{
  "conflicts": [],
  "coverage": {
    "cells": {},
    "data_levels": {},
    "single_method_states": [],
    "states": [],
    "techniques": [
      "xray",
      "cryoem",
      "nmr_structure",
      "nmr_shifts",
      "force_spectroscopy",
      "af_prediction"
    ],
    "unmapped_evidence": 25
  },
  "curation": {
    "as_of": "",
    "curator": "none",
    "file": "",
    "status": "uncurated"
  },
  "evidence": [
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 5.0,
        "salt_mM": null,
        "temperature_c": 49.85
      },
      "construct": {
        "description": "DNA-BINDING PROTEIN 7D (chains C,D)",
        "labels": []
      },
      "data_format": "mmCIF + NMR restraints",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/1BBX",
      "evidence_id": "EV-PDB-1BBX-2",
      "mappings": [],
      "molecule_id": "P39476",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "1BBX",
        "doi": "10.1038/836",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/1BBX"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_structure",
      "title": "NON-SPECIFIC PROTEIN-DNA INTERACTIONS IN THE SSO7D-DNA COMPLEX, NMR, 1 STRUCTURE"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 6.5,
        "salt_mM": null,
        "temperature_c": 13.85
      },
      "construct": {
        "description": "DNA-BINDING PROTEIN 7A (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/1BNZ",
      "evidence_id": "EV-PDB-1BNZ-2",
      "mappings": [],
      "molecule_id": "P39476",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.0
      },
      "provenance": {
        "deposit_id": "1BNZ",
        "doi": "10.1038/1822",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/1BNZ"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "SSO7D HYPERTHERMOPHILE PROTEIN/DNA COMPLEX"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 6.5,
        "salt_mM": null,
        "temperature_c": -150.15
      },
      "construct": {
        "description": "DNA-BINDING PROTEIN 7A (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/1C8C",
      "evidence_id": "EV-PDB-1C8C-2",
      "mappings": [],
      "molecule_id": "P39476",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.45
      },
      "provenance": {
        "deposit_id": "1C8C",
        "doi": "10.1006/jmbi.2000.4112",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/1C8C"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "CRYSTAL STRUCTURES OF THE CHROMOSOMAL PROTEINS SSO7D/SAC7D BOUND TO DNA CONTAINING T-G MISMATCHED BASE PAIRS"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 4.5,
        "salt_mM": null,
        "temperature_c": 26.85
      },
      "construct": {
        "description": "SSO7D (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + NMR restraints",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/1JIC",
      "evidence_id": "EV-PDB-1JIC-1",
      "mappings": [],
      "molecule_id": "P39476",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "1JIC",
        "doi": "10.1021/bi9911280",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/1JIC"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_structure",
      "title": "SOLUTION NMR STRUCTURE OF RECOMBINANT SSO7D WITH RNASE ACTIVITY, MINIMIZED AVERAGE STRUCTURE"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "UMQ"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.1,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "MoeN5,DNA-binding protein 7d (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5B0J",
      "evidence_id": "EV-PDB-5B0J-1",
      "mappings": [],
      "molecule_id": "P39476",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.5
      },
      "provenance": {
        "deposit_id": "5B0J",
        "doi": "10.1002/anie.201511388",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5B0J"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of MoeN5-Sso7d fusion protein in complex with beta-undecyl maltoside"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "DMU"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.1,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "MoeN5,DNA-binding protein 7d (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5B0K",
      "evidence_id": "EV-PDB-5B0K-1",
      "mappings": [],
      "molecule_id": "P39476",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.75
      },
      "provenance": {
        "deposit_id": "5B0K",
        "doi": "10.1002/anie.201511388",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5B0K"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of MoeN5-Sso7d fusion protein in complex with beta-decyl maltoside"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "BNG"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.1,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "MoeN5,DNA-binding protein 7d (chains A,B,C,D,E,F,G,H)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5B0L",
      "evidence_id": "EV-PDB-5B0L-1",
      "mappings": [],
      "molecule_id": "P39476",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.8
      },
      "provenance": {
        "deposit_id": "5B0L",
        "doi": "10.1002/anie.201511388",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5B0L"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of MoeN5-Sso7d fusion protein in complex with beta-nonyl glucoside"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "LMT"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.1,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "MoeN5,DNA-binding protein 7d (chains A,B,C,D,E,F,G,H)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5B0M",
      "evidence_id": "EV-PDB-5B0M-1",
      "mappings": [],
      "molecule_id": "P39476",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.05
      },
      "provenance": {
        "deposit_id": "5B0M",
        "doi": "10.1002/anie.201511388",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5B0M"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of MoeN5-Sso7d fusion protein in complex with beta-dodecyl maltoside"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "78S"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.1,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "MoeN5,DNA-binding protein 7d (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5GWV",
