{
  "conflicts": [
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2J3-EV-SASBDB-SASD2M3",
      "evidence_ids": [
        "EV-SASBDB-SASD2J3",
        "EV-SASBDB-SASD2M3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.504 nm, beyond combined uncertainty 0.0382",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.028,
        0.026
      ],
      "unit": "nm",
      "values": [
        2.912,
        3.416
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2J3-EV-SASBDB-SASD2N3",
      "evidence_ids": [
        "EV-SASBDB-SASD2J3",
        "EV-SASBDB-SASD2N3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.458 nm, beyond combined uncertainty 0.0333",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.028,
        0.018
      ],
      "unit": "nm",
      "values": [
        2.912,
        3.37
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2J3-EV-SASBDB-SASD2P3",
      "evidence_ids": [
        "EV-SASBDB-SASD2J3",
        "EV-SASBDB-SASD2P3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.511 nm, beyond combined uncertainty 0.0382",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.028,
        0.026
      ],
      "unit": "nm",
      "values": [
        2.912,
        3.423
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2J3-EV-SASBDB-SASD2Q3",
      "evidence_ids": [
        "EV-SASBDB-SASD2J3",
        "EV-SASBDB-SASD2Q3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.509 nm, beyond combined uncertainty 0.0328",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.028,
        0.017
      ],
      "unit": "nm",
      "values": [
        2.912,
        3.421
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2J3-EV-SASBDB-SASD2R3",
      "evidence_ids": [
        "EV-SASBDB-SASD2J3",
        "EV-SASBDB-SASD2R3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.506 nm, beyond combined uncertainty 0.0313",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.028,
        0.014
      ],
      "unit": "nm",
      "values": [
        2.912,
        3.418
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2J3-EV-SASBDB-SASD2S3",
      "evidence_ids": [
        "EV-SASBDB-SASD2J3",
        "EV-SASBDB-SASD2S3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.526 nm, beyond combined uncertainty 0.0375",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.028,
        0.025
      ],
      "unit": "nm",
      "values": [
        2.912,
        3.438
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2J3-EV-SASBDB-SASD2T3",
      "evidence_ids": [
        "EV-SASBDB-SASD2J3",
        "EV-SASBDB-SASD2T3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.495 nm, beyond combined uncertainty 0.0328",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.028,
        0.017
      ],
      "unit": "nm",
      "values": [
        2.912,
        3.407
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2J3-EV-SASBDB-SASD2U3",
      "evidence_ids": [
        "EV-SASBDB-SASD2J3",
        "EV-SASBDB-SASD2U3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.522 nm, beyond combined uncertainty 0.0309",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.028,
        0.013
      ],
      "unit": "nm",
      "values": [
        2.912,
        3.434
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2K3-EV-SASBDB-SASD2M3",
      "evidence_ids": [
        "EV-SASBDB-SASD2K3",
        "EV-SASBDB-SASD2M3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.478 nm, beyond combined uncertainty 0.0328",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.02,
        0.026
      ],
      "unit": "nm",
      "values": [
        2.938,
        3.416
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2K3-EV-SASBDB-SASD2N3",
      "evidence_ids": [
        "EV-SASBDB-SASD2K3",
        "EV-SASBDB-SASD2N3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.432 nm, beyond combined uncertainty 0.0269",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.02,
        0.018
      ],
      "unit": "nm",
      "values": [
        2.938,
        3.37
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2K3-EV-SASBDB-SASD2P3",
      "evidence_ids": [
        "EV-SASBDB-SASD2K3",
        "EV-SASBDB-SASD2P3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.485 nm, beyond combined uncertainty 0.0328",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.02,
        0.026
      ],
      "unit": "nm",
      "values": [
        2.938,
        3.423
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2K3-EV-SASBDB-SASD2Q3",
      "evidence_ids": [
        "EV-SASBDB-SASD2K3",
        "EV-SASBDB-SASD2Q3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.483 nm, beyond combined uncertainty 0.0262",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.02,
        0.017
      ],
      "unit": "nm",
      "values": [
        2.938,
        3.421
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2K3-EV-SASBDB-SASD2R3",
      "evidence_ids": [
        "EV-SASBDB-SASD2K3",
        "EV-SASBDB-SASD2R3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.48 nm, beyond combined uncertainty 0.0244",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.02,
        0.014
      ],
      "unit": "nm",
      "values": [
        2.938,
        3.418
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2K3-EV-SASBDB-SASD2S3",
      "evidence_ids": [
        "EV-SASBDB-SASD2K3",
        "EV-SASBDB-SASD2S3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.5 nm, beyond combined uncertainty 0.032",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.02,
        0.025
      ],
      "unit": "nm",
      "values": [
        2.938,
        3.438
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2K3-EV-SASBDB-SASD2T3",
      "evidence_ids": [
        "EV-SASBDB-SASD2K3",
        "EV-SASBDB-SASD2T3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.469 nm, beyond combined uncertainty 0.0262",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.02,
        0.017
      ],
      "unit": "nm",
      "values": [
        2.938,
        3.407
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2K3-EV-SASBDB-SASD2U3",
      "evidence_ids": [
        "EV-SASBDB-SASD2K3",
        "EV-SASBDB-SASD2U3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.496 nm, beyond combined uncertainty 0.0239",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.02,
        0.013
      ],
      "unit": "nm",
      "values": [
        2.938,
        3.434
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2L3-EV-SASBDB-SASD2M3",
      "evidence_ids": [
        "EV-SASBDB-SASD2L3",
        "EV-SASBDB-SASD2M3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.49 nm, beyond combined uncertainty 0.0305",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.016,
        0.026
      ],
      "unit": "nm",
      "values": [
        2.926,
        3.416
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2L3-EV-SASBDB-SASD2N3",
      "evidence_ids": [
        "EV-SASBDB-SASD2L3",
        "EV-SASBDB-SASD2N3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.444 nm, beyond combined uncertainty 0.0241",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.016,
        0.018
      ],
      "unit": "nm",
      "values": [
        2.926,
        3.37
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2L3-EV-SASBDB-SASD2P3",
      "evidence_ids": [
        "EV-SASBDB-SASD2L3",
        "EV-SASBDB-SASD2P3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.497 nm, beyond combined uncertainty 0.0305",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.016,
        0.026
      ],
      "unit": "nm",
      "values": [
        2.926,
        3.423
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2L3-EV-SASBDB-SASD2Q3",
      "evidence_ids": [
        "EV-SASBDB-SASD2L3",
        "EV-SASBDB-SASD2Q3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.495 nm, beyond combined uncertainty 0.0233",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.016,
        0.017
      ],
      "unit": "nm",
      "values": [
        2.926,
        3.421
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2L3-EV-SASBDB-SASD2R3",
      "evidence_ids": [
        "EV-SASBDB-SASD2L3",
        "EV-SASBDB-SASD2R3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.492 nm, beyond combined uncertainty 0.0213",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.016,
        0.014
      ],
      "unit": "nm",
      "values": [
        2.926,
        3.418
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2L3-EV-SASBDB-SASD2S3",
      "evidence_ids": [
        "EV-SASBDB-SASD2L3",
        "EV-SASBDB-SASD2S3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.512 nm, beyond combined uncertainty 0.0297",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.016,
        0.025
      ],
      "unit": "nm",
      "values": [
        2.926,
        3.438
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2L3-EV-SASBDB-SASD2T3",
      "evidence_ids": [
        "EV-SASBDB-SASD2L3",
        "EV-SASBDB-SASD2T3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.481 nm, beyond combined uncertainty 0.0233",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.016,
        0.017
      ],
      "unit": "nm",
      "values": [
        2.926,
        3.407
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2L3-EV-SASBDB-SASD2U3",
      "evidence_ids": [
        "EV-SASBDB-SASD2L3",
        "EV-SASBDB-SASD2U3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.508 nm, beyond combined uncertainty 0.0206",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.016,
        0.013
      ],
      "unit": "nm",
      "values": [
        2.926,
        3.434
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2M3-EV-SASBDB-SASD2N3",
      "evidence_ids": [
        "EV-SASBDB-SASD2M3",
        "EV-SASBDB-SASD2N3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.046 nm, beyond combined uncertainty 0.0316",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.026,
        0.018
      ],
      "unit": "nm",
      "values": [
        3.416,
        3.37
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2N3-EV-SASBDB-SASD2P3",
      "evidence_ids": [
        "EV-SASBDB-SASD2N3",
        "EV-SASBDB-SASD2P3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.053 nm, beyond combined uncertainty 0.0316",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.018,
        0.026
      ],
      "unit": "nm",
      "values": [
        3.37,
        3.423
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2N3-EV-SASBDB-SASD2Q3",
      "evidence_ids": [
        "EV-SASBDB-SASD2N3",
        "EV-SASBDB-SASD2Q3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.051 nm, beyond combined uncertainty 0.0248",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.018,
        0.017
      ],
      "unit": "nm",
      "values": [
        3.37,
        3.421
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2N3-EV-SASBDB-SASD2R3",
      "evidence_ids": [
        "EV-SASBDB-SASD2N3",
        "EV-SASBDB-SASD2R3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.048 nm, beyond combined uncertainty 0.0228",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.018,
        0.014
      ],
      "unit": "nm",
      "values": [
        3.37,
        3.418
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2N3-EV-SASBDB-SASD2S3",
      "evidence_ids": [
        "EV-SASBDB-SASD2N3",
        "EV-SASBDB-SASD2S3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.068 nm, beyond combined uncertainty 0.0308",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.018,
        0.025
      ],
      "unit": "nm",
      "values": [
        3.37,
        3.438
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2N3-EV-SASBDB-SASD2T3",
      "evidence_ids": [
        "EV-SASBDB-SASD2N3",
        "EV-SASBDB-SASD2T3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.037 nm, beyond combined uncertainty 0.0248",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.018,
        0.017
      ],
      "unit": "nm",
      "values": [
        3.37,
        3.407
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2N3-EV-SASBDB-SASD2U3",
      "evidence_ids": [
        "EV-SASBDB-SASD2N3",
        "EV-SASBDB-SASD2U3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.064 nm, beyond combined uncertainty 0.0222",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.018,
