanin (azF) variant, dark grown" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.1, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6PFU", "evidence_id": "EV-PDB-6PFU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.619 }, "provenance": { "deposit_id": "6PFU", "doi": "10.1021/jacs.9b08356", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6PFU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "rsEGFP2 with a chlorinated chromophore in the non-fluorescent off-state in a contracted unit cell" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.1, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6PFT", "evidence_id": "EV-PDB-6PFT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "6PFT", "doi": "10.1021/jacs.9b08356", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6PFT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "rsEGFP2 with a chlorinated chromophore in the non-fluorescent off-state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green Fluorescent Protein (GFP); S65T; ih circular permutant (50-51) (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6OFK", "evidence_id": "EV-PDB-6OFK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.15 }, "provenance": { "deposit_id": "6OFK", "doi": "10.1021/jacs.9b07152", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6OFK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of green fluorescent protein (GFP); S65T; ih circular permutant (50-51)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein (chains G,H,I,J)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6MWQ", "evidence_id": "EV-PDB-6MWQ-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "6MWQ", "doi": "10.1016/j.str.2019.04.003", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6MWQ" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Single particle cryoEM structure of a DARPin-aldolase platform in complex with GFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "UQ1" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein,Disulfide bond formation protein B,Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6WVF", "evidence_id": "EV-PDB-6WVF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.9 }, "provenance": { "deposit_id": "6WVF", "doi": "10.1126/sciadv.abe3717", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6WVF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "E.coli DsbB C104S with ubiquinone" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NAG", "OLC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein, Leukocyte surface antigen CD53 chimera (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6WVG", "evidence_id": "EV-PDB-6WVG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.9 }, "provenance": { "deposit_id": "6WVG", "doi": "10.15252/embj.2020105246", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6WVG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "human CD53" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "TB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "eGFP (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6XZF", "evidence_id": "EV-PDB-6XZF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "6XZF", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6XZF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Nanobody in complex with eGFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PTD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,POU domain, class 5, transcription factor 1 (chains K)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6YOV", "evidence_id": "EV-PDB-6YOV-8", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.42 }, "provenance": { "deposit_id": "6YOV", "doi": "10.1126/science.abb0074", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6YOV" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "OCT4-SOX2-bound nucleosome - SHL+6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "HTH-type transcriptional repressor NemR,Green fluorescent protein,Green fluorescent protein,HTH-type transcriptional repressor NemR (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6ZUI", "evidence_id": "EV-PDB-6ZUI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.20008218184 }, "provenance": { "deposit_id": "6ZUI", "doi": "10.1038/s41467-021-27796-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6ZUI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the Cys-Ser mutant of the cpYFP-based biosensor for hypochlorous acid" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7A7K", "evidence_id": "EV-PDB-7A7K-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "7A7K", "doi": "10.1002/anie.202015201", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7A7K" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "rsEGFP in the green-on state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PG4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7A7L", "evidence_id": "EV-PDB-7A7L-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "7A7L", "doi": "10.1002/anie.202015201", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7A7L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "rsEGFP in the green-off state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7AMB", "evidence_id": "EV-PDB-7AMB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.63 }, "provenance": { "deposit_id": "7AMB", "doi": "10.1002/cphc.202200192", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7AMB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of rsFolder2 in its fluorescent on-state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7AMF", "evidence_id": "EV-PDB-7AMF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.63 }, "provenance": { "deposit_id": "7AMF", "doi": "10.1002/cphc.202200192", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7AMF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of rsFolder2 in its non-fluorescent off-state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 11.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7AMU", "evidence_id": "EV-PDB-7AMU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.64 }, "provenance": { "deposit_id": "7AMU", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7AMU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of rsEGFP2 T204A in its fluorescent on-state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Chimera of Green fluorescent protein and p53dim (chains A,C,E,F,H,J,M,O)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BWN", "evidence_id": "EV-PDB-7BWN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.396 }, "provenance": { "deposit_id": "7BWN", "doi": "10.1002/anie.202005490", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BWN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of a Designed Protein Heterocatenane" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K", "PT5" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,Potassium voltage-gated channel subfamily KQT member 4 (chains A,C,E,G)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BYL", "evidence_id": "EV-PDB-7BYL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "7BYL", "doi": "10.1016/j.molcel.2020.10.037", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BYL" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of human KCNQ4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FBX", "K", "PT5" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,Potassium voltage-gated channel subfamily KQT member 4 (chains A,C,E,G)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BYM", "evidence_id": "EV-PDB-7BYM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "7BYM", "doi": "10.1016/j.molcel.2020.10.037", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BYM" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of human KCNQ4 with retigabine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FCC", "K", "PT5" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,Potassium voltage-gated channel subfamily KQT member 4 (chains A,C,E,G)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BYN", "evidence_id": "EV-PDB-7BYN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.3 }, "provenance": { "deposit_id": "7BYN", "doi": "10.1016/j.molcel.2020.10.037", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BYN" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of human KCNQ4 with linopirdine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NAG", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Angiotensin-converting enzyme 2 (ACE2) ectodomain (chains I,J,K)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7EDJ", "evidence_id": "EV-PDB-7EDJ-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.3 }, "provenance": { "deposit_id": "7EDJ", "doi": "10.1038/s41594-021-00652-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of SARS-CoV-2 S-UK variant (B.1.1.7) in complex with Angiotensin-converting enzyme 2 (ACE2) ectodomain" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Two pore calcium channel protein 1,GFP (chains A,C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7FHO", "evidence_id": "EV-PDB-7FHO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "7FHO", "doi": "10.1073/pnas.2113946118", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7FHO" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of AtTPC1 D240A/D454A/E528A mutant with 50 mM Ca2+" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "6OU", "NAG", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Sodium channel protein type 5 subunit alpha, Enhanced Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7K18", "evidence_id": "EV-PDB-7K18-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.3 }, "provenance": { "deposit_id": "7K18", "doi": "10.1038/s41467-020-20078-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7K18" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cardiac Sodium channel with toxin bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Glutamate receptor ionotropic, kainate 5,Green fluorescent protein chimera (chains A,C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7KS0", "evidence_id": "EV-PDB-7KS0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 5.3 }, "provenance": { "deposit_id": "7KS0", "doi": "10.7554/eLife.66097", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7KS0" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "GluK2/K5 with 6-Cyano-7-nitroquinoxaline-2,3-dione (CNQX)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Glutamate receptor ionotropic, kainate 5,Green fluorescent protein chimera (chains A,C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7KS3", "evidence_id": "EV-PDB-7KS3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 5.8 }, "provenance": { "deposit_id": "7KS3", "doi": "10.7554/eLife.66097", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7KS3" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "GluK2/K5 with L-Glu" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NAG", "SY9" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Glycine receptor subunit beta, Green fluorescent protein chimera (chains E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7KUY", "evidence_id": "EV-PDB-7KUY-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.6 }, "provenance": { "deposit_id": "7KUY", "doi": "10.1016/j.neuron.2021.08.019", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7KUY" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cyro-EM structure of human Glycine Receptor alpha2-beta heteromer, strychnine bound state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NAG", "SY9" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Glycine receptor subunit beta,Green fluorescent protein (chains E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7L31", "evidence_id": "EV-PDB-7L31-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.8 }, "provenance": { "deposit_id": "7L31", "doi": "10.1016/j.neuron.2021.08.019", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7L31" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cyro-EM structure of human Glycine Receptor alpha2-beta heteromer, strychnine bound state, 3.8 Angstrom" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7O7C", "evidence_id": "EV-PDB-7O7C-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "7O7C", "doi": "10.1002/cphc.202200192", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7O7C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of rsEGFP2 mutant V151A in the non-fluorescent off-state determined by synchrotron radiation at 100K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7O7D", "evidence_id": "EV-PDB-7O7D-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "7O7D", "doi": "10.1002/cphc.202200192", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7O7D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of rsEGFP2 mutant V151A in the fluorescent on-state determined by synchrotron radiation at 100K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7O7E", "evidence_id": "EV-PDB-7O7E-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "7O7E", "doi": "10.1002/cphc.202200192", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7O7E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of rsEGFP2 mutant V151L in the fluorescent on-state determined by synchrotron radiation at 100K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7O7H", "evidence_id": "EV-PDB-7O7H-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "7O7H", "doi": "10.1002/cphc.202200192", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7O7H" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of rsEGFP2 mutant V151L in the non-fluorescent off-state determined by synchrotron radiation at 100K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": 4.0 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7O7U", "evidence_id": "EV-PDB-7O7U-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "7O7U", "doi": "10.1002/cphc.202200192", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7O7U" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of rsEGFP2 in the non-fluorescent off-state determined by serial femtosecond crystallography at room temperature" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": 4.0 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7O7V", "evidence_id": "EV-PDB-7O7V-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "7O7V", "doi": "10.1002/cphc.202200192", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7O7V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of rsEGFP2 mutant V151A in the fluorescent on-state determined by serial femtosecond crystallography at room temperature" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": 4.0 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7O7W", "evidence_id": "EV-PDB-7O7W-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "7O7W", "doi": "10.1002/cphc.202200192", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7O7W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of rsEGFP2 mutant V151L in the non-fluorescent off-state the determined by serial femtosecond crystallography at room temperature" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": 4.0 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7O7X", "evidence_id": "EV-PDB-7O7X-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "7O7X", "doi": "10.1002/cphc.202200192", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7O7X" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of rsEGFP2 mutant V151A in the non-fluorescent off-state determined by serial femtosecond crystallography at room temperature" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ARF", "EOH", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7PCA", "evidence_id": "EV-PDB-7PCA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.05 }, "provenance": { "deposit_id": "7PCA", "doi": "10.1089/ars.2021.0234", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7PCA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Functional and structural characterization of redox sensitive superfolder green fluorescent protein and variants" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EOH", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7PCZ", "evidence_id": "EV-PDB-7PCZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "7PCZ", "doi": "10.1089/ars.2021.0234", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7PCZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Functional and structural characterization of redox sensitive superfolder green fluorescent protein and variants" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "PEG", "PGE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7PD0", "evidence_id": "EV-PDB-7PD0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "7PD0", "doi": "10.1089/ars.2021.0234", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7PD0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Functional and structural characterization of redox sensitive superfolder green fluorescent protein and variants" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NAG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T-cell surface glycoprotein CD3 delta chain, green fluorescent protein (chains D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7PHR", "evidence_id": "EV-PDB-7PHR-4", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.08 }, "provenance": { "deposit_id": "7PHR", "doi": "10.1016/j.cell.2022.07.010", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7PHR" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of a fully assembled T-cell receptor engaging a tumor-associated peptide-MHC I" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "mVenus (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7PNN", "evidence_id": "EV-PDB-7PNN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.43 }, "provenance": { "deposit_id": "7PNN", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7PNN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "mVenus released from fusion protein." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7SAH", "evidence_id": "EV-PDB-7SAH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7SAH", "doi": "10.1002/pro.4383", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7SAH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of LaG16 Nanobody bound to eGFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "MES", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7SAI", "evidence_id": "EV-PDB-7SAI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.23 }, "provenance": { "deposit_id": "7SAI", "doi": "10.1002/pro.4383", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7SAI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Lag30 Nanobody bound to eGFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Citrus Sudden Death-associated Virus Capsid Protein,Green fluorescent protein,Citrus Sudden Death-associated Virus Capsid Protein (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7SQY", "evidence_id": "EV-PDB-7SQY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.4 }, "provenance": { "deposit_id": "7SQY", "doi": "10.1016/j.btre.2022.e00739", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7SQY" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "CSDaV GFP mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Potassium voltage-gated channel subfamily A member 3,Green fluorescent protein fusion (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7SSV", "evidence_id": "EV-PDB-7SSV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.39 }, "provenance": { "deposit_id": "7SSV", "doi": "10.1038/s41467-022-31285-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7SSV" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of human Kv1.3 with Fab-ShK fusion" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Potassium voltage-gated channel subfamily A member 3, Green fluorescent protein fusion (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7SSX", "evidence_id": "EV-PDB-7SSX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.89 }, "provenance": { "deposit_id": "7SSX", "doi": "10.1038/s41467-022-31285-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7SSX" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of human Kv1.3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Potassium voltage-gated channel subfamily A member 3,Green fluorescent protein fusion (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7SSY", "evidence_id": "EV-PDB-7SSY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.89 }, "provenance": { "deposit_id": "7SSY", "doi": "10.1038/s41467-022-31285-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7SSY" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of human Kv1.3 (alternate conformation)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Potassium voltage-gated channel subfamily A member 3,Green fluorescent protein fusion (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7SSZ", "evidence_id": "EV-PDB-7SSZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.25 }, "provenance": { "deposit_id": "7SSZ", "doi": "10.1038/s41467-022-31285-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7SSZ" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of human Kv1.3 with A0194009G09 nanobodies" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7KM4", "evidence_id": "EV-PDB-7KM4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.65 }, "provenance": { "deposit_id": "7KM4", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7KM4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Oxidized Version of Redox-Sensitive Superfolder Green Fluorescent Protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Two pore calcium channel protein 1,GFP (chains A,C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7FHN", "evidence_id": "EV-PDB-7FHN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.3 }, "provenance": { "deposit_id": "7FHN", "doi": "10.1073/pnas.2113946118", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7FHN" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of AtTPC1 D240A/D454A/E528A mutant with 1 mM Ca2+" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Two pore calcium channel protein 1,GFP (chains A,C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7FHL", "evidence_id": "EV-PDB-7FHL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "7FHL", "doi": "10.1073/pnas.2113946118", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7FHL" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of AtTPC1 with 50 mM Ca2+" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Two pore calcium channel protein 1,GFP (chains A,C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7FHK", "evidence_id": "EV-PDB-7FHK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.3 }, "provenance": { "deposit_id": "7FHK", "doi": "10.1073/pnas.2113946118", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7FHK" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of AtTPC1 with 1 mM Ca2+" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -180.15 }, "construct": { "description": "Green fluorescent protein (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7CD8", "evidence_id": "EV-PDB-7CD8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "7CD8", "doi": "10.1093/jb/mvaa147", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7CD8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GFP-40/GFPuv complex, Form II" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -180.15 }, "construct": { "description": "Green fluorescent protein (chains B,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7CD7", "evidence_id": "EV-PDB-7CD7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.704 }, "provenance": { "deposit_id": "7CD7", "doi": "10.1093/jb/mvaa147", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7CD7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GFP-40/GFPuv complex, Form I" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Transient receptor potential cation channel subfamily V member 4,Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7AA5", "evidence_id": "EV-PDB-7AA5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.18 }, "provenance": { "deposit_id": "7AA5", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7AA5" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Human TRPV4 structure in presence of 4a-PDD" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "FMT", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein,Green fluorescent protein,Calmodulin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6ZSN", "evidence_id": "EV-PDB-6ZSN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "6ZSN", "doi": "10.1038/s41587-021-01100-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6ZSN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of rsGCaMP double mutant Ile80His/Val116Ile in the OFF state (illuminated)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "EDO", "FMT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein,Green fluorescent protein,Calmodulin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6ZSM", "evidence_id": "EV-PDB-6ZSM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "6ZSM", "doi": "10.1038/s41587-021-01100-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6ZSM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of rsGCaMP double mutant Ile80His/Val116Ile in the ON state (non-illuminated)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Prestin, Enhanced Yellow Fluorescent Protein chimera (chains A,B)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7SUN", "evidence_id": "EV-PDB-7SUN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.6 }, "provenance": { "deposit_id": "7SUN", "doi": "10.1038/s41467-021-27915-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7SUN" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Atomic model of prestin from gerbil (Meriones unguiculatus)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -175.15 }, "construct": { "description": "Lime (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7YV5", "evidence_id": "EV-PDB-7YV5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.85 }, "provenance": { "deposit_id": "7YV5", "doi": "10.1021/acssensors.3c00484", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7YV5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "genetically encoded pH sensor Lime at pH6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8A6G", "evidence_id": "EV-PDB-8A6G-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.63 }, "provenance": { "deposit_id": "8A6G", "doi": "10.1021/jacs.3c02313", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8A6G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature rsEGFP2 with a chlorinated chromophore in the non-fluorescent OFF-state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8A6N", "evidence_id": "EV-PDB-8A6N-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.63 }, "provenance": { "deposit_id": "8A6N", "doi": "10.1021/jacs.3c02313", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8A6N" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature rsEGFP2 with a chlorinated chromophore 300 fs after Photoexcitation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8A6O", "evidence_id": "EV-PDB-8A6O-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.63 }, "provenance": { "deposit_id": "8A6O", "doi": "10.1021/jacs.3c02313", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8A6O" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature rsEGFP2 with a chlorinated chromophore 600 fs after Photoexcitation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8A6P", "evidence_id": "EV-PDB-8A6P-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.63 }, "provenance": { "deposit_id": "8A6P", "doi": "10.1021/jacs.3c02313", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8A6P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature rsEGFP2 with a chlorinated chromophore 900 fs after photoexcitation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8A6Q", "evidence_id": "EV-PDB-8A6Q-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.63 }, "provenance": { "deposit_id": "8A6Q", "doi": "10.1021/jacs.3c02313", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8A6Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature rsEGFP2 with a chlorinated chromophore 5 ps after photoexcitation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8A6S", "evidence_id": "EV-PDB-8A6S-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.63 }, "provenance": { "deposit_id": "8A6S", "doi": "10.1021/jacs.3c02313", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8A6S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature rsEGFP2 with a chlorinated chromophore 1 microsecond after Photoexcitation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8A7V", "evidence_id": "EV-PDB-8A7V-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.46 }, "provenance": { "deposit_id": "8A7V", "doi": "10.1021/jacs.3c02313", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8A7V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature rsEGFP2 in its OFF-state obtained with SFX" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.1, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8AHA", "evidence_id": "EV-PDB-8AHA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.38 }, "provenance": { "deposit_id": "8AHA", "doi": "10.1021/jacs.3c01500", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8AHA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "rsEGFP2 photoswitched to its off-state at 100K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.1, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8AHB", "evidence_id": "EV-PDB-8AHB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.79 }, "provenance": { "deposit_id": "8AHB", "doi": "10.1021/jacs.3c01500", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8AHB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "rsEGFP2 photoswitched to its off-state at room temperature and back-switched to its on-state at 100K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -223.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8AM4", "evidence_id": "EV-PDB-8AM4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.02 }, "provenance": { "deposit_id": "8AM4", "doi": "10.1021/jacs.3c02313", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8AM4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Cl-rsEGFP2 Long Wavelength Structure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "OEH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein,Haloalkane dehalogenase (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8B6S", "evidence_id": "EV-PDB-8B6S-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "8B6S", "doi": "10.1038/s41589-023-01350-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8B6S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the haloalkane dehalogenase HaloTag7 fusion to the green fluorescent protein GFP (ChemoG1) labeled with a chloroalkane tetramethylrhodamine fluorophore substrate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "OEH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein,Haloalkane dehalogenase (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8B6T", "evidence_id": "EV-PDB-8B6T-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "8B6T", "doi": "10.1038/s41589-023-01350-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8B6T" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the interface optimized haloalkane dehalogenase HaloTag7 fusion to the green fluorescent protein GFP (ChemoG5-TMR) labeled with a chloroalkane tetramethylrhodamine fluorophore substrate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Green fluorescent protein,Synaptosomal-associated protein 25 (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8BAN", "evidence_id": "EV-PDB-8BAN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.35 }, "provenance": { "deposit_id": "8BAN", "doi": "10.1073/pnas.2309211121", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8BAN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Secretagogin (mouse) in complex with its target peptide from SNAP-25" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "144", "ACT", "CA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Green fluorescent protein,Synaptosomal-associated protein 25 (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8BAV", "evidence_id": "EV-PDB-8BAV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "8BAV", "doi": "10.1073/pnas.2309211121", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8BAV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Secretagogin (human) in complex with its target peptide from SNAP-25" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "CAC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Green fluorescent protein,Syntaxin-4 (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8BBJ", "evidence_id": "EV-PDB-8BBJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.65 }, "provenance": { "deposit_id": "8BBJ", "doi": "10.1073/pnas.2309211121", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8BBJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Secretagogin (mouse) in complex with its target peptide from Syntaxin-4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "BrUSSLEE (chains A,B,C,D,E,F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8BVG", "evidence_id": "EV-PDB-8BVG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.38 }, "provenance": { "deposit_id": "8BVG", "doi": "10.3390/ijms24076403", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8BVG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Bright fluorescent protein BrUSLEE with subnanosecond fluorescence lifetime" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein,Tll0404 protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8C7I", "evidence_id": "EV-PDB-8C7I-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.12 }, "provenance": { "deposit_id": "8C7I", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8C7I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the PS2 assembly factor Psb32 from the cyanobactium Thermosyncechococcus vestitus (formerly elongatus)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Potassium voltage-gated channel subfamily A member 3,Green fluorescent protein fusion (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8DFL", "evidence_id": "EV-PDB-8DFL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.25 }, "provenance": { "deposit_id": "8DFL", "doi": "10.1038/s41467-022-31285-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8DFL" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of human Kv1.3 with A0194009G09 nanobodies (alternate conformation)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8DHR", "evidence_id": "EV-PDB-8DHR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "8DHR", "doi": "10.1016/j.jbc.2023.105517", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8DHR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "An ester mutant of SfGFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "D10", "DD9", "GLY", "HEX", "HP6", "NAG", "NBU", "OCT", "UND" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Glycine receptor subunit beta,Green fluorescent protein,Glycine receptor beta (chains E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8DN2", "evidence_id": "EV-PDB-8DN2-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.9 }, "provenance": { "deposit_id": "8DN2", "doi": "10.1038/s41467-023-42051-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8DN2" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of human Glycine Receptor alpha1-beta heteromer, glycine-bound state 2(expanded open)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "D10", "DD9", "HEX", "HP6", "NAG", "NBU", "UND" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Glycine receptor subunit beta,Green fluorescent protein,Glycine receptor beta (chains E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8DN3", "evidence_id": "EV-PDB-8DN3-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.55 }, "provenance": { "deposit_id": "8DN3", "doi": "10.1038/s41467-023-42051-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8DN3" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of human Glycine Receptor alpha1-beta heteromer, apo state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DD9", "HEX", "LNK", "NAG", "NBU", "OCT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Glycine receptor subunit beta,Green fluorescent protein,Glycine receptor beta (chains E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8DN4", "evidence_id": "EV-PDB-8DN4-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.1 }, "provenance": { "deposit_id": "8DN4", "doi": "10.1038/s41467-023-42051-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8DN4" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of human Glycine Receptor alpha-1 beta heteromer, glycine-bound state3(desensitized state)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "D10", "DD9", "GLY", "HEX", "HP6", "NAG", "NBU", "OCT", "UND" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Glycine receptor subunit beta,Green fluorescent protein,Glycine receptor beta (chains E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8DN5", "evidence_id": "EV-PDB-8DN5-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.63 }, "provenance": { "deposit_id": "8DN5", "doi": "10.1038/s41467-023-42051-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8DN5" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of human Glycine Receptor alpha1-beta heteromer, glycine-bound state1(open state)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CO2", "EDO", "MG", "PEG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Superfolder green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8DPD", "evidence_id": "EV-PDB-8DPD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.51 }, "provenance": { "deposit_id": "8DPD", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8DPD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "superfolder GFP Tyr74pCNPhe mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "PA0", "PEG", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8DTA", "evidence_id": "EV-PDB-8DTA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.81 }, "provenance": { "deposit_id": "8DTA", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8DTA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Metal sensitive GFP (mseGFP) complexed with phenylarsine oxide." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "6OU", "BMA", "NAG", "XHO", "Y01", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Sodium channel protein type 5 subunit alpha,Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8F6P", "evidence_id": "EV-PDB-8F6P-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "8F6P", "doi": "10.1038/s44161-023-00271-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8F6P" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Rat Cardiac Sodium Channel with Ranolazine Bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HAUS augmin like complex subunit 2 L homeolog, Green fluorescent protein chimera (chains E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FCK", "evidence_id": "EV-PDB-8FCK-5", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 6.88 }, "provenance": { "deposit_id": "8FCK", "doi": "10.1038/s41467-023-37519-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FCK" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of the vertebrate augmin complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "UNL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "ABC transporter, ATP-binding protein,Green fluorescent protein chimera (chains G,H)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FED", "evidence_id": "EV-PDB-8FED-7", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.76 }, "provenance": { "deposit_id": "8FED", "doi": "10.1038/s41586-023-06366-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FED" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of Mce1-LucB complex from Mycobacterium smegmatis (Map1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "UNL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "ABC transporter, ATP-binding protein,Green fluorescent protein chimera (chains G,H)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FEE", "evidence_id": "EV-PDB-8FEE-7", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.9 }, "provenance": { "deposit_id": "8FEE", "doi": "10.1038/s41586-023-06366-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FEE" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of Mce1 transporter from Mycobacterium smegmatis in the absence of LucB (Map2)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "UNL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "ABC transporter, ATP-binding protein,Green fluorescent protein chimera (chains G,H)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FEF", "evidence_id": "EV-PDB-8FEF-7", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.71 }, "provenance": { "deposit_id": "8FEF", "doi": "10.1038/s41586-023-06366-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FEF" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of Mce1 transporter from Mycobacterium smegmatis (Map0)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8G0I", "evidence_id": "EV-PDB-8G0I-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "8G0I", "doi": "10.1016/j.str.2025.01.019", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8G0I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High Affinity nanobodies against GFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Superfolder Green Fluorescent Protein (chains B)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8G4E", "evidence_id": "EV-PDB-8G4E-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.98 }, "provenance": { "deposit_id": "8G4E", "doi": "10.1073/pnas.2305494120", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8G4E" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Green Fluorescence Protein imaged on a cryo-EM imaging scaffold" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8IYY", "evidence_id": "EV-PDB-8IYY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "8IYY", "doi": "10.1007/s11427-025-2971-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8IYY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Single excitation and two emissions pH sensor protein(SITE-pHorin)_pH7.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8IYZ", "evidence_id": "EV-PDB-8IYZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.99 }, "provenance": { "deposit_id": "8IYZ", "doi": "10.1007/s11427-025-2971-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8IYZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "mTurquoise2 S65T" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8IZ0", "evidence_id": "EV-PDB-8IZ0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "8IZ0", "doi": "10.1007/s11427-025-2971-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8IZ0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "mTurquoise2 W66Y" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8IZ1", "evidence_id": "EV-PDB-8IZ1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.66 }, "provenance": { "deposit_id": "8IZ1", "doi": "10.1007/s11427-025-2971-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8IZ1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Single excitation and two emissions pH sensor protein (SITE-pHorin)_C203E_pH5.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "sfGFP (chains G)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8HCO", "evidence_id": "EV-PDB-8HCO-6", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.1 }, "provenance": { "deposit_id": "8HCO", "doi": "10.1038/s41594-023-01103-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8HCO" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Substrate-engaged TOM complex from yeast" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ADP", "AGS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein (chains S)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8ET3", "evidence_id": "EV-PDB-8ET3-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.7 }, "provenance": { "deposit_id": "8ET3", "doi": "10.1073/pnas.2219044120", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8ET3" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of a delivery complex containing the SspB adaptor, an ssrA-tagged substrate, and the AAA+ ClpXP protease" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8C1X", "evidence_id": "EV-PDB-8C1X-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.89 }, "provenance": { "deposit_id": "8C1X", "doi": "10.1039/d5sc06589e", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8C1X" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "sfGFP C148 F206 mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8BXP", "evidence_id": "EV-PDB-8BXP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.79 }, "provenance": { "deposit_id": "8BXP", "doi": "10.1039/d5sc06589e", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8BXP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SfGFP C148 F206 mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8A83", "evidence_id": "EV-PDB-8A83-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.81 }, "provenance": { "deposit_id": "8A83", "doi": "10.1021/jacs.3c02313", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8A83" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "rsEGFP2 with a chlorinated chromophore in the fluorescent ON-state in a crystal dehydrated after illumination" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8A6R", "evidence_id": "EV-PDB-8A6R-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.63 }, "provenance": { "deposit_id": "8A6R", "doi": "10.1021/jacs.3c02313", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8A6R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature rsEGFP2 with a chlorinated chromophore 100 ps after Photoexcitation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -175.15 }, "construct": { "description": "Lime (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7YV3", "evidence_id": "EV-PDB-7YV3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "7YV3", "doi": "10.1021/acssensors.3c00484", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7YV3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "genetically encoded pH sensor Lime at pH10" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Superfolder green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7YEU", "evidence_id": "EV-PDB-7YEU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "7YEU", "doi": "10.1021/jacs.2c09683", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7YEU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Superfolder green fluorescent protein with phosphine unnatural amino acid P3BF" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "IRX" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Nucleoside transporter 1,Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7YDQ", "evidence_id": "EV-PDB-7YDQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.04 }, "provenance": { "deposit_id": "7YDQ", "doi": "10.1038/s41467-023-37411-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7YDQ" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of PfNT1(Y190A)-GFP in complex with GSK4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.3, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein,Membrane protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7Y96", "evidence_id": "EV-PDB-7Y96-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.415 }, "provenance": { "deposit_id": "7Y96", "doi": "10.1093/pnasnexus/pgad021", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7Y96" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the carboxy-terminal domain of a coronavirus M protein fused with a split GFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "ion channel,GFP-TwinStrep (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7X5V", "evidence_id": "EV-PDB-7X5V-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.83 }, "provenance": { "deposit_id": "7X5V", "doi": "10.1038/s41467-022-30400-w", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7X5V" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "NaVEh Sodium channel, and NaVEh from the coccolithophore Emiliania huxleyi" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein,Potassium binding protein Kbp,Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7VCM", "evidence_id": "EV-PDB-7VCM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "7VCM", "doi": "10.1371/journal.pbio.3001772", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7VCM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "crystal structure of GINKO1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -80.