      "evidence_id": "EV-PDB-5GWV-1",
      "mappings": [],
      "molecule_id": "P39476",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.4
      },
      "provenance": {
        "deposit_id": "5GWV",
        "doi": "10.1016/j.bbrc.2019.02.131",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5GWV"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of MoeN5-Sso7d fusion protein in complex with a substrate analogue"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "7B5"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.1,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "MoeN5,DNA-binding protein 7d (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5GWW",
      "evidence_id": "EV-PDB-5GWW-1",
      "mappings": [],
      "molecule_id": "P39476",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.3
      },
      "provenance": {
        "deposit_id": "5GWW",
        "doi": "10.1016/j.bbrc.2019.02.131",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5GWW"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of MoeN5-Sso7d fusion protein in complex with a permethylated substrate analogue"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "MG",
          "ZN"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "HIV-1 Integrase, Sso7d chimera (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5U1C",
      "evidence_id": "EV-PDB-5U1C-1",
      "mappings": [],
      "molecule_id": "P39476",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.9
      },
      "provenance": {
        "deposit_id": "5U1C",
        "doi": "10.1126/science.aah5163",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5U1C"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Structure of tetrameric HIV-1 Strand Transfer Complex Intasome"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "CA",
          "ZN"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Chimeric Sso7d and HIV-1 integrase (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6PUT",
      "evidence_id": "EV-PDB-6PUT-1",
      "mappings": [],
      "molecule_id": "P39476",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.9
      },
      "provenance": {
        "deposit_id": "6PUT",
        "doi": "10.1126/science.aay8015",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6PUT"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Structure of HIV cleaved synaptic complex (CSC) intasome bound with calcium"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "KLQ",
          "MG",
          "ZN"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Chimeric Sso7d and HIV-1 integrase (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6PUW",
      "evidence_id": "EV-PDB-6PUW-1",
      "mappings": [],
      "molecule_id": "P39476",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.9
      },
      "provenance": {
        "deposit_id": "6PUW",
        "doi": "10.1126/science.aay8015",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6PUW"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Structure of HIV cleaved synaptic complex (CSC) intasome bound with magnesium and Bictegravir (BIC)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "MG",
          "XXJ",
          "ZN"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Chimeric Sso7d and HIV-1 integrase (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6PUZ",
      "evidence_id": "EV-PDB-6PUZ-1",
      "mappings": [],
      "molecule_id": "P39476",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.8
      },
      "provenance": {
        "deposit_id": "6PUZ",
        "doi": "10.1126/science.aay8015",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6PUZ"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Structure of HIV cleaved synaptic complex (CSC) intasome bound with magnesium and INSTI XZ446 (compound 4f)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "MG",
          "QUW",
          "ZN"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Chimeric Sso7d and HIV-1 integrase (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6V3K",
      "evidence_id": "EV-PDB-6V3K-1",
      "mappings": [],
      "molecule_id": "P39476",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.4
      },
      "provenance": {
        "deposit_id": "6V3K",
        "doi": "10.1126/science.aay8015",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6V3K"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Structure of HIV cleaved synaptic complex (CSC) intasome bound with magnesium and INSTI XZ419 (compound 4c)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "MG",
          "ZN"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "DNA-binding protein 7d (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6VOY",
      "evidence_id": "EV-PDB-6VOY-1",
      "mappings": [],
      "molecule_id": "P39476",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.7
      },
      "provenance": {
        "deposit_id": "6VOY",
        "doi": "10.1038/s41467-020-16963-6",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6VOY"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of HTLV-1 instasome"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "MG",
          "OZ1",
          "ZN"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Chimeric Sso7d and HIV-1 integrase (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6PUY",
      "evidence_id": "EV-PDB-6PUY-1",
      "mappings": [],
      "molecule_id": "P39476",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.8
      },
      "provenance": {
        "deposit_id": "6PUY",
        "doi": "10.1126/science.aay8015",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6PUY"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Structure of HIV cleaved synaptic complex (CSC) intasome bound with magnesium and INSTI XZ426 (compound 4d)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "C0X"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.1,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "MoeN5,DNA-binding protein 7d (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6J8W",
      "evidence_id": "EV-PDB-6J8W-1",
      "mappings": [],
      "molecule_id": "P39476",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.35