        0.013
      ],
      "unit": "nm",
      "values": [
        3.37,
        3.434
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2S3-EV-SASBDB-SASD2T3",
      "evidence_ids": [
        "EV-SASBDB-SASD2S3",
        "EV-SASBDB-SASD2T3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.031 nm, beyond combined uncertainty 0.0302",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.025,
        0.017
      ],
      "unit": "nm",
      "values": [
        3.438,
        3.407
      ]
    },
    {
      "conflict_id": "CF-aS-disordered-radius_of_gyration-EV-SASBDB-SASD2T3-EV-SASBDB-SASD2U3",
      "evidence_ids": [
        "EV-SASBDB-SASD2T3",
        "EV-SASBDB-SASD2U3"
      ],
      "observable_type": "radius_of_gyration",
      "reason": "differ by 0.027 nm, beyond combined uncertainty 0.0214",
      "state_id": "aS-disordered",
      "uncertainties": [
        0.017,
        0.013
      ],
      "unit": "nm",
      "values": [
        3.407,
        3.434
      ]
    }
  ],
  "coverage": {
    "cells": {
      "aS-disordered": {
        "af_prediction": 0,
        "cd": 4,
        "cryoem": 0,
        "epr_deer": 1,
        "force_spectroscopy": 0,
        "ftir_raman": 1,
        "gel_electrophoresis": 1,
        "integrative": 1,
        "microed": 0,
        "nmr_dynamics": 2,
        "nmr_shifts": 27,
        "nmr_structure": 0,
        "saxs_sans": 11,
        "xray": 0
      },
      "aS-fibril": {
        "af_prediction": 0,
        "cd": 0,
        "cryoem": 204,
        "epr_deer": 0,
        "force_spectroscopy": 0,
        "ftir_raman": 0,
        "gel_electrophoresis": 0,
        "integrative": 0,
        "microed": 1,
        "nmr_dynamics": 0,
        "nmr_shifts": 0,
        "nmr_structure": 3,
        "saxs_sans": 0,
        "xray": 3
      },
      "aS-micelle-helix": {
        "af_prediction": 0,
        "cd": 0,
        "cryoem": 0,
        "epr_deer": 0,
        "force_spectroscopy": 0,
        "ftir_raman": 0,
        "gel_electrophoresis": 0,
        "integrative": 0,
        "microed": 0,
        "nmr_dynamics": 0,
        "nmr_shifts": 1,
        "nmr_structure": 2,
        "saxs_sans": 0,
        "xray": 0
      }
    },
    "data_levels": {
      "aS-disordered": {
        "cd": "reported",
        "epr_deer": "reported",
        "ftir_raman": "reported",
        "gel_electrophoresis": "reported",
        "integrative": "processed",
        "nmr_dynamics": "processed",
        "nmr_shifts": "processed",
        "saxs_sans": "processed"
      },
      "aS-fibril": {
        "cryoem": "processed",
        "microed": "processed",
        "nmr_structure": "processed",
        "xray": "processed"
      },
      "aS-micelle-helix": {
        "nmr_shifts": "processed",
        "nmr_structure": "processed"
      }
    },
    "single_method_states": [],
    "states": [
      "aS-disordered",
      "aS-micelle-helix",
      "aS-fibril"
    ],
    "techniques": [
      "xray",
      "cryoem",
      "microed",
      "nmr_structure",
      "nmr_dynamics",
      "nmr_shifts",
      "saxs_sans",
      "epr_deer",
      "cd",
      "ftir_raman",
      "force_spectroscopy",
      "gel_electrophoresis",
      "integrative",
      "af_prediction"
    ],
    "unmapped_evidence": 84
  },
  "curation": {
    "as_of": "2026-10-19",
    "curator": "draft (unreviewed)",
    "file": "P37840.yaml",
    "status": "draft"
  },
  "evidence": [
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.4,
        "salt_mM": null,
        "temperature_c": 25.05
      },
      "construct": {
        "description": "Alpha-synuclein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + NMR restraints",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/2KKW",
      "evidence_id": "EV-PDB-2KKW-1",
      "mappings": [
        {
          "confidence": "medium",
          "justification": "Structure titled as micelle-bound.",
          "rule": "as-micelle-title",
          "state_id": "aS-micelle-helix",
          "who": "rule:as-micelle-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "2KKW",
        "doi": "10.1021/ja100646t",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/2KKW"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_structure",
      "title": "SLAS-micelle bound alpha-synuclein"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "GOL",
          "SO4",
          "branched: alpha-D-glucopyranose-(1-4)-alpha-D-glucopyranose"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.0,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Maltose-binding periplasmic protein/alpha-synuclein chimeric protein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/3Q26",
      "evidence_id": "EV-PDB-3Q26-1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.54
      },
      "provenance": {
        "deposit_id": "3Q26",
        "doi": "10.1002/pro.630",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/3Q26"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Cyrstal structure of human alpha-synuclein (10-42) fused to maltose binding protein (MBP)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "IPA"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.9,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "ACE-MET-ASP-VAL-PHE-MET-LYS-GLY-LEU-SER-LYS (chains S,T)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6CT7",
      "evidence_id": "EV-PDB-6CT7-3",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.903
      },
      "provenance": {
        "deposit_id": "6CT7",
        "doi": "10.1016/j.nbd.2018.10.016",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6CT7"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Fab of anti-a-synuclein antibody BIIB054 in complex with acetylated a-synuclein peptide (1-10)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6OSM",
      "evidence_id": "EV-PDB-6OSM-1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.4
      },
      "provenance": {
        "deposit_id": "6OSM",
        "doi": "10.1016/j.jmb.2019.07.001",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6OSM"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of the N-terminally acetylated C-terminal Alpha-synuclein truncation Ac1-103"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6XYQ",
      "evidence_id": "EV-PDB-6XYQ-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.09
      },
      "provenance": {
        "deposit_id": "6XYQ",
        "doi": "10.1038/s41586-020-2317-6",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6XYQ"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Multiple system atrophy Type II-2 alpha-synuclein filament"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6XYP",
      "evidence_id": "EV-PDB-6XYP-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.29
      },
      "provenance": {
        "deposit_id": "6XYP",
        "doi": "10.1038/s41586-020-2317-6",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6XYP"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Multiple system atrophy Type II-1 alpha-synuclein filament"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6XYO",
      "evidence_id": "EV-PDB-6XYO-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.6
      },
      "provenance": {
        "deposit_id": "6XYO",
        "doi": "10.1038/s41586-020-2317-6",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6XYO"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Multiple system atrophy Type I alpha-synuclein filament"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6UFR",
      "evidence_id": "EV-PDB-6UFR-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.5
      },
      "provenance": {
        "deposit_id": "6UFR",
        "doi": "10.1073/pnas.1917914117",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6UFR"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Structure of recombinantly assembled E46K alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6SSX",
      "evidence_id": "EV-PDB-6SSX-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.98
      },
      "provenance": {
        "deposit_id": "6SSX",
        "doi": "10.7554/eLife.48907",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6SSX"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "cryo-em structure of alpha-synuclein fibril polymorph 2A"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6SST",
      "evidence_id": "EV-PDB-6SST-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.4
      },
      "provenance": {
        "deposit_id": "6SST",
        "doi": "10.7554/eLife.48907",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6SST"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "cryo-em structure of alpha-synuclein fibril polymorph 2B"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6RTB",
      "evidence_id": "EV-PDB-6RTB-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.46
      },
      "provenance": {
        "deposit_id": "6RTB",
        "doi": "10.7554/eLife.48907",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6RTB"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "cryo-em structure of alpha-synuclein fibril polymorph 2B"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6RT0",
      "evidence_id": "EV-PDB-6RT0-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.1
      },
      "provenance": {
        "deposit_id": "6RT0",
        "doi": "10.7554/eLife.48907",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6RT0"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "cryo-em structure of alpha-synuclein fibril polymorph 2A"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,V,W,X,Y,Z)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6PES",
      "evidence_id": "EV-PDB-6PES-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.6
      },
      "provenance": {
        "deposit_id": "6PES",
        "doi": "10.1038/s41594-019-0322-y",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6PES"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of alpha-synuclein H50Q Wide Fibril"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6PEO",
      "evidence_id": "EV-PDB-6PEO-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.3
      },
      "provenance": {
        "deposit_id": "6PEO",
        "doi": "10.1038/s41594-019-0322-y",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6PEO"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of alpha-synuclein H50Q Narrow Fibril"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6OSL",
      "evidence_id": "EV-PDB-6OSL-1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.0
      },
      "provenance": {
        "deposit_id": "6OSL",
        "doi": "10.1016/j.jmb.2019.07.001",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6OSL"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of the N-terminally acetylated C-terminal Alpha-synuclein truncation Ac1-122"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6OSJ",
      "evidence_id": "EV-PDB-6OSJ-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.8
      },
      "provenance": {
        "deposit_id": "6OSJ",
        "doi": "10.1016/j.jmb.2019.07.001",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6OSJ"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of the N-terminally acetylated full length alpha-synuclein fibrils (Ac1-140)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6LRQ",
      "evidence_id": "EV-PDB-6LRQ-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.49
      },
      "provenance": {
        "deposit_id": "6LRQ",
        "doi": "10.1038/s41422-020-0299-4",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6LRQ"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of A53T alpha-synuclein amyloid fibril"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6L4S",
      "evidence_id": "EV-PDB-6L4S-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.37
      },
      "provenance": {
        "deposit_id": "6L4S",
        "doi": "10.1038/s41467-020-16386-3",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6L4S"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "cryo-em structure of alpha-synuclein fiber mutation type E46K"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L,M,N,O)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6L1U",