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JL2", "evidence_id": "EV-PDB-8JL2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.76 }, "provenance": { "deposit_id": "8JL2", "doi": "10.1021/acssensors.5c01748", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JL2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the Green fluorescent protein SE_A277 variant at pH 9.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "JW0" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Soluble cytochrome b562,Mas-related G-protein coupled receptor member X4,Green fluorescent protein (chains E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8K4S", "evidence_id": "EV-PDB-8K4S-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.9 }, "provenance": { "deposit_id": "8K4S", "doi": "10.1016/j.cell.2024.10.001", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8K4S" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "CryoEM structure of Gq coupled MRGPRX4 with agonist DCA-3P" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PTD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,POU domain, class 5, transcription factor 1 (chains K)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8OTS", "evidence_id": "EV-PDB-8OTS-7", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.3 }, "provenance": { "deposit_id": "8OTS", "doi": "10.1038/s41586-023-06282-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8OTS" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "OCT4 and MYC-MAX co-bound to a nucleosome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CIT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Putative periplasmic binding transport protein,Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8OVN", "evidence_id": "EV-PDB-8OVN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "8OVN", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8OVN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the SF-iGluSnFR-S72A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein (chains B)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8RL9", "evidence_id": "EV-PDB-8RL9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.22 }, "provenance": { "deposit_id": "8RL9", "doi": "10.1038/s41589-025-01972-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8RL9" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "RECQL5:sfGFP hetero dimer assembled by Di-Gluebody" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA", "NH4", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SFS", "evidence_id": "EV-PDB-8SFS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.37 }, "provenance": { "deposit_id": "8SFS", "doi": "10.1016/j.str.2025.01.019", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SFS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High Affinity nanobodies against GFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "NA", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SFV", "evidence_id": "EV-PDB-8SFV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.83 }, "provenance": { "deposit_id": "8SFV", "doi": "10.1016/j.str.2025.01.019", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SFV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High affinity nanobodies to GFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "MLT", "NA", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SFX", "evidence_id": "EV-PDB-8SFX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "8SFX", "doi": "10.1016/j.str.2025.01.019", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SFX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High Affinity nanobodies against GFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains D,F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SFZ", "evidence_id": "EV-PDB-8SFZ-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "8SFZ", "doi": "10.1016/j.str.2025.01.019", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SFZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High Affinity nanobodies against GFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SFZ", "evidence_id": "EV-PDB-8SFZ-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "8SFZ", "doi": "10.1016/j.str.2025.01.019", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SFZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High Affinity nanobodies against GFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "C-C chemokine receptor type 8, Green fluorescent protein fusion (chains C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8TLM", "evidence_id": "EV-PDB-8TLM-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.9 }, "provenance": { "deposit_id": "8TLM", "doi": "10.1038/s41467-023-43601-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8TLM" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of a class A GPCR/Fab complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CLR" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "C-X-C chemokine receptor type 4 (chains R)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8U4N", "evidence_id": "EV-PDB-8U4N-4", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.72 }, "provenance": { "deposit_id": "8U4N", "doi": "10.1038/s41594-024-01397-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8U4N" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of Apo CXCR4/Gi complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CLR", "VH6" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "C-X-C chemokine receptor type 4 (chains R)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8U4P", "evidence_id": "EV-PDB-8U4P-4", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.15 }, "provenance": { "deposit_id": "8U4P", "doi": "10.1038/s41594-024-01397-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8U4P" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of AMD3100-bound CXCR4/Gi complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CLR" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "C-X-C chemokine receptor type 4 (chains R)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8U4O", "evidence_id": "EV-PDB-8U4O-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.29 }, "provenance": { "deposit_id": "8U4O", "doi": "10.1038/s41594-024-01397-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8U4O" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of CXCL12-bound CXCR4/Gi complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACO", "NAG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Enhanced green fluorescent protein,Heparan-alpha-glucosaminide N-acetyltransferase,Isoform 2 of Heparan-alpha-glucosaminide N-acetyltransferase (chains A,B)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8TU9", "evidence_id": "EV-PDB-8TU9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.26 }, "provenance": { "deposit_id": "8TU9", "doi": "10.7554/eLife.93510", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8TU9" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of HGSNAT-acetyl-CoA complex at pH 7.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Venus-tagged CaMKII beta holoenzyme mutant (chains A,B,C,D,F,G,H,I,J,K,L,N)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8T6Q", "evidence_id": "EV-PDB-8T6Q-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.5 }, "provenance": { "deposit_id": "8T6Q", "doi": "10.1038/s42003-024-06423-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8T6Q" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of dodecameric CaMKII beta holoenzyme T287A T306A T307A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "9Z9", "LBN", "NAG", "Y01", "YIJ", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-3)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Sodium channel protein type 5 subunit alpha,Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8T6L", "evidence_id": "EV-PDB-8T6L-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.3 }, "provenance": { "deposit_id": "8T6L", "doi": "10.1038/s41467-024-45958-w", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8T6L" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of rat cardiac sodium channel NaV1.5 with batrachotoxin analog BTX-B" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Venus-tagged CaMKII Beta Holoenzyme mutant (chains A,B,C,D,E,F,G,H,I,J,K,L,M,N)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8T6K", "evidence_id": "EV-PDB-8T6K-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "8T6K", "doi": "10.1038/s42003-024-06423-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8T6K" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of tetradecameric CaMKII beta holoenzyme T287A T306A T307A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Venus-tagged CaMKII Alpha Association Domain (chains A,B,C,D,E,F,G,H,I,J,K,L)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8T18", "evidence_id": "EV-PDB-8T18-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "8T18", "doi": "10.1038/s42003-024-06423-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8T18" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of dodecameric hub domain of CaMKII beta" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Venus-tagged CaMKII Beta Association Domain (chains A,B,C,D,E,F,G,H,I,J,K,L,M,N)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8T17", "evidence_id": "EV-PDB-8T17-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "8T17", "doi": "10.1038/s42003-024-06423-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8T17" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of tetradecameric hub domain of CaMKII beta" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Venus-tagged CaMKII Alpha Association Domain (chains A,B,C,D,E,F,G,H,I,J,K,L)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8T15", "evidence_id": "EV-PDB-8T15-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "8T15", "doi": "10.1038/s42003-024-06423-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8T15" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of dodecameric hub domain of CaMKII alpha" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Venus-tagged CaMKII Alpha Association Domain (chains A,B,C,D,E,F,G,H,I,J,K,L,M,N)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SYG", "evidence_id": "EV-PDB-8SYG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "8SYG", "doi": "10.1038/s42003-024-06423-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SYG" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of tetradecameric hub domain of CaMKII alpha" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1PE", "CL", "GOL", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "HtaACR2 integral fusion within enhanced green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SMU", "evidence_id": "EV-PDB-8SMU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.45 }, "provenance": { "deposit_id": "8SMU", "doi": "10.1016/j.jinorgbio.2023.112368", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SMU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Integral fusion of the HtaA CR2 domain from Corynebacterium diphtheriae within EGFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SLC", "evidence_id": "EV-PDB-8SLC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.97 }, "provenance": { "deposit_id": "8SLC", "doi": "10.1016/j.str.2025.01.019", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SLC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High Affinity nanobodies against GFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SG3", "evidence_id": "EV-PDB-8SG3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.11 }, "provenance": { "deposit_id": "8SG3", "doi": "10.1016/j.str.2025.01.019", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SG3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High Affinity nanobodies against GFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein (chains B)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8RLE", "evidence_id": "EV-PDB-8RLE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.75 }, "provenance": { "deposit_id": "8RLE", "doi": "10.1038/s41589-025-01972-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8RLE" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "SPNS2:sfGFP hetero dimer assembled by Di-Gluebody - sfGFP local refinement" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "LMT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein (chains B)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8RLC", "evidence_id": "EV-PDB-8RLC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.9 }, "provenance": { "deposit_id": "8RLC", "doi": "10.1038/s41589-025-01972-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8RLC" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "SPNS2:sfGFP hetero dimer assembled by Di-Gluebody" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein (chains B)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8RLB", "evidence_id": "EV-PDB-8RLB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.99 }, "provenance": { "deposit_id": "8RLB", "doi": "10.1038/s41589-025-01972-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8RLB" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "RECQL5:sfGFP hetero dimer assembled by Di-Gluebody - sfGFP local refinement" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8QWJ", "evidence_id": "EV-PDB-8QWJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8QWJ", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8QWJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of GFP variant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8OVY", "evidence_id": "EV-PDB-8OVY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.537 }, "provenance": { "deposit_id": "8OVY", "doi": "10.1038/s41586-023-06897-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8OVY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of analogue of superfolded GFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "ASP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Putative periplasmic binding transport protein,Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8OVP", "evidence_id": "EV-PDB-8OVP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "8OVP", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8OVP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the iAspSnFR in complex with L-aspartate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ASP" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Putative periplasmic binding transport protein,Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8OVO", "evidence_id": "EV-PDB-8OVO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "8OVO", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8OVO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the SF-iGluSnFR-S72A in complex with L-aspartate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "JW0" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Soluble cytochrome b562,Mas-related G-protein coupled receptor member X4,Green fluorescent protein (chains E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8KEX", "evidence_id": "EV-PDB-8KEX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "8KEX", "doi": "10.1016/j.cell.2024.10.001", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8KEX" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "CryoEM structure of Gq coupled MRGPRX4 with agonist DCA-3P, local" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -80.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JLU", "evidence_id": "EV-PDB-8JLU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.09 }, "provenance": { "deposit_id": "8JLU", "doi": "10.1021/acssensors.5c01748", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JLU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the Green fluorescent protein SET203EF223DA227 variant at pH 8.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -80.