      },
      "provenance": {
        "deposit_id": "6J8W",
        "doi": "10.1016/j.bbrc.2019.02.131",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6J8W"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of MOEN5-SSO7D fusion protein in complex with lig 1"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "FAR"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.1,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "MoeN5,DNA-binding protein 7d (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6J8V",
      "evidence_id": "EV-PDB-6J8V-1",
      "mappings": [],
      "molecule_id": "P39476",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.23
      },
      "provenance": {
        "deposit_id": "6J8V",
        "doi": "10.1016/j.bbrc.2019.02.131",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6J8V"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of MOEN5-SSO7D fusion protein in complex with ligand 2"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "BOG"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.1,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "MoeN5,DNA-binding protein 7d (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5B0I",
      "evidence_id": "EV-PDB-5B0I-1",
      "mappings": [],
      "molecule_id": "P39476",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.26
      },
      "provenance": {
        "deposit_id": "5B0I",
        "doi": "10.1002/anie.201511388",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5B0I"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of MoeN5-Sso7d fusion protein in complex with beta-octyl glucoside"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "GPP"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.1,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "MoeN5,DNA-binding protein 7d (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5B03",
      "evidence_id": "EV-PDB-5B03-1",
      "mappings": [],
      "molecule_id": "P39476",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.6
      },
      "provenance": {
        "deposit_id": "5B03",
        "doi": "10.1002/anie.201511388",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5B03"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of MoeN5-Sso7d fusion protein in complex with geranyl pyrophosphate"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.1,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "MoeN5,DNA-binding protein 7d (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5B02",
      "evidence_id": "EV-PDB-5B02-1",
      "mappings": [],
      "molecule_id": "P39476",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.21
      },
      "provenance": {
        "deposit_id": "5B02",
        "doi": "10.1002/anie.201511388",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5B02"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of the prenyltransferase MoeN5 with a fusion protein tag of Sso7d"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 5.15,
        "salt_mM": null,
        "temperature_c": 29.85
      },
      "construct": {
        "description": "BMRB data: 1H chemical shifts, 13C chemical shifts, 15N chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=5909",
      "evidence_id": "EV-BMRB-5909",
      "mappings": [],
      "molecule_id": "P39476",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr5909",
        "doi": "10.13018/BMR5909",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=5909"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Backbone 1HN and 15N Chemical Shift Assignments for Sso7d"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_silico",
        "ions": [],
        "ligands": [],
        "notes": "Computed prediction; no experimental conditions.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "AlphaFold Monomer v2.0 pipeline, residues 1-64",
        "labels": []
      },
      "data_format": "mmCIF, PAE JSON",
      "data_level": "processed",
      "data_link": "https://alphafold.ebi.ac.uk/entry/P39476",
      "evidence_id": "EV-AFDB-AF-P39476-F1",
      "mappings": [],
      "molecule_id": "P39476",
      "observable": {
        "type": "plddt",
        "uncertainty": null,
        "unit": "pLDDT",
        "value": 91.38
      },
      "provenance": {
        "deposit_id": "AF-P39476-F1",
        "doi": null,
        "licence": "CC BY 4.0",
        "retrieved": "2026-10-19",
        "source": "AlphaFold DB",
        "url": "https://alphafold.ebi.ac.uk/entry/P39476"
      },
      "reader": null,
      "source_kind": "computed",
      "technique": "af_prediction",
      "title": "AlphaFold DB prediction AF-P39476-F1"
    }
  ],
  "models": [],
  "molecule": {
    "components": [],
    "domains": [],
    "gene": "sso7d",
    "identifiers": {
      "genbank": null,
      "isoform": null,
      "nakb": null,
      "pdb": [],
      "rfam": null,
      "rnacentral": null,
      "uniprot": "P39476"
    },
    "ligands": [],
    "modifications": [
      {
        "kind": "ptm",
        "name": "N6-methyllysine",
        "position": 5,
        "source": "UniProtKB"
      },
      {
        "kind": "ptm",
        "name": "N6-methyllysine",
        "position": 7,
        "source": "UniProtKB"
      },
      {
        "kind": "ptm",
        "name": "N6-methyllysine",
        "position": 61,
        "source": "UniProtKB"
      },
      {
        "kind": "ptm",
        "name": "N6-methyllysine",
        "position": 63,
        "source": "UniProtKB"
      },
      {
        "kind": "ptm",
        "name": "N6-methyllysine",
        "position": 64,
        "source": "UniProtKB"
      }
    ],
    "molecule_id": "P39476",
    "molecule_type": "protein",
    "name": "DNA-binding protein 7d",
    "organism": {
      "name": "Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)",
      "taxon_id": 273057
    },
    "provenance": {
      "deposit_id": "P39476",
      "doi": null,
      "licence": "CC BY 4.0 (UniProt)",
      "retrieved": "2026-10-19",
      "source": "UniProtKB",
      "url": "https://www.uniprot.org/uniprotkb/P39476/entry"
    },
    "sequence": "MATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK",
    "sequence_length": 64
  },
  "molecule_id": "P39476",
  "states": [],
  "transitions": []
}