      "evidence_id": "EV-PDB-6L1U-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.37
      },
      "provenance": {
        "deposit_id": "6L1U",
        "doi": "10.1073/pnas.1922741117",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6L1U"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of phosphorylated Tyr39 alpha-synuclein amyloid fibril"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6L1T",
      "evidence_id": "EV-PDB-6L1T-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.22
      },
      "provenance": {
        "deposit_id": "6L1T",
        "doi": "10.1073/pnas.1922741117",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6L1T"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of phosphorylated Tyr39 a-synuclein amyloid fibril"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.0,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Alpha-synuclein (chains B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6I42",
      "evidence_id": "EV-PDB-6I42-2",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.38
      },
      "provenance": {
        "deposit_id": "6I42",
        "doi": "10.1002/anie.201914878",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6I42"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of the alpha-Synuclein PreNAC/Cyclophilin A-complex"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6H6B",
      "evidence_id": "EV-PDB-6H6B-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.4
      },
      "provenance": {
        "deposit_id": "6H6B",
        "doi": "10.7554/eLife.36402",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6H6B"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Structure of alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6CU8",
      "evidence_id": "EV-PDB-6CU8-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.6
      },
      "provenance": {
        "deposit_id": "6CU8",
        "doi": "10.1038/s41467-018-05971-2",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6CU8"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Alpha Synuclein fibril formed by full length protein - Twister Polymorph"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6CU7",
      "evidence_id": "EV-PDB-6CU7-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.5
      },
      "provenance": {
        "deposit_id": "6CU7",
        "doi": "10.1038/s41467-018-05971-2",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6CU7"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Alpha Synuclein fibril formed by full length protein - Rod Polymorph"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6A6B",
      "evidence_id": "EV-PDB-6A6B-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Cryo-EM fibril; representative for the fibril state. Polymorph not separated.",
          "rule": "curator_assignment",
          "state_id": "aS-fibril",
          "who": "curator:draft (unreviewed)"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.07
      },
      "provenance": {
        "deposit_id": "6A6B",
        "doi": "10.1038/s41422-018-0075-x",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6A6B"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "cryo-em structure of alpha-synuclein fiber"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Peptide from Alpha-synuclein (chains B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5CRW",
      "evidence_id": "EV-PDB-5CRW-2",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.6
      },
      "provenance": {
        "deposit_id": "5CRW",
        "doi": "10.1038/srep13909",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5CRW"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of the b'-a' domain of oxidized protein disulfide isomerase complexed with alpha-synuclein peptide (31-41)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.0,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Alpha-synuclein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4ZNN",
      "evidence_id": "EV-PDB-4ZNN-1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.41
      },
      "provenance": {
        "deposit_id": "4ZNN",
        "doi": "10.1038/nature15368",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4ZNN"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "microed",
      "title": "MicroED structure of the segment, GVVHGVTTVA, from the A53T familial mutant of Parkinson's disease protein, alpha-synuclein residues 47-56"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 4.0,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Alpha-synuclein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4RIL",
      "evidence_id": "EV-PDB-4RIL-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.43
      },
      "provenance": {
        "deposit_id": "4RIL",
        "doi": "10.1038/nature15368",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4RIL"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "microed",
      "title": "Structure of the amyloid forming segment, GAVVTGVTAVA, from the NAC domain of Parkinson's disease protein alpha-synuclein, residues 68-78, determined by electron diffraction"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 4.6,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Alpha-synuclein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4RIK",
      "evidence_id": "EV-PDB-4RIK-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.854
      },
      "provenance": {
        "deposit_id": "4RIK",
        "doi": "10.1038/nature15368",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4RIK"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Amyloid forming segment, AVVTGVTAV, from the NAC domain of Parkinson's disease protein alpha-synuclein, residues 69-77"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 6.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Alpha-synuclein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4R0W",
      "evidence_id": "EV-PDB-4R0W-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.5
      },
      "provenance": {
        "deposit_id": "4R0W",
        "doi": "10.1021/ja509648u",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4R0W"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Vvtgvta, an amyloid forming segment from alpha synuclein, residues 70-76"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Alpha-synuclein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4R0U",
      "evidence_id": "EV-PDB-4R0U-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.38
      },
      "provenance": {
        "deposit_id": "4R0U",
        "doi": "10.1021/ja509648u",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4R0U"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Tgvtava, an amyloid forming segment from alpha synuclein, residues 72-78"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.4,
        "salt_mM": null,
        "temperature_c": 29.85
      },
      "construct": {
        "description": "ALPHA SYNUCLEIN (chains C)",
        "labels": []
      },
      "data_format": "mmCIF + NMR restraints",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4BXL",
      "evidence_id": "EV-PDB-4BXL-2",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "4BXL",
        "doi": "10.1002/ANIE.201309001",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4BXL"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_structure",
      "title": "Structure of alpha-synuclein in complex with an engineered binding protein"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "GOL",
          "SO4",
          "branched: alpha-D-glucopyranose-(1-4)-alpha-D-glucopyranose"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.0,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Maltose-binding periplasmic protein/alpha-synuclein chimeric protein (chains A,C)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/3Q29",
      "evidence_id": "EV-PDB-3Q29-1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.3
      },
      "provenance": {
        "deposit_id": "3Q29",
        "doi": "10.1002/pro.630",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/3Q29"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Cyrstal structure of human alpha-synuclein (1-19) fused to maltose binding protein (MBP)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "SO4",
          "branched: alpha-D-glucopyranose-(1-4)-alpha-D-glucopyranose"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 9.0,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Maltose-binding periplasmic protein/alpha-synuclein chimeric protein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/3Q28",
      "evidence_id": "EV-PDB-3Q28-1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.6
      },
      "provenance": {
        "deposit_id": "3Q28",
        "doi": "10.1002/pro.630",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/3Q28"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Cyrstal structure of human alpha-synuclein (58-79) fused to maltose binding protein (MBP)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "GOL",
          "SO4",
          "branched: alpha-D-glucopyranose-(1-4)-alpha-D-glucopyranose"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 9.0,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Maltose-binding periplasmic protein/alpha-synuclein chimeric protein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/3Q27",
      "evidence_id": "EV-PDB-3Q27-1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.302
      },
      "provenance": {
        "deposit_id": "3Q27",
        "doi": "10.1002/pro.630",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/3Q27"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (MBP)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "GOL",
          "SO4",
          "branched: alpha-D-glucopyranose-(1-4)-alpha-D-glucopyranose"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.0,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Maltose-binding periplasmic protein/alpha-synuclein chimeric protein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/3Q25",
      "evidence_id": "EV-PDB-3Q25-1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.9
      },
      "provenance": {
        "deposit_id": "3Q25",
        "doi": "10.1002/pro.630",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/3Q25"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of human alpha-synuclein (1-19) fused to maltose binding protein (MBP)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/36QD",
      "evidence_id": "EV-PDB-36QD-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.05
      },
      "provenance": {
        "deposit_id": "36QD",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/36QD"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM of rPFFs (recombinant preformed fibrils)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "CU"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.4,
        "salt_mM": null,
        "temperature_c": 7.85
      },
      "construct": {
        "description": "Alpha-synuclein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + NMR restraints",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/34AH",
      "evidence_id": "EV-PDB-34AH-1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "34AH",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/34AH"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_structure",
      "title": "Cu(II) - alpha-synuclein monomer complex - local structure of binding site His50 with Glu46 as ligand"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "CU"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.4,
        "salt_mM": null,
        "temperature_c": 7.85
      },
      "construct": {
        "description": "Alpha-synuclein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + NMR restraints",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/34AG",
      "evidence_id": "EV-PDB-34AG-1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "34AG",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/34AG"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_structure",
      "title": "Cu(II) - alpha-synuclein monomer complex - local structure of binding site His50 with Gly47 as ligand"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "CU"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.4,