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JLT", "evidence_id": "EV-PDB-8JLT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.94 }, "provenance": { "deposit_id": "8JLT", "doi": "10.1021/acssensors.5c01748", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JLT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the Green fluorescent protein SET203EF223DA227 variant at pH 7.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -80.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JLS", "evidence_id": "EV-PDB-8JLS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "8JLS", "doi": "10.1021/acssensors.5c01748", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JLS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the Green fluorescent protein SET203EF223DA227 variant at pH 6.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -80.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JLM", "evidence_id": "EV-PDB-8JLM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "8JLM", "doi": "10.1021/acssensors.5c01748", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JLM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the Green fluorescent protein SET203EF223DA227 variant at pH 4.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -80.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JLL", "evidence_id": "EV-PDB-8JLL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.69 }, "provenance": { "deposit_id": "8JLL", "doi": "10.1021/acssensors.5c01748", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JLL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the Green fluorescent protein SEA227D variant at pH 9.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -80.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JL7", "evidence_id": "EV-PDB-8JL7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.76 }, "provenance": { "deposit_id": "8JL7", "doi": "10.1021/acssensors.5c01748", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JL7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the Green fluorescent protein SEA227D variant at pH 8.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -80.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JL6", "evidence_id": "EV-PDB-8JL6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.88 }, "provenance": { "deposit_id": "8JL6", "doi": "10.1021/acssensors.5c01748", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JL6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the Green fluorescent protein SEA227D variant at pH 5.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JL5", "evidence_id": "EV-PDB-8JL5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "8JL5", "doi": "10.1021/acssensors.5c01748", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JL5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the Green fluorescent protein SEA227D variant at pH 4.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -80.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JKI", "evidence_id": "EV-PDB-8JKI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "8JKI", "doi": "10.1021/acssensors.5c01748", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JKI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the Green fluorescent protein SE_A277 variant at pH 7.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -80.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JKG", "evidence_id": "EV-PDB-8JKG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "8JKG", "doi": "10.1021/acssensors.5c01748", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JKG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the Green fluorescent protein SE_A277 variant at pH 5.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -80.15 }, "construct": { "description": "Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JKC", "evidence_id": "EV-PDB-8JKC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "8JKC", "doi": "10.1021/acssensors.5c01748", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JKC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the Green fluorescent protein SE_A277 variant at pH 4.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Glutamate receptor ionotropic, NMDA 3A,Enhanced green fluorescent protein (chains D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JF7", "evidence_id": "EV-PDB-8JF7-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 7.73 }, "provenance": { "deposit_id": "8JF7", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JF7" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Triheteromeric NMDA receptor GluN1-GluN2A-GluN3A in complex with glycine, glutamate, a GluN1-specific Fab,and a GluN2A-specific Fab" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Glutamate receptor ionotropic, NMDA 2A,Enhanced green fluorescent protein (chains B)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JF7", "evidence_id": "EV-PDB-8JF7-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 7.73 }, "provenance": { "deposit_id": "8JF7", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JF7" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Triheteromeric NMDA receptor GluN1-GluN2A-GluN3A in complex with glycine, glutamate, a GluN1-specific Fab,and a GluN2A-specific Fab" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "ion channel (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8J7H", "evidence_id": "EV-PDB-8J7H-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.3 }, "provenance": { "deposit_id": "8J7H", "doi": "10.1038/s41467-024-48125-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8J7H" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "ion channel" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NAG", "ZN", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein (Fragment),SID1 transmembrane family member 2 (chains A,B)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8J6O", "evidence_id": "EV-PDB-8J6O-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.25 }, "provenance": { "deposit_id": "8J6O", "doi": "10.1038/s41594-024-01276-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8J6O" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "transport T2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "Y01" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Guard cell S-type anion channel SLAC1,Green fluorescent protein (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8J1E", "evidence_id": "EV-PDB-8J1E-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.84 }, "provenance": { "deposit_id": "8J1E", "doi": "10.1038/s41467-023-43193-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8J1E" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "AtSLAC1 in open state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "Y01" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Guard cell S-type anion channel SLAC1,Green fluorescent protein (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8J0J", "evidence_id": "EV-PDB-8J0J-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "8J0J", "doi": "10.1038/s41467-023-43193-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8J0J" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "AtSLAC1 8D mutant in closed state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8IZ3", "evidence_id": "EV-PDB-8IZ3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.18 }, "provenance": { "deposit_id": "8IZ3", "doi": "10.1007/s11427-025-2971-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8IZ3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Single excitation and two emissions pH sensor protein(SITE-pHorin)_pH5.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8IZ2", "evidence_id": "EV-PDB-8IZ2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.572 }, "provenance": { "deposit_id": "8IZ2", "doi": "10.1007/s11427-025-2971-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8IZ2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Single excitation and two emissions pH sensor protein (SITE-pHorin)_C203E_pH8.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CLR" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "C-X-C chemokine receptor type 4 (chains R)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8U4Q", "evidence_id": "EV-PDB-8U4Q-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.36 }, "provenance": { "deposit_id": "8U4Q", "doi": "10.1038/s41594-024-01397-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8U4Q" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of REGN7663 Fab-bound CXCR4/Gi complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CLR" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "C-X-C chemokine receptor type 4 (chains R)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8U4R", "evidence_id": "EV-PDB-8U4R-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "8U4R", "doi": "10.1038/s41594-024-01397-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8U4R" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of REGN7663-Fab bound CXCR4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CLR", "D21" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "C-X-C chemokine receptor type 4 (chains C,G,R)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8U4S", "evidence_id": "EV-PDB-8U4S-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.35 }, "provenance": { "deposit_id": "8U4S", "doi": "10.1038/s41594-024-01397-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8U4S" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of trimeric CXCR4 in complex with REGN7663 Fab" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "mCLIFY (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8UQQ", "evidence_id": "EV-PDB-8UQQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.57 }, "provenance": { "deposit_id": "8UQQ", "doi": "10.1016/j.bpj.2025.05.012", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8UQQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of mCLIFY: a circularly permuted yellow fluorescent protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,Talin-1 (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8VDP", "evidence_id": "EV-PDB-8VDP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.4 }, "provenance": { "deposit_id": "8VDP", "doi": "10.1038/s41467-024-52581-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8VDP" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryogenic electron microscopy model of full-length talin without FABD" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,Talin-1 (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8VDQ", "evidence_id": "EV-PDB-8VDQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 5.5 }, "provenance": { "deposit_id": "8VDQ", "doi": "10.1038/s41467-024-52581-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8VDQ" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryogenic electron microscopy model of full-length talin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,Talin-1 (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8VDR", "evidence_id": "EV-PDB-8VDR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.7 }, "provenance": { "deposit_id": "8VDR", "doi": "10.1038/s41467-024-52581-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8VDR" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryogenic electron microscopy model of full-length talin without R12 and FABD" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "LBN", "Y01" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "CSC1-like protein 2,Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8WG3", "evidence_id": "EV-PDB-8WG3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.4 }, "provenance": { "deposit_id": "8WG3", "doi": "10.1038/s41594-024-01411-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8WG3" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "mouse TMEM63b in LMNG-CHS micelle" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "LBN", "Y01" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "CSC1-like protein 2,Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8WG4", "evidence_id": "EV-PDB-8WG4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.5 }, "provenance": { "deposit_id": "8WG4", "doi": "10.1038/s41594-024-01411-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8WG4" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "mouse TMEM63b in DDM-CHS micelle with YN9303-24 Fab" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Disks large-associated protein 5,Green fluorescent protein (chains C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8X9P", "evidence_id": "EV-PDB-8X9P-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.54 }, "provenance": { "deposit_id": "8X9P", "doi": "10.1038/s41467-024-53139-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8X9P" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "HURP (428-534)-alpha-tubulin-beta-tubulin complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Vesicular acetylcholine transporter,Green fluorescent protein,antibody (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8XTW", "evidence_id": "EV-PDB-8XTW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.3 }, "provenance": { "deposit_id": "8XTW", "doi": "10.1038/s41594-024-01462-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8XTW" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of human VAChT in complex with acetylcholine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Vesicular acetylcholine transporter,Green fluorescent protein,antibody (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8XTX", "evidence_id": "EV-PDB-8XTX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.4 }, "provenance": { "deposit_id": "8XTX", "doi": "10.1038/s41594-024-01462-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8XTX" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of human VAChT in an apo conformation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1LWL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Vesicular acetylcholine transporter,Green fluorescent protein,antibody (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8XTY", "evidence_id": "EV-PDB-8XTY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "8XTY", "doi": "10.1038/s41594-024-01462-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8XTY" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of human VAChT in complex with vesamicol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ADP", "BEF", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein (chains G)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8YA0", "evidence_id": "EV-PDB-8YA0-7", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.97 }, "provenance": { "deposit_id": "8YA0", "doi": "10.1016/j.cell.2025.01.037", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8YA0" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+7C)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ADP", "BEF", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein (chains G)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8YA2", "evidence_id": "EV-PDB-8YA2-6", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.84 }, "provenance": { "deposit_id": "8YA2", "doi": "10.1016/j.cell.2025.01.037", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8YA2" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+20C)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -258.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8ZUP", "evidence_id": "EV-PDB-8ZUP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "8ZUP", "doi": "10.1038/s41598-024-73696-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8ZUP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the F99S/M153T/V163A/T203V/E222Q variant of GFP at pH 8.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -258.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8ZUQ", "evidence_id": "EV-PDB-8ZUQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.48 }, "provenance": { "deposit_id": "8ZUQ", "doi": "10.1038/s41598-024-73696-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8ZUQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the F99S/M153T/V163A/T203I/E222Q variant of GFP at pH 8.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -258.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8ZUR", "evidence_id": "EV-PDB-8ZUR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "8ZUR", "doi": "10.1038/s41598-024-73696-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8ZUR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the F99S/M153T/V163A/T203V/E222Q variant of GFP at pH 5.