        "salt_mM": null,
        "temperature_c": 7.85
      },
      "construct": {
        "description": "Alpha-synuclein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + NMR restraints",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/34AF",
      "evidence_id": "EV-PDB-34AF-1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "34AF",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/34AF"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_structure",
      "title": "Cu(II)-bound alpha-synuclein monomer complex - local structure of N-terminal binding site"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.5,
        "salt_mM": null,
        "temperature_c": -100.15
      },
      "construct": {
        "description": "ALPHA-SYNUCLEIN PEPTIDE (chains B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/2X6M",
      "evidence_id": "EV-PDB-2X6M-2",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.62
      },
      "provenance": {
        "deposit_id": "2X6M",
        "doi": "10.1016/J.JMB.2010.07.001",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/2X6M"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of a single domain camelid antibody fragment in complex with a C-terminal peptide of alpha-synuclein"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.0,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + NMR restraints",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/2N0A",
      "evidence_id": "EV-PDB-2N0A-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "2N0A",
        "doi": "10.1038/nsmb.3194",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/2N0A"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_structure",
      "title": "Atomic-resolution structure of alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "CA"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 6.36,
        "salt_mM": null,
        "temperature_c": 36.85
      },
      "construct": {
        "description": "Alpha-synuclein (chains B)",
        "labels": []
      },
      "data_format": "mmCIF + NMR restraints",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/2M55",
      "evidence_id": "EV-PDB-2M55-2",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "2M55",
        "doi": "10.1021/bi400199p",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/2M55"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_structure",
      "title": "NMR structure of the complex of an N-terminally acetylated alpha-synuclein peptide with calmodulin"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 6.5,
        "salt_mM": null,
        "temperature_c": 24.85
      },
      "construct": {
        "description": "Alpha-synuclein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + NMR restraints",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/2JN5",
      "evidence_id": "EV-PDB-2JN5-1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "2JN5",
        "doi": "10.1096/fj.09-133082",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/2JN5"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_structure",
      "title": "Solution Structure of a Dodecapeptide from Alpha-Synuclein Bound with Synphilin-1"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.4,
        "salt_mM": null,
        "temperature_c": 25.05
      },
      "construct": {
        "description": "Alpha-synuclein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + NMR restraints",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/1XQ8",
      "evidence_id": "EV-PDB-1XQ8-1",
      "mappings": [
        {
          "confidence": "medium",
          "justification": "NMR structure of the micelle-bound helical form; membrane-mimetic conditions, so confidence is medium.",
          "rule": "curator_assignment",
          "state_id": "aS-micelle-helix",
          "who": "curator:draft (unreviewed)"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "1XQ8",
        "doi": "10.1074/jbc.M411805200",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/1XQ8"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_structure",
      "title": "Human micelle-bound alpha-synuclein"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/12AT",
      "evidence_id": "EV-PDB-12AT-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.1
      },
      "provenance": {
        "deposit_id": "12AT",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/12AT"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of alpha-synuclein filaments (doublet) from M83(+/+) mouse brains with A53T mutation"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/12AR",
      "evidence_id": "EV-PDB-12AR-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.9
      },
      "provenance": {
        "deposit_id": "12AR",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/12AR"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of alpha-synuclein filaments (singlet) from M83(+/+) mouse brains with A53T mutation"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/12AQ",
      "evidence_id": "EV-PDB-12AQ-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.1
      },
      "provenance": {
        "deposit_id": "12AQ",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/12AQ"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of alpha-synuclein filaments (doublet) from Parkinson's disease with A53T mutation in SNCA"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/12AP",
      "evidence_id": "EV-PDB-12AP-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.1
      },
      "provenance": {
        "deposit_id": "12AP",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/12AP"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of alpha-synuclein filaments (singlet) from Parkinson's disease with A53T mutation in SNCA"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,U,W,X,Y,Z)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/10XU",
      "evidence_id": "EV-PDB-10XU-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.18
      },
      "provenance": {
        "deposit_id": "10XU",
        "doi": "10.1038/s41467-025-66146-4",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/10XU"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Structure of amplified aSyn filament by using seed amplification assay (SAA) from MSA patient CSF."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7C1D",
      "evidence_id": "EV-PDB-7C1D-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.8
      },
      "provenance": {
        "deposit_id": "7C1D",
        "doi": "10.1073/pnas.2012435118",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7C1D"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of the hE46K cross-seeded hWT alpha-synuclein fibril"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7L7H",
      "evidence_id": "EV-PDB-7L7H-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 4.0
      },
      "provenance": {
        "deposit_id": "7L7H",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7L7H"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7NCG",
      "evidence_id": "EV-PDB-7NCG-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.43
      },
      "provenance": {
        "deposit_id": "7NCG",
        "doi": "10.1002/2211-5463.13110",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7NCG"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Type 2A alpha-synuclein filament seeded in vitro by filaments purified from Multiple Systems Atrophy Case 2"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7NCH",
      "evidence_id": "EV-PDB-7NCH-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.84
      },
      "provenance": {
        "deposit_id": "7NCH",
        "doi": "10.1002/2211-5463.13110",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7NCH"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Type 1B alpha-synuclein filament seeded in vitro by filaments purified from Multiple Systems Atrophy Case 1"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7NCJ",
      "evidence_id": "EV-PDB-7NCJ-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 4.23
      },
      "provenance": {
        "deposit_id": "7NCJ",
        "doi": "10.1002/2211-5463.13110",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7NCJ"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Type 2AB alpha-synuclein filament seeded in vitro by filaments purified from Multiple Systems Atrophy Case 1"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7NCK",
      "evidence_id": "EV-PDB-7NCK-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.18
      },
      "provenance": {
        "deposit_id": "7NCK",
        "doi": "10.1002/2211-5463.13110",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7NCK"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Type 3 alpha-synuclein filament seeded in vitro by filaments purified from Multiple Systems Atrophy Case 5"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7OZG",
      "evidence_id": "EV-PDB-7OZG-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.3
      },
      "provenance": {
        "deposit_id": "7OZG",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7OZG"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "PMCA-amplified alpha-synuclein fibril polymorph, Parkinson's Disease patient-derived seeds"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7OZH",
      "evidence_id": "EV-PDB-7OZH-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.02
      },
      "provenance": {
        "deposit_id": "7OZH",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7OZH"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "PMCA-amplified alpha-synuclein fibril polymorph, Multiple System Atrophy patient-derived seeds"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7UAK",
      "evidence_id": "EV-PDB-7UAK-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.38
      },
      "provenance": {
        "deposit_id": "7UAK",
        "doi": "10.1016/j.jbc.2023.104566",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7UAK"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Structure of recombinantly assembled A53E alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7V49",
      "evidence_id": "EV-PDB-7V49-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.4
      },
      "provenance": {
        "deposit_id": "7V49",
        "doi": "10.1016/j.str.2022.11.013",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7V49"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Type 4 alpha-synuclein fibril seeded by cerebrospinal fluid from a postmortal Parkinson's disease patient"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7V4A",
      "evidence_id": "EV-PDB-7V4A-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.2
      },
      "provenance": {
        "deposit_id": "7V4A",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7V4A"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Heparin-induced alpha-synuclein fibrils polymorph 1"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7V4B",
      "evidence_id": "EV-PDB-7V4B-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.1
      },
      "provenance": {
        "deposit_id": "7V4B",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7V4B"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Heparin-induced alpha-synuclein fibrils polymorph 3"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7V4C",
      "evidence_id": "EV-PDB-7V4C-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.3
      },
      "provenance": {
        "deposit_id": "7V4C",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7V4C"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Heparin-induced alpha-synuclein fibrils polymorph 4"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7V4D",
      "evidence_id": "EV-PDB-7V4D-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.5
      },
      "provenance": {
        "deposit_id": "7V4D",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7V4D"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Heparin-remodelled alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7WNZ",
      "evidence_id": "EV-PDB-7WNZ-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.4
      },
      "provenance": {
        "deposit_id": "7WNZ",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7WNZ"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "CryoEM structure of human alpha-synuclein A53T fibril"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,O,P,Q,R,S,T,U)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7WO0",
      "evidence_id": "EV-PDB-7WO0-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.7
      },
      "provenance": {
        "deposit_id": "7WO0",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7WO0"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "CryoEM structure of human alpha-synuclein A53T fibril induced by calcium ions"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7XJX",
      "evidence_id": "EV-PDB-7XJX-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.7
      },
      "provenance": {
        "deposit_id": "7XJX",
        "doi": "10.1016/j.jmb.2022.167680",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7XJX"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of Fe3+ induced alpha-syn fibril."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7XO0",
      "evidence_id": "EV-PDB-7XO0-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.0
      },
      "provenance": {
        "deposit_id": "7XO0",
        "doi": "10.1016/j.str.2022.11.013",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7XO0"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Minor polymorph inalpha-synuclein fibril seeded by cerebrospinal fluid from a mid-to-late stage (mid-PD-1) Parkinson's disease patient"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7XO1",
      "evidence_id": "EV-PDB-7XO1-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.0
      },
      "provenance": {
        "deposit_id": "7XO1",
        "doi": "10.1016/j.str.2022.11.013",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7XO1"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Major polymorph in alpha-synuclein fibril seeded by cerebrospinal fluid from a mid-to-late stage (mid-PD-1) Parkinson's disease patient"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,I)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7XO2",
      "evidence_id": "EV-PDB-7XO2-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.0
      },
      "provenance": {
        "deposit_id": "7XO2",
        "doi": "10.1016/j.str.2022.11.013",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7XO2"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Minor polymorph in alpha-synuclein fibril seeded by cerebrospinal fluid from a mid-to-late stage (mid-PD-4) Parkinson's disease patient"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7XO3",
      "evidence_id": "EV-PDB-7XO3-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.6
      },
      "provenance": {
        "deposit_id": "7XO3",
        "doi": "10.1016/j.str.2022.11.013",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7XO3"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Type 1C alpha-synuclein fibril seeded by cerebrospinal fluid from a mid-to-late stage (mid-PD-4) Parkinson's disease patient"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7YK8",
      "evidence_id": "EV-PDB-7YK8-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.8
      },
      "provenance": {
        "deposit_id": "7YK8",
        "doi": "10.1021/jacs.2c10854",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7YK8"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of dLAG3-alpha-syn fibril"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "V79"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7YNF",
      "evidence_id": "EV-PDB-7YNF-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.5
      },
      "provenance": {
        "deposit_id": "7YNF",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7YNF"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "CCA-bound alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7YNG",
      "evidence_id": "EV-PDB-7YNG-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.1
      },
      "provenance": {
        "deposit_id": "7YNG",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7YNG"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "CR-bound alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "IZ8"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7YNL",
      "evidence_id": "EV-PDB-7YNL-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.6
      },
      "provenance": {
        "deposit_id": "7YNL",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7YNL"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "EB-bound alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "TFX"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7YNM",
      "evidence_id": "EV-PDB-7YNM-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.9
      },
      "provenance": {
        "deposit_id": "7YNM",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7YNM"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "ThT-bound alpha-synuclein fibrils conformation 1"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "TFX"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7YNN",
      "evidence_id": "EV-PDB-7YNN-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.9
      },
      "provenance": {
        "deposit_id": "7YNN",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7YNN"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "ThT-bound alpha-synuclein fibrils conformation 2"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "IZV"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7YNO",
      "evidence_id": "EV-PDB-7YNO-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.8
      },
      "provenance": {
        "deposit_id": "7YNO",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7YNO"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "PiB-bound alpha-synuclein fibrils conformation 1"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "IZM"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7YNP",
      "evidence_id": "EV-PDB-7YNP-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.8
      },
      "provenance": {
        "deposit_id": "7YNP",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7YNP"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "BF227-bound alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7YNR",
      "evidence_id": "EV-PDB-7YNR-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.9
      },
      "provenance": {
        "deposit_id": "7YNR",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7YNR"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "C05-03-bound alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7YNS",
      "evidence_id": "EV-PDB-7YNS-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.0
      },
      "provenance": {
        "deposit_id": "7YNS",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7YNS"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "SIL5-bound alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7YNT",
      "evidence_id": "EV-PDB-7YNT-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.1
      },
      "provenance": {
        "deposit_id": "7YNT",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7YNT"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "pFTAA-bound alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L,M,O,P)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8A4L",
      "evidence_id": "EV-PDB-8A4L-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.68
      },
      "provenance": {
        "deposit_id": "8A4L",
        "doi": "10.1038/s41467-022-34552-7",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8A4L"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Lipidic alpha-synuclein fibril - polymorph L2A"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8A9L",
      "evidence_id": "EV-PDB-8A9L-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.2
      },
      "provenance": {
        "deposit_id": "8A9L",
        "doi": "10.1038/s41586-022-05319-3",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8A9L"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of alpha-synuclein filaments from Parkinson's disease and dementia with Lewy bodies"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8ADS",
      "evidence_id": "EV-PDB-8ADS-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.05
      },
      "provenance": {
        "deposit_id": "8ADS",
        "doi": "10.1038/s41467-022-34552-7",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8ADS"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Lipidic alpha-synuclein fibril - polymorph L2B"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8ADU",
      "evidence_id": "EV-PDB-8ADU-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.24
      },
      "provenance": {
        "deposit_id": "8ADU",
        "doi": "10.1038/s41467-022-34552-7",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8ADU"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Lipidic alpha-synuclein fibril - polymorph L1A"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8ADV",
      "evidence_id": "EV-PDB-8ADV-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.98
      },
      "provenance": {
        "deposit_id": "8ADV",
        "doi": "10.1038/s41467-022-34552-7",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8ADV"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Lipidic alpha-synuclein fibril - polymorph L1B"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "ZN"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.0,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Alpha-synuclein 110-120 (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8B9V",
      "evidence_id": "EV-PDB-8B9V-3",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.16
      },
      "provenance": {
        "deposit_id": "8B9V",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8B9V"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of Lu AF82422 in complex with alpha-synuclein 110-120"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8AEX",
      "evidence_id": "EV-PDB-8AEX-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.76
      },
      "provenance": {
        "deposit_id": "8AEX",
        "doi": "10.1038/s41467-022-34552-7",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8AEX"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Lipidic alpha-synuclein fibril - polymorph L3A"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8ADW",
      "evidence_id": "EV-PDB-8ADW-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.95
      },
      "provenance": {
        "deposit_id": "8ADW",
        "doi": "10.1038/s41467-022-34552-7",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8ADW"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Lipidic alpha-synuclein fibril - polymorph L1C"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "IZV"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7YNQ",
      "evidence_id": "EV-PDB-7YNQ-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.8
      },
      "provenance": {
        "deposit_id": "7YNQ",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7YNQ"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "PiB-bound alpha-synuclein fibrils conformation 2"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7YK2",
      "evidence_id": "EV-PDB-7YK2-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.8
      },
      "provenance": {
        "deposit_id": "7YK2",
        "doi": "10.1021/jacs.2c10854",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7YK2"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of Apo-alpha-syn fibril"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "1KI"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7WMM",
      "evidence_id": "EV-PDB-7WMM-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.6
      },
      "provenance": {
        "deposit_id": "7WMM",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7WMM"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "alpha-synuclein fibril-F0502B complex"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7V48",
      "evidence_id": "EV-PDB-7V48-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.0
      },
      "provenance": {
        "deposit_id": "7V48",