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -258.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8ZUS", "evidence_id": "EV-PDB-8ZUS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "8ZUS", "doi": "10.1038/s41598-024-73696-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8ZUS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the F99S/M153T/V163A/T203V variant of GFP at pH 7.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -257.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8ZUT", "evidence_id": "EV-PDB-8ZUT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.48 }, "provenance": { "deposit_id": "8ZUT", "doi": "10.1038/s41598-024-73696-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8ZUT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the F99S/M153T/V163A variant of GFP at pH 8.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Parvalbumin, Green fluorescent protein chimera (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9BCF", "evidence_id": "EV-PDB-9BCF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "9BCF", "doi": "10.1002/pro.5226", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9BCF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Chimeric protein of crocodile allergen Cro p 1.0101 and GFP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "42H" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "mVenus,Maltose/maltodextrin-binding periplasmic protein,Protein spinster homolog 1,Designed ankyrin repeat protein (DARPin) (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9BOI", "evidence_id": "EV-PDB-9BOI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.22 }, "provenance": { "deposit_id": "9BOI", "doi": "10.1073/pnas.2409596121", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9BOI" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of human Spns1 in complex with LPC (18:1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9C74", "evidence_id": "EV-PDB-9C74-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.51 }, "provenance": { "deposit_id": "9C74", "doi": "10.1039/d4ra05058d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9C74" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "superfolder Green Fluorescent Protein with meta-nitro-tyrosine incorporated at position 66" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1AUV", "D10", "D12", "GLU", "GLY", "HEX", "HP6", "NAG", "Y01", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Glutamate receptor ionotropic, NMDA 1,Green fluorescent protein (chains A,C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9C7C", "evidence_id": "EV-PDB-9C7C-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "9C7C", "doi": "10.1126/sciadv.adx4647", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9C7C" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Diheteromeric GluN1/GluN2A (delM653) in nanodisc complexed with glycine, glutamate, and GNE-4123, open conformation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1AUV", "D10", "D12", "GLU", "GLY", "HEX", "HP6", "NAG", "Y01", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Glutamate receptor ionotropic, NMDA 2A,Green fluorescent protein chimera (chains B,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9C7C", "evidence_id": "EV-PDB-9C7C-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "9C7C", "doi": "10.1126/sciadv.adx4647", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9C7C" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Diheteromeric GluN1/GluN2A (delM653) in nanodisc complexed with glycine, glutamate, and GNE-4123, open conformation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1AUV", "D12", "Y01" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Glutamate receptor ionotropic, NMDA 1,Green fluorescent protein chimera (chains A,C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9C7E", "evidence_id": "EV-PDB-9C7E-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.22 }, "provenance": { "deposit_id": "9C7E", "doi": "10.1126/sciadv.adx4647", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9C7E" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Diheteromeric GluN1/GluN2A (delM653) in nanodisc complex with glycine, glutamate, and GNE-4123, open conformation, C2 symmetry" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1AUV", "D12", "Y01" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Glutamate receptor ionotropic, NMDA 2A,Green fluorescent protein chimera (chains B,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9C7E", "evidence_id": "EV-PDB-9C7E-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.22 }, "provenance": { "deposit_id": "9C7E", "doi": "10.1126/sciadv.adx4647", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9C7E" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Diheteromeric GluN1/GluN2A (delM653) in nanodisc complex with glycine, glutamate, and GNE-4123, open conformation, C2 symmetry" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Glutamate receptor ionotropic, NMDA 1, Green fluorescent protein chimera (chains A,C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9C7P", "evidence_id": "EV-PDB-9C7P-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.61 }, "provenance": { "deposit_id": "9C7P", "doi": "10.1126/sciadv.adx4647", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9C7P" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Diheteromeric GluN1/GluN2A (delM653) in digitonin complexed with glycine, glutamate, and GNE-4123" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Glutamate receptor ionotropic, NMDA 2A, Green fluorescent protein chimera (chains B,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9C7P", "evidence_id": "EV-PDB-9C7P-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.61 }, "provenance": { "deposit_id": "9C7P", "doi": "10.1126/sciadv.adx4647", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9C7P" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Diheteromeric GluN1/GluN2A (delM653) in digitonin complexed with glycine, glutamate, and GNE-4123" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Glutamate receptor ionotropic, NMDA 1, Green fluorescent protein chimera (chains A,C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9C7Q", "evidence_id": "EV-PDB-9C7Q-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.05 }, "provenance": { "deposit_id": "9C7Q", "doi": "10.1126/sciadv.adx4647", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9C7Q" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Diheteromeric NMDA receptor GluN1/GluN2A, in complex with glycine and glutamate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Glutamate receptor ionotropic, NMDA 2A, Green fluorescent protein chimera (chains B,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9C7Q", "evidence_id": "EV-PDB-9C7Q-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.05 }, "provenance": { "deposit_id": "9C7Q", "doi": "10.1126/sciadv.adx4647", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9C7Q" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Diheteromeric NMDA receptor GluN1/GluN2A, in complex with glycine and glutamate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NAG", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Glutamate receptor ionotropic, NMDA 1, Green fluorescent protein chimera (chains A,C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9C7R", "evidence_id": "EV-PDB-9C7R-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.99 }, "provenance": { "deposit_id": "9C7R", "doi": "10.1126/sciadv.adx4647", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9C7R" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Diheteromeric GluN1/GluN2A (M817V) in digitonin complexed with glycine, glutamate, and GNE-4123" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NAG", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Glutamate receptor ionotropic, NMDA 2A, Green fluorescent protein chimera (chains B,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9C7R", "evidence_id": "EV-PDB-9C7R-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.99 }, "provenance": { "deposit_id": "9C7R", "doi": "10.1126/sciadv.adx4647", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9C7R" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Diheteromeric GluN1/GluN2A (M817V) in digitonin complexed with glycine, glutamate, and GNE-4123" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Potassium voltage-gated channel subfamily A member 3,Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9CLA", "evidence_id": "EV-PDB-9CLA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.97 }, "provenance": { "deposit_id": "9CLA", "doi": "10.1038/s41467-026-74630-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9CLA" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Human Kv1.3 mutant-H451V" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Potassium voltage-gated channel subfamily A member 3/mVenus fusion protein,Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9CLV", "evidence_id": "EV-PDB-9CLV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.18 }, "provenance": { "deposit_id": "9CLV", "doi": "10.1038/s41467-026-74630-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9CLV" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Human Kv1.3 mutant-P424G" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Potassium voltage-gated channel subfamily A member 3/mVenus fusion protein,Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9CON", "evidence_id": "EV-PDB-9CON-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.06 }, "provenance": { "deposit_id": "9CON", "doi": "10.1038/s41467-026-74630-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9CON" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Human Kv1.3-H451V with A0194009G09 nanobodies conformation 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Potassium voltage-gated channel subfamily A member 3/mVenus fusion protein,Green fluorescent protein (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9CTY", "evidence_id": "EV-PDB-9CTY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.03 }, "provenance": { "deposit_id": "9CTY", "doi": "10.1038/s41467-026-74630-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9CTY" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Human Kv1.3-H451V with A0194009G09 nanobodies conformation 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NAG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Hemagglutinin HA2 chain, Green fluorescent protein fusion (chains D,E,F)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9D0Y", "evidence_id": "EV-PDB-9D0Y-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "9D0Y", "doi": "10.1038/s41467-025-66375-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9D0Y" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Map of endoH-treated hemagglutinin A/Sing/INFIMH/16" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BR", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9F22", "evidence_id": "EV-PDB-9F22-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "9F22", "doi": "10.1038/s42003-025-08352-w", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9F22" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DARPin eGFP complex DP1 (3G190.24)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1H87", "EDO", "NA", "PXN", "TRS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9F23", "evidence_id": "EV-PDB-9F23-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.59 }, "provenance": { "deposit_id": "9F23", "doi": "10.1038/s42003-025-08352-w", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9F23" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DARPin eGFP complex DP2 (2G156)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9F24", "evidence_id": "EV-PDB-9F24-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.06 }, "provenance": { "deposit_id": "9F24", "doi": "10.1038/s42003-025-08352-w", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9F24" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DARPin eGFP complex DP4 (2G71)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1H9N" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,D(3) dopamine receptor (chains R)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9F33", "evidence_id": "EV-PDB-9F33-5", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.05 }, "provenance": { "deposit_id": "9F33", "doi": "10.1038/s41467-024-51993-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9F33" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of Dopamine 3 Receptor:Go complex bound to bitopic FOB02-04A - Conformation A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "nowGFP crystallized in Space Group C2 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9FEN", "evidence_id": "EV-PDB-9FEN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "9FEN", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9FEN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "LSSmOrange (P1) - Directionality of Optical Properties of Fluorescent Proteins" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "NA", "PEG", "PGE", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "wasCFP crystallized in SG P212121 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9FEQ", "evidence_id": "EV-PDB-9FEQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "9FEQ", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9FEQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "LSSmOrange (P1) - Directionality of Optical Properties of Fluorescent Proteins" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "nowGFP (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9FGI", "evidence_id": "EV-PDB-9FGI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.77 }, "provenance": { "deposit_id": "9FGI", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9FGI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "LSSmOrange (P1) - Directionality of Optical Properties of Fluorescent Proteins" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BUA", "EPE", "NAG", "ZN", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-6)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(1-6)-[alpha-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-3)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(1-6)-[alpha-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: beta-D-mannopyranose-(1-3)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,Gamma-aminobutyric acid receptor subunit alpha-5 (chains A,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9HAA", "evidence_id": "EV-PDB-9HAA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.14 }, "provenance": { "deposit_id": "9HAA", "doi": "10.1038/s41467-026-74279-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9HAA" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "a5b3 GABAA Receptor resting state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BUA", "EPE", "NAG", "ZN", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-6)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(1-6)-[alpha-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-3)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(1-6)-[alpha-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: beta-D-mannopyranose-(1-3)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Gamma-aminobutyric acid receptor subunit beta-3,Green fluorescent protein (chains B,C,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9HAA", "evidence_id": "EV-PDB-9HAA-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.14 }, "provenance": { "deposit_id": "9HAA", "doi": "10.1038/s41467-026-74279-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9HAA" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "a5b3 GABAA Receptor resting state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ABU", "EPE", "NAG", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-6)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(1-6)-[alpha-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-3)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(1-6)-[alpha-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: beta-D-mannopyranose-(1-3)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,Gamma-aminobutyric acid receptor subunit alpha-5 (chains A,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9HUM", "evidence_id": "EV-PDB-9HUM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.35 }, "provenance": { "deposit_id": "9HUM", "doi": "10.1038/s41467-026-74279-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9HUM" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "a5b3 GABAAR bound to GABA and Mb25 in a desensitized state in saposin nanodiscs after short GABA treatment" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ABU", "EPE", "NAG", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-6)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(1-6)-[alpha-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-3)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(1-6)-[alpha-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: beta-D-mannopyranose-(1-3)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Gamma-aminobutyric acid receptor subunit beta-3,Green fluorescent protein (chains B,C,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9HUM", "evidence_id": "EV-PDB-9HUM-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.35 }, "provenance": { "deposit_id": "9HUM", "doi": "10.1038/s41467-026-74279-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9HUM" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "a5b3 GABAAR bound to GABA and Mb25 in a desensitized state in saposin nanodiscs after short GABA treatment" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein (chains C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9IRV", "evidence_id": "EV-PDB-9IRV-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.47 }, "provenance": { "deposit_id": "9IRV", "doi": "10.1107/S2052252525003021", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9IRV" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "MultiBody Refinement of dimeric DARPin and its bound GFP on a symmetric scaffold" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Calcium indicator GCaMP6s-BrUS,Calmodulin-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9K8W", "evidence_id": "EV-PDB-9K8W-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.65 }, "provenance": { "deposit_id": "9K8W", "doi": "10.3390/ijms252312493", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9K8W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the calcium indicator GCaMP6s-BrUS in calcium-bound state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Calcium indicator GCaMP6s-BrUS-145,Calmodulin-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9K8X", "evidence_id": "EV-PDB-9K8X-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.05 }, "provenance": { "deposit_id": "9K8X", "doi": "10.3390/ijms252312493", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9K8X" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the calcium indicator GCaMP6s-BrUS-145 in calcium-bounded state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Protein zyg-11 homolog B,Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9LK2", "evidence_id": "EV-PDB-9LK2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.37 }, "provenance": { "deposit_id": "9LK2", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9LK2" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "monomeric ZYG11B-EloB-EloC + substrate peptide GYIND" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Protein zyg-11 homolog B,Green fluorescent protein (chains A,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9LK6", "evidence_id": "EV-PDB-9LK6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.27 }, "provenance": { "deposit_id": "9LK6", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9LK6" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "dimeric ZYG11B-EloB-EloC + substrate peptide GYIND" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "PSP2 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9LYL", "evidence_id": "EV-PDB-9LYL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.33 }, "provenance": { "deposit_id": "9LYL", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9LYL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The X-ray diffraction structure of photosensitizer protein PSP2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1H9N" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,D(3) dopamine receptor (chains R)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9F34", "evidence_id": "EV-PDB-9F34-5", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.09 }, "provenance": { "deposit_id": "9F34", "doi": "10.1038/s41467-024-51993-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9F34" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of Dopamine 3 receptor:Go complex bound to bitopic FOB02-04A - Conformation B" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "CLR", "DU0", "M05", "POV" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,Transient receptor potential cation channel subfamily M member 7 (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8W2L", "evidence_id": "EV-PDB-8W2L-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.45 }, "provenance": { "deposit_id": "8W2L", "doi": "10.1016/j.celrep.2024.114108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8W2L" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "TRPM7 structure in complex with anticancer agent CCT128930 in closed state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,POU domain, class 5, transcription factor 1 (chains V)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RMC", "evidence_id": "EV-PDB-9RMC-14", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.2 }, "provenance": { "deposit_id": "9RMC", "doi": "10.1016/j.molcel.2026.01.021", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RMC" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL+6 class 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,POU domain, class 5, transcription factor 1 (chains V)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RN1", "evidence_id": "EV-PDB-9RN1-14", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 5.9 }, "provenance": { "deposit_id": "9RN1", "doi": "10.1016/j.molcel.2026.01.021", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RN1" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of BAF-nucleosome complex with OCT4-SOX2 at SHL+6 in ADP-bound state, BAF47 bound to ATPase lobe 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Siderophore exporter MmpL5,Green fluorescent protein (chains D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9S2U", "evidence_id": "EV-PDB-9S2U-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "9S2U", "doi": "10.1073/pnas.2516660122", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9S2U" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "1:1 complex of M.tuberculosis MmpL5 and M.smegmatis AcpM" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Non-structural protein 1,Green fluorescent protein (chains A,B,a,b)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9W1Y", "evidence_id": "EV-PDB-9W1Y-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 6.1 }, "provenance": { "deposit_id": "9W1Y", "doi": "10.1038/s41467-026-71970-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9W1Y" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "DENV2 non-structural protein 1 (NS1) with C-terminal mVenus Conformation 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Non-structural protein 1,Green fluorescent protein (chains A,B,a,b)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9W24", "evidence_id": "EV-PDB-9W24-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.8 }, "provenance": { "deposit_id": "9W24", "doi": "10.1038/s41467-026-71970-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9W24" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "DENV2 non-structural protein 1 (NS1) with C-terminal mVenus fusion" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ADP", "PO4", "XB2" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Myosin-7,General control transcription factor GCN4,Enhanced Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9YR7", "evidence_id": "EV-PDB-9YR7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "9YR7", "doi": "10.1126/sciadv.aed6472", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9YR7" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of human beta-cardiac myosin bound to mavacamten in the interacting-heads motif and S2-FH undocked state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "2OW", "ADP", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Myosin-7,General control transcription factor GCN4,Enhanced Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9YRH", "evidence_id": "EV-PDB-9YRH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.8 }, "provenance": { "deposit_id": "9YRH", "doi": "10.1126/sciadv.aed6472", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9YRH" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of human beta-cardiac myosin bound to omecamtiv mecarbil in the interacting-heads motif and S2-FH undocked state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ADP", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Myosin-7,General control transcription factor GCN4,Enhanced Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9YRG", "evidence_id": "EV-PDB-9YRG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "9YRG", "doi": "10.1126/sciadv.aed6472", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9YRG" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of human beta-cardiac myosin in the interacting-heads motif and S2-FH undocked state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ADP", "PO4", "XB2" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Myosin-7,General control transcription factor GCN4,Enhanced Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9YP9", "evidence_id": "EV-PDB-9YP9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "9YP9", "doi": "10.1126/sciadv.aed6472", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9YP9" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of human beta-cardiac myosin bound to mavacamten in the interacting-heads motif and S2-FH docked state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "2OW", "ADP", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Myosin-7,General control transcription factor GCN4,Enhanced Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9YP4", "evidence_id": "EV-PDB-9YP4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.5 }, "provenance": { "deposit_id": "9YP4", "doi": "10.1126/sciadv.aed6472", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9YP4" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of human beta-cardiac myosin bound to omecamtiv mecarbil in the interacting-heads motif and S2-FH docked state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ADP", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Myosin-7,General control transcription factor GCN4,Enhanced Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9YOP", "evidence_id": "EV-PDB-9YOP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.5 }, "provenance": { "deposit_id": "9YOP", "doi": "10.1126/sciadv.aed6472", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9YOP" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of human beta-cardiac myosin in the interacting-heads motif and S2-FH docked state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9X27", "evidence_id": "EV-PDB-9X27-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "9X27", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9X27" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray Structure of the EGFP:GBPR(R34K) Complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Non-structural protein 1,Green fluorescent protein (chains A,B,a,b)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9W25", "evidence_id": "EV-PDB-9W25-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 5.3 }, "provenance": { "deposit_id": "9W25", "doi": "10.1038/s41467-026-71970-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9W25" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "DENV2 non-structural protein 1 (NS1) with C-terminal mVenus Conformation 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Piezo-type mechanosensitive ion channel component 2,Green fluorescent protein (chains A,C,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9VEF", "evidence_id": "EV-PDB-9VEF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.75 }, "provenance": { "deposit_id": "9VEF", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9VEF" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "The cryo-EM structure of human Piezo2-MDFIC complex (composite map)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Piezo-type mechanosensitive ion channel component 2,Green fluorescent protein (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9VEE", "evidence_id": "EV-PDB-9VEE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.36 }, "provenance": { "deposit_id": "9VEE", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9VEE" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "The cryo-EM structure of human Piezo2-MDFIC2 complex (composite map)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Piezo-type mechanosensitive ion channel component 1,Green fluorescent protein (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9VED", "evidence_id": "EV-PDB-9VED-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.63 }, "provenance": { "deposit_id": "9VED", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9VED" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "The cryo-EM structure of mouse Piezo1-MDFI complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9U9D", "evidence_id": "EV-PDB-9U9D-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "9U9D", "doi": "10.1021/acs.analchem.5c03831", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9U9D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Bipartite Genetically Encoded Biosensor sG-GECO1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "MAN", "NAG", "THJ", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,alpha-1,2-Mannosidase (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9TPA", "evidence_id": "EV-PDB-9TPA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "9TPA", "doi": "10.1101/2025.01.29.635535", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9TPA" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "The ERAD misfolded glycoprotein checkpoint complex from Chaetomium thermophilum (EDEM:PDI heterodimer)." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZMA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Adenosine receptor A2a,Small exopenicillinase,Green fluorescent protein (chains B)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9T9P", "evidence_id": "EV-PDB-9T9P-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "9T9P", "doi": "10.1107/S2059798326003785", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9T9P" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Adenosine receptor A2a (A2AR)-beta-lactamase fusion bound to beta-lactamase inhibitory protein II (BLIPII) and ZM241385" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FDA", "MG", "NAD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "ATP-dependent RNA helicase DDX1,Green fluorescent protein (chains D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9SPE", "evidence_id": "EV-PDB-9SPE-4", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.25 }, "provenance": { "deposit_id": "9SPE", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9SPE" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Human tRNA ligase complex bound by PYROXD1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1IVP" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Hexose transporter 1,Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9SDL", "evidence_id": "EV-PDB-9SDL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.42 }, "provenance": { "deposit_id": "9SDL", "doi": "10.1038/s41594-026-01784-w", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9SDL" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of PfHT1 bound to 2,5-anhydro-D-mannitol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "branched: Cyclohexakis-(1-4)-(alpha-D-glucopyranose)" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Green fluorescent protein (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9S0T", "evidence_id": "EV-PDB-9S0T-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.05 }, "provenance": { "deposit_id": "9S0T", "doi": "10.1002/open.202500471", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9S0T" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Superfolder green fluorescent protein (sfGFP) exhibiting p-(phenylazo)-L-phenylalanine (Pap) at position 39 in complex with alpha-cyclodextrin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Augmin complex subunit msd5,Green fluorescent protein,Glutathione S-transferase class-mu 26 kDa isozyme (chains K)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RPD", "evidence_id": "EV-PDB-9RPD-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.9 }, "provenance": { "deposit_id": "9RPD", "doi": "10.1038/s41467-025-63165-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RPD" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "D. melanogaster Augmin TII N-clamp (GST-fusion) bound to a microtubule, well-defined subset of particles" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ABU", "EPE", "NAG", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-6)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(1-6)-[alpha-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-3)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(1-6)-[alpha-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: beta-D-mannopyranose-(1-3)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Gamma-aminobutyric acid receptor subunit beta-3,Green fluorescent protein (chains B,C,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RPB", "evidence_id": "EV-PDB-9RPB-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "9RPB", "doi": "10.1038/s41467-026-74279-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RPB" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "a5b3 GABAAR bound to GABA, and Mb25 in a desensitized state in saposin nanodiscs, topiramate-free" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ABU", "EPE", "NAG", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-6)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(1-6)-[alpha-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-3)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(1-6)-[alpha-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: beta-D-mannopyranose-(1-3)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,Gamma-aminobutyric acid receptor subunit alpha-5 (chains A,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RPB", "evidence_id": "EV-PDB-9RPB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "9RPB", "doi": "10.1038/s41467-026-74279-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RPB" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "a5b3 GABAAR bound to GABA, and Mb25 in a desensitized state in saposin nanodiscs, topiramate-free" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,POU domain, class 5, transcription factor 1 (chains V)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RN2", "evidence_id": "EV-PDB-9RN2-13", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.1 }, "provenance": { "deposit_id": "9RN2", "doi": "10.1016/j.molcel.2026.01.021", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RN2" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL+6 class 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ABU", "EPE", "NAG", "TOR", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-6)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(1-6)-[alpha-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-3)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(1-6)-[alpha-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: beta-D-mannopyranose-(1-3)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Gamma-aminobutyric acid receptor subunit beta-3,Green fluorescent protein (chains B,C,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RL5", "evidence_id": "EV-PDB-9RL5-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "9RL5", "doi": "10.1038/s41467-026-74279-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RL5" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "a5b3 GABAAR bound to Topiramate, GABA, and Mb25 in a desensitized state in saposin nanodiscs" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PTD", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,POU domain, class 5, transcription factor 1 (chains V)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RL4", "evidence_id": "EV-PDB-9RL4-14", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.5 }, "provenance": { "deposit_id": "9RL4", "doi": "10.1016/j.molcel.2026.01.021", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RL4" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL-6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "L9Q" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Siderophore exporter MmpL5,Green fluorescent protein (chains D,E,F)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RGB", "evidence_id": "EV-PDB-9RGB-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "9RGB", "doi": "10.1101/2025.06.24.661325", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RGB" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "M.tuberculosis MmpS5L5-acpM complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Green fluorescent protein,Adhesion G protein-coupled receptor L4 (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9QXL", "evidence_id": "EV-PDB-9QXL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.14 }, "provenance": { "deposit_id": "9QXL", "doi": "10.1038/s41467-025-67629-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9QXL" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "The structure of ADGRL4 in the active-state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "ESX secretion system protein YukB,Green fluorescent protein (chains G,H)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9QKS", "evidence_id": "EV-PDB-9QKS-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.8 }, "provenance": { "deposit_id": "9QKS", "doi": "10.1126/sciadv.ady9587", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9QKS" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "B subtilis Type VIIb Core Unit (T7bCU) + DUF" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "PEG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9PQC", "evidence_id": "EV-PDB-9PQC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "9PQC", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9PQC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature crystal structure of enhanced Green Fluorescent Protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Glutamate receptor ionotropic, kainate 5,Green fluorescent protein chimera (chains A,C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9OSI", "evidence_id": "EV-PDB-9OSI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.95 }, "provenance": { "deposit_id": "9OSI", "doi": "10.1038/s41467-026-72226-w", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9OSI" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "The intact LBD state of GluK2/K5 with alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Glutamate receptor ionotropic, kainate 5,Green fluorescent protein chimera (chains A,C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9OSF", "evidence_id": "EV-PDB-9OSF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.83 }, "provenance": { "deposit_id": "9OSF", "doi": "10.1038/s41467-026-72226-w", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9OSF" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "The intact LBD state of GluK2/K5 with 5-iodowillardiine and kynurenic acid sodium salt" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Isoform 3 of Protein-serine O-palmitoleoyltransferase porcupine,Green fluorescent protein (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9OO8", "evidence_id": "EV-PDB-9OO8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.32 }, "provenance": { "deposit_id": "9OO8", "doi": "10.1038/s42004-025-01726-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9OO8" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Apo Human PORCN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACY", "GOL", "PEG", "PGE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Fluorescent thiol-disulfide redox biosensor (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9MUV", "evidence_id": "EV-PDB-9MUV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "9MUV", "doi": "10.1073/pnas.2503978122", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9MUV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Oxidized state of a turn-on thiol-disulfide redox biosensor with a fluorescence-lifetime readout" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "FMT", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Fluorescent thiol-disulfide redox biosensor (chains C,D,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9MUU", "evidence_id": "EV-PDB-9MUU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.15 }, "provenance": { "deposit_id": "9MUU", "doi": "10.1073/pnas.2503978122", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9MUU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Oxidized state of a turn-off thiol-disulfide redox biosensor with a fluorescence-lifetime readout" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "EDO", "FMT", "GOL", "PGE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Fluorescent thiol-disulfide redox biosensor (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9MUT", "evidence_id": "EV-PDB-9MUT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "9MUT", "doi": "10.1073/pnas.2503978122", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9MUT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Reduced state of a turn-on thiol-disulfide redox biosensor with a fluorescence-lifetime readout" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACY", "GOL", "PGE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Fluorescent thiol-disulfide redox biosensor (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9MUS", "evidence_id": "EV-PDB-9MUS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "gfp-structures-native", "state_id": "GFP-native", "who": "rule:gfp-structures-native" } ], "molecule_id": "P42212", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "9MUS", "doi": "10.1073/pnas.2503978122", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9MUS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Reduced state of a turn-off thiol-disulfide redox biosensor with a fluorescence-lifetime readout" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.7, "salt_mM": null, "temperature_c": 34.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=19069", "evidence_id": "EV-BMRB-19069", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "gfp-nmr-shifts-native", "state_id": "GFP-native", "who": "rule:gfp-nmr-shifts-native" } ], "molecule_id": "P42212", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr19069", "doi": "10.13018/BMR19069", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=19069" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H,13C,15N Assignement of EFGP fluorescent protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.0, "salt_mM": null, "temperature_c": 36.85 }, "construct": { "description": "BMRB data: 1H chemical shifts, 13C chemical shifts, 15N chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=5514", "evidence_id": "EV-BMRB-5514", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "gfp-nmr-shifts-native", "state_id": "GFP-native", "who": "rule:gfp-nmr-shifts-native" } ], "molecule_id": "P42212", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr5514", "doi": "10.13018/BMR5514", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=5514" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Backbone HN, N, Ca and Cb assignment of the GFPuv mutant, an 54 kDa protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_silico", "ions": [], "ligands": [], "notes": "Computed prediction; no experimental conditions.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "AlphaFold Monomer v2.0 pipeline, residues 1-238", "labels": [] }, "data_format": "mmCIF, PAE JSON", "data_level": "processed", "data_link": "https://alphafold.ebi.ac.uk/entry/P42212", "evidence_id": "EV-AFDB-AF-P42212-F1", "mappings": [ { "confidence": "low", "justification": "AlphaFold prediction of the native fold (prediction, not a measurement).", "rule": "gfp-af-native", "state_id": "GFP-native", "who": "rule:gfp-af-native" } ], "molecule_id": "P42212", "observable": { "type": "plddt", "uncertainty": null, "unit": "pLDDT", "value": 96.62 }, "provenance": { "deposit_id": "AF-P42212-F1", "doi": null, "licence": "CC BY 4.0", "retrieved": "2026-10-19", "source": "AlphaFold DB", "url": "https://alphafold.ebi.ac.uk/entry/P42212" }, "reader": null, "source_kind": "computed", "technique": "af_prediction", "title": "AlphaFold DB prediction AF-P42212-F1" } ], "models": [ { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-1GFL-1" ], "file": "models/P42212/GFP-native.cif", "format": "mmCIF", "model_id": "GFP-native-cif", "molecule_id": "P42212", "provenance": { "deposit_id": "1GFL", "doi": "10.1038/nbt1096-1246", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/1GFL.cif" }, "state_id": "GFP-native" }, { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-1GFL-1" ], "file": "models/P42212/GFP-native.pdb", "format": "PDB", "model_id": "GFP-native-pdb", "molecule_id": "P42212", "provenance": { "deposit_id": "1GFL", "doi": "10.1038/nbt1096-1246", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/1GFL.pdb" }, "state_id": "GFP-native" } ], "molecule": { "components": [], "domains": [], "gene": "GFP", "identifiers": { "genbank": null, "isoform": null, "nakb": null, "pdb": [], "rfam": null, "rnacentral": null, "uniprot": "P42212" }, "ligands": [], "modifications": [ { "kind": "ptm", "name": "(Z)-2,3-didehydrotyrosine", "position": 66, "source": "UniProtKB" } ], "molecule_id": "P42212", "molecule_type": "protein", "name": "Green fluorescent protein", "organism": { "name": "Aequorea victoria", "taxon_id": 6100 }, "provenance": { "deposit_id": "P42212", "doi": null, "licence": "CC BY 4.0 (UniProt)", "retrieved": "2026-10-19", "source": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P42212/entry" }, "sequence": "MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK", "sequence_length": 238 }, "molecule_id": "P42212", "states": [ { "assumptions": [], "basis": "observed", "description": "Beta-barrel with the chromophore formed, as in 1GFL.", "family_label": null, "molecule_id": "P42212", "name": "native fold", "parent_state": null, "population": null, "provenance": { "deposit_id": null, "doi": null, "licence": "Project licence (pending decision)", "retrieved": "2026-10-19", "source": "Conformome curation (P42212.yaml)", "url": "https://github.com/matth55/conformome/blob/HEAD/curation/P42212.yaml" }, "representative_model": "GFP-native-cif", "secondary_structure": null, "state_id": "GFP-native", "status": "draft" }, { "assumptions": [ "Treated as a single ensemble; residual structure and intermediates are not resolved.", "Defined by indirect measurements (denaturation, NMR of denatured samples, force spectroscopy); no model is exported." ], "basis": "inferred", "description": "Unfolded ensemble reached by denaturant, temperature or force. No observed structure.", "family_label": null, "molecule_id": "P42212", "name": "unfolded", "parent_state": null, "population": null, "provenance": { "deposit_id": null, "doi": null, "licence": "Project licence (pending decision)", "retrieved": "2026-10-19", "source": "Conformome curation (P42212.yaml)", "url": "https://github.com/matth55/conformome/blob/HEAD/curation/P42212.yaml" }, "representative_model": null, "secondary_structure": null, "state_id": "GFP-unfolded", "status": "draft" } ], "transitions": [] }