        "doi": "10.1016/j.str.2022.11.013",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7V48"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Type 1D alpha-synuclein fibril seeded by cerebrospinal fluid from a postmortal Parkinson's disease patient"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7V47",
      "evidence_id": "EV-PDB-7V47-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.8
      },
      "provenance": {
        "deposit_id": "7V47",
        "doi": "10.1016/j.str.2022.11.013",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7V47"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Type 1A alpha-synuclein fibril seeded by cerebrospinal fluid from a preclinical Parkinson's disease patient"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "COA"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains C)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7STX",
      "evidence_id": "EV-PDB-7STX-3",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.14
      },
      "provenance": {
        "deposit_id": "7STX",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7STX"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of human NatB in complex with CoA-Alpha-Synuclein"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7NCI",
      "evidence_id": "EV-PDB-7NCI-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.55
      },
      "provenance": {
        "deposit_id": "7NCI",
        "doi": "10.1002/2211-5463.13110",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7NCI"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Type 2B alpha-synuclein filament seeded in vitro by filaments purified from Multiple Systems Atrophy Case 1"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7NCA",
      "evidence_id": "EV-PDB-7NCA-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.47
      },
      "provenance": {
        "deposit_id": "7NCA",
        "doi": "10.1002/2211-5463.13110",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7NCA"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Type 1A alpha-synuclein filament seeded in vitro by filaments purified from Multiple Systems Atrophy Case 2"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7LC9",
      "evidence_id": "EV-PDB-7LC9-1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.2
      },
      "provenance": {
        "deposit_id": "7LC9",
        "doi": "10.1073/pnas.2023487118",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7LC9"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of the N-terminal alpha-synuclein truncation 41-140"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7E0F",
      "evidence_id": "EV-PDB-7E0F-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.02
      },
      "provenance": {
        "deposit_id": "7E0F",
        "doi": "10.1038/s41467-021-26433-2",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7E0F"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "CryoEM structure of G51D alpha-synuclein amyloid fibril"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,C)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8CE7",
      "evidence_id": "EV-PDB-8CE7-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.7
      },
      "provenance": {
        "deposit_id": "8CE7",
        "doi": "10.1007/s00401-023-02550-8",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8CE7"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Type1 alpha-synuclein filament assembled in vitro by wild-type and mutant (7 residues insertion) protein"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8Y2P",
      "evidence_id": "EV-PDB-8Y2P-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.2
      },
      "provenance": {
        "deposit_id": "8Y2P",
        "doi": "10.1016/j.jbc.2024.107862",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8Y2P"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of a-synuclein fibril in Tris buffer."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "KDH"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8XWD",
      "evidence_id": "EV-PDB-8XWD-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.1
      },
      "provenance": {
        "deposit_id": "8XWD",
        "doi": "10.1002/advs.202416721",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8XWD"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Croy-EM structure of alpha synuclein fibril with EGCG"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "Y9W"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8X7R",
      "evidence_id": "EV-PDB-8X7R-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.0
      },
      "provenance": {
        "deposit_id": "8X7R",
        "doi": "10.1073/pnas.2321633121",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8X7R"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "C05-03-bound E46K alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "3LS"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8X7Q",
      "evidence_id": "EV-PDB-8X7Q-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.7
      },
      "provenance": {
        "deposit_id": "8X7Q",
        "doi": "10.1073/pnas.2321633121",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8X7Q"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "pFTAA-bound E46K alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "V79"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8X7P",
      "evidence_id": "EV-PDB-8X7P-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.7
      },
      "provenance": {
        "deposit_id": "8X7P",
        "doi": "10.1073/pnas.2321633121",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8X7P"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "CCA-bound E46K alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "IZV"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8X7O",
      "evidence_id": "EV-PDB-8X7O-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.5
      },
      "provenance": {
        "deposit_id": "8X7O",
        "doi": "10.1073/pnas.2321633121",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8X7O"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "PiB-bound E46K mutanted alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "59P"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8X7M",
      "evidence_id": "EV-PDB-8X7M-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.0
      },
      "provenance": {
        "deposit_id": "8X7M",
        "doi": "10.1073/pnas.2321633121",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8X7M"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "CR-bound E46K alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "IZ8"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8X7L",
      "evidence_id": "EV-PDB-8X7L-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.4
      },
      "provenance": {
        "deposit_id": "8X7L",
        "doi": "10.1073/pnas.2321633121",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8X7L"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "EB-bound E46K alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "TFX"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8X7B",
      "evidence_id": "EV-PDB-8X7B-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.0
      },
      "provenance": {
        "deposit_id": "8X7B",
        "doi": "10.1073/pnas.2321633121",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8X7B"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "ThT-bound E46K alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8RRR",
      "evidence_id": "EV-PDB-8RRR-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.4
      },
      "provenance": {
        "deposit_id": "8RRR",
        "doi": "10.1038/s42003-025-07906-2",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8RRR"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Alpha-synuclein amyloid fibril"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8RQM",
      "evidence_id": "EV-PDB-8RQM-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.2
      },
      "provenance": {
        "deposit_id": "8RQM",
        "doi": "10.1038/s42003-025-07906-2",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8RQM"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Alpha-synuclein amyloid fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8RI9",
      "evidence_id": "EV-PDB-8RI9-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.3
      },
      "provenance": {
        "deposit_id": "8RI9",
        "doi": "10.1021/jacs.3c14703",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8RI9"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Late alpha-Synuclein fibril structure from liquid-liquid phase separations."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8QPZ",
      "evidence_id": "EV-PDB-8QPZ-1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.5
      },
      "provenance": {
        "deposit_id": "8QPZ",
        "doi": "10.1073/pnas.2315006121",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8QPZ"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "CryoEM structure of recombinant DeltaN7 alpha-synuclein in PBS"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8PK4",
      "evidence_id": "EV-PDB-8PK4-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.3
      },
      "provenance": {
        "deposit_id": "8PK4",
        "doi": "10.7554/eLife.93562",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8PK4"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo EM structure of the type 5A polymorph of alpha-synuclein."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8PK2",
      "evidence_id": "EV-PDB-8PK2-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.26
      },
      "provenance": {
        "deposit_id": "8PK2",
        "doi": "10.7554/eLife.93562",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8PK2"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo EM structure of the type 1m polymorph of alpha-synuclein"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "CL"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8PJO",
      "evidence_id": "EV-PDB-8PJO-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.31
      },
      "provenance": {
        "deposit_id": "8PJO",
        "doi": "10.7554/eLife.93562",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8PJO"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo EM structure of the type 3D polymorph of alpha-synuclein E46K mutant at low pH."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8PIX",
      "evidence_id": "EV-PDB-8PIX-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.41
      },
      "provenance": {
        "deposit_id": "8PIX",
        "doi": "10.7554/eLife.93562",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8PIX"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo EM structure of the type 3C polymorph of alpha-synuclein at low pH."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8OQI",
      "evidence_id": "EV-PDB-8OQI-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.1
      },
      "provenance": {
        "deposit_id": "8OQI",
        "doi": "10.1093/brain/awae061",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8OQI"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of the wild-type alpha-synuclein fibril."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 6.5,
        "salt_mM": null,
        "temperature_c": 24.85
      },
      "construct": {
        "description": "ACE-ASP-VAL-PHE-MET-LYS-LYS-LEU-SER-LYS-ASP-LYS-NH2 (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + NMR restraints",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8OL8",
      "evidence_id": "EV-PDB-8OL8-1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "8OL8",
        "doi": "10.1021/jacsau.5c00694",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8OL8"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_structure",
      "title": "Solution NMR Structure of Lactamised Alpha-Synuclein 2-12 Peptide in 50% TFE."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 6.5,
        "salt_mM": null,
        "temperature_c": 24.85
      },
      "construct": {
        "description": "Alpha-synuclein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + NMR restraints",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8OJR",
      "evidence_id": "EV-PDB-8OJR-1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "8OJR",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8OJR"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_structure",
      "title": "Solution NMR Structure of Alpha-Synuclein 1-25 Peptide in 50% TFE."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 5.0,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Alpha-synuclein (chains P)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8OG0",
      "evidence_id": "EV-PDB-8OG0-3",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.712
      },
      "provenance": {
        "deposit_id": "8OG0",
        "doi": "10.1038/s41531-024-00822-y",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8OG0"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of MJF14-6-4-2 Fab fragment in complex with epitope peptide"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "GOL"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "alpha-synuclein peptide (chains B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8JLY",
      "evidence_id": "EV-PDB-8JLY-2",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.29
      },
      "provenance": {
        "deposit_id": "8JLY",
        "doi": "10.1002/pro.4875",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8JLY"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of nanobody in complex with alpha-synuclein peptide"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "GOL"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Alpha-synuclein peptide (chains B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8JJV",
      "evidence_id": "EV-PDB-8JJV-2",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.23
      },
      "provenance": {
        "deposit_id": "8JJV",
        "doi": "10.1002/pro.4875",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8JJV"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of truncated form of nanobody in complex with alpha-synuclein peptide"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8JEY",
      "evidence_id": "EV-PDB-8JEY-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.6
      },
      "provenance": {
        "deposit_id": "8JEY",
        "doi": "10.1038/s41467-024-46898-1",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8JEY"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of alpha-synuclein pS87 fibril"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "NAG"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,G,H,K,P)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8JEX",
      "evidence_id": "EV-PDB-8JEX-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.1
      },
      "provenance": {
        "deposit_id": "8JEX",
        "doi": "10.1038/s41467-024-46898-1",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8JEX"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of alpha-synuclein gS87 fibril"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8HZS",
      "evidence_id": "EV-PDB-8HZS-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.3
      },
      "provenance": {
        "deposit_id": "8HZS",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8HZS"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Formed alpha-synuclein fibrils after incubation with heparin for 3 days (Hep-remod-3)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8HZC",
      "evidence_id": "EV-PDB-8HZC-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.2
      },
      "provenance": {
        "deposit_id": "8HZC",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8HZC"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Formed alpha-synuclein fibrils after incubation with heparin for 1 hour (Hep-remod-2)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8HZB",
      "evidence_id": "EV-PDB-8HZB-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.2
      },
      "provenance": {
        "deposit_id": "8HZB",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8HZB"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Formed alpha-synuclein fibrils after incubation with heparin for 1 hour (Hep-remod-1)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8H05",
      "evidence_id": "EV-PDB-8H05-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.4
      },
      "provenance": {
        "deposit_id": "8H05",
        "doi": "10.1016/j.str.2022.11.013",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8H05"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Minor polymorph in alpha-synuclein fibril seeded by cerebrospinal fluid from a postmortal Parkinson's disease patient"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8H04",
      "evidence_id": "EV-PDB-8H04-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.0
      },
      "provenance": {
        "deposit_id": "8H04",
        "doi": "10.1016/j.str.2022.11.013",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8H04"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Major polymorph in alpha-synuclein fibril seeded by cerebrospinal fluid from a postmortal Parkinson's disease patient"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8H03",
      "evidence_id": "EV-PDB-8H03-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.8
      },
      "provenance": {
        "deposit_id": "8H03",
        "doi": "10.1016/j.str.2022.11.013",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8H03"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Major polymorph in alpha-synuclein fibril seeded by cerebrospinal fluid from a preclinical Parkinson's disease patient"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "NAG"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8GF7",
      "evidence_id": "EV-PDB-8GF7-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 4.8
      },
      "provenance": {
        "deposit_id": "8GF7",
        "doi": "10.1038/s41589-024-01551-2",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8GF7"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of serine 87 O-GlcNAc-modified alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "CMC"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains C)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8G0L",
      "evidence_id": "EV-PDB-8G0L-3",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.39
      },
      "provenance": {
        "deposit_id": "8G0L",
        "doi": "10.1021/jacs.3c03887",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8G0L"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Semi-synthetic CoA-alpha-Synuclein Constructs Trap N-terminal Acetyltransferase NatB for Binding Mechanism Studies"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.6,
        "salt_mM": null,
        "temperature_c": -0.15
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + NMR restraints",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8FPT",
      "evidence_id": "EV-PDB-8FPT-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "8FPT",
        "doi": "10.1038/s41467-024-46832-5",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8FPT"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_structure",
      "title": "STRUCTURE OF ALPHA-SYNUCLEIN FIBRILS DERIVED FROM HUMAN LEWY BODY DEMENTIA TISSUE"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,I,J,K,L,M,N,O)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8CZ6",
      "evidence_id": "EV-PDB-8CZ6-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.2
      },
      "provenance": {
        "deposit_id": "8CZ6",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8CZ6"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "CryoEM structure of amplified alpha-synuclein fibril class A type I with extended core from DLB case X"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,I,J,K,L,M,N)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8CZ3",
      "evidence_id": "EV-PDB-8CZ3-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.2
      },
      "provenance": {
        "deposit_id": "8CZ3",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8CZ3"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "CryoEM structure of amplified alpha-synuclein fibril class B type I with extended core from DLB case X"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,I,J,K,L,M,N)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8CZ2",
      "evidence_id": "EV-PDB-8CZ2-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.0
      },
      "provenance": {
        "deposit_id": "8CZ2",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8CZ2"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "CryoEM structure of amplified alpha-synuclein fibril class A type I with extended core from DLB case VII"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,I,J,K,L,M,N)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8CZ1",
      "evidence_id": "EV-PDB-8CZ1-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.0
      },
      "provenance": {
        "deposit_id": "8CZ1",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8CZ1"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "CryoEM structure of amplified alpha-synuclein fibril class B type II with extended core from DLB case VII"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,I,J,K,L,M,N)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8CZ0",
      "evidence_id": "EV-PDB-8CZ0-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.9
      },
      "provenance": {
        "deposit_id": "8CZ0",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8CZ0"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "CryoEM structure of amplified alpha-synuclein fibril class B type I with extended core from DLB case VII"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,I,J,K,L,M,N)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8CYY",
      "evidence_id": "EV-PDB-8CYY-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.1
      },
      "provenance": {
        "deposit_id": "8CYY",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8CYY"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "CryoEM structure of amplified alpha-synuclein fibril class B mixed type I/II with extended core from DLB case V"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,I,J,K,L,M)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8CYX",
      "evidence_id": "EV-PDB-8CYX-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.0
      },
      "provenance": {
        "deposit_id": "8CYX",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8CYX"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "CryoEM structure of amplified alpha-synuclein fibril class A type I with compact core from DLB case III"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,I,J,K,L,M,N)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8CYW",
      "evidence_id": "EV-PDB-8CYW-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.1
      },
      "provenance": {
        "deposit_id": "8CYW",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8CYW"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "CryoEM structures of amplified alpha-synuclein fibril class B type I with compact core from DLB case III"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,I,J,K,L,M,N)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8CYV",
      "evidence_id": "EV-PDB-8CYV-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.5
      },
      "provenance": {
        "deposit_id": "8CYV",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8CYV"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "CryoEM structures of amplified alpha-synuclein fibril class B mixed type I/II with extended core from DLB case II"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,I,J,K,L,M,N,O)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8CYT",
      "evidence_id": "EV-PDB-8CYT-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.0
      },
      "provenance": {
        "deposit_id": "8CYT",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8CYT"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "CryoEM structures of amplified alpha-synuclein fibril class A type I with extended core from DLB case I"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,I,J,K,L,M,N,O)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8CYS",
      "evidence_id": "EV-PDB-8CYS-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.1
      },
      "provenance": {
        "deposit_id": "8CYS",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8CYS"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "CryoEM structures of amplified alpha-synuclein fibril class B type II with extended core from DLB case I"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,I,J,K,L,M,N)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8CYR",
      "evidence_id": "EV-PDB-8CYR-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 4.2
      },
      "provenance": {
        "deposit_id": "8CYR",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8CYR"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Alpha-synuclein fibril from spontaneous control"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,C)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8CEB",
      "evidence_id": "EV-PDB-8CEB-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.8
      },
      "provenance": {
        "deposit_id": "8CEB",
        "doi": "10.1007/s00401-023-02550-8",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8CEB"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Type2 alpha-synuclein filament assembled in vitro by wild-type and mutant (7 residues insertion) protein"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,C)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8BQW",
      "evidence_id": "EV-PDB-8BQW-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.3
      },
      "provenance": {
        "deposit_id": "8BQW",
        "doi": "10.1007/s00401-023-02550-8",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8BQW"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of alpha-synuclein filaments doublet from Juvenile-onset synucleinopathy"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8BQV",
      "evidence_id": "EV-PDB-8BQV-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.0
      },
      "provenance": {
        "deposit_id": "8BQV",
        "doi": "10.1007/s00401-023-02550-8",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8BQV"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of alpha-synuclein singlet filament from Juvenile-onset synucleinopathy"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8Y2Q",
      "evidence_id": "EV-PDB-8Y2Q-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.8
      },
      "provenance": {
        "deposit_id": "8Y2Q",
        "doi": "10.1016/j.jbc.2024.107862",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8Y2Q"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of spermine induced a-synuclein fibril in Tris buffer."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "A1L13"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,I,J,K,L)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8ZLI",
      "evidence_id": "EV-PDB-8ZLI-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.4
      },
      "provenance": {
        "deposit_id": "8ZLI",
        "doi": "10.1073/pnas.2321633121",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8ZLI"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "BTA-2-bound E46K alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "1KI"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,O,T)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8ZLO",
      "evidence_id": "EV-PDB-8ZLO-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.1
      },
      "provenance": {
        "deposit_id": "8ZLO",
        "doi": "10.1073/pnas.2321633121",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8ZLO"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "F0502B-bound E46K alpha-synuclein fibril"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,F,G,H)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8ZLP",
      "evidence_id": "EV-PDB-8ZLP-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.5
      },
      "provenance": {
        "deposit_id": "8ZLP",
        "doi": "10.1073/pnas.2321633121",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8ZLP"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "apo WT polymorph 5a alpha-synuclein fibril"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "CL"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.0,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Isoform 1 of Alpha-synuclein (chains C,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8ZVY",
      "evidence_id": "EV-PDB-8ZVY-2",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.72
      },
      "provenance": {
        "deposit_id": "8ZVY",
        "doi": "10.1038/s42003-025-08138-0",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8ZVY"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Alpha-Synuclein with H2a-H2b dimer complex structure."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8ZWH",
      "evidence_id": "EV-PDB-8ZWH-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.5
      },
      "provenance": {
        "deposit_id": "8ZWH",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8ZWH"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Heparin bound E46K alpha-synuclein fibril"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "alpha-synuclein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF/IHM",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9A1A",
      "evidence_id": "EV-PDB-9A1A-1",
      "mappings": [
        {
          "confidence": "medium",
          "justification": "Integrative ensemble of the monomer.",
          "rule": "as-integrative-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-integrative-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "9A1A",
        "doi": "10.1016/j.str.2021.05.002",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9A1A"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "integrative",
      "title": "The ensemble structure of alpha-synuclein monomer"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9C5R",
      "evidence_id": "EV-PDB-9C5R-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.61
      },
      "provenance": {
        "deposit_id": "9C5R",
        "doi": "10.1016/j.jbc.2025.108351",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9C5R"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Structure of recombinantly assembled alpha-synuclein variant fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9CD9",
      "evidence_id": "EV-PDB-9CD9-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.2
      },
      "provenance": {
        "deposit_id": "9CD9",
        "doi": "10.1002/1873-3468.15048",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9CD9"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Structure of type II-2 alpha-synuclein filament from multiple system atrophy"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,a,b)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9CDA",
      "evidence_id": "EV-PDB-9CDA-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.3
      },
      "provenance": {
        "deposit_id": "9CDA",
        "doi": "10.1002/1873-3468.15048",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9CDA"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Structure of type I-2 alpha-synuclein filament from multiple system atrophy"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9CK3",
      "evidence_id": "EV-PDB-9CK3-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.04
      },
      "provenance": {
        "deposit_id": "9CK3",
        "doi": "10.21769/BioProtoc.5171",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9CK3"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of in-vitro alpha-synuclein fibril"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains G,H)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9CX6",
      "evidence_id": "EV-PDB-9CX6-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.2
      },
      "provenance": {
        "deposit_id": "9CX6",
        "doi": "10.1111/nan.70013",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9CX6"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM filament structure in FTLD-synuclein"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "NAG"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,F,G,H)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9D5C",
      "evidence_id": "EV-PDB-9D5C-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 4.8
      },
      "provenance": {
        "deposit_id": "9D5C",
        "doi": "10.1038/s41589-024-01551-2",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9D5C"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of serine 87 O-GlcNAc-modified alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9E8U",
      "evidence_id": "EV-PDB-9E8U-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.6
      },
      "provenance": {
        "deposit_id": "9E8U",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9E8U"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "(Apo)Alpha-synuclein fibril structures from MSA patient brain"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "A1BGB"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9E8W",
      "evidence_id": "EV-PDB-9E8W-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.8
      },
      "provenance": {
        "deposit_id": "9E8W",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9E8W"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Complex fibril structure of MSA alpha-synuclein with CNS-11g at 6 hours"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9E9X",
      "evidence_id": "EV-PDB-9E9X-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.2
      },
      "provenance": {
        "deposit_id": "9E9X",
        "doi": "10.1038/s42003-025-08355-7",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9E9X"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of alpha-synuclein filaments derived from the temporal cortex of the case of atypical multiple system atrophy"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9EUU",
      "evidence_id": "EV-PDB-9EUU-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.93
      },
      "provenance": {
        "deposit_id": "9EUU",
        "doi": "10.1038/s41586-025-09698-1",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9EUU"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Structure of recombinant alpha-synuclein fibrils 1B capable of seeding GCIs in vivo"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9HC8",
      "evidence_id": "EV-PDB-9HC8-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.82
      },
      "provenance": {
        "deposit_id": "9HC8",
        "doi": "10.1101/2025.04.21.649837",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9HC8"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The L2C alpha-synuclein fibril in the presence of MODAG-005 (short incubation)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L,M,N,O)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9HCA",
      "evidence_id": "EV-PDB-9HCA-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.7
      },
      "provenance": {
        "deposit_id": "9HCA",
        "doi": "10.1101/2025.04.21.649837",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9HCA"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The L2A-II alpha-synuclein fibril in the presence of MODAG-005 (long incubation)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9HCB",
      "evidence_id": "EV-PDB-9HCB-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.95
      },
      "provenance": {
        "deposit_id": "9HCB",
        "doi": "10.1101/2025.04.21.649837",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9HCB"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The L2C alpha-synuclein fibril in the presence of MODAG-005 (long incubation)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9HGR",
      "evidence_id": "EV-PDB-9HGR-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.7
      },
      "provenance": {
        "deposit_id": "9HGR",
        "doi": "10.1186/s13024-025-00889-y",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9HGR"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "In vitro grown WT Alpha-Synuclein Fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains C)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9HGS",
      "evidence_id": "EV-PDB-9HGS-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.0
      },
      "provenance": {
        "deposit_id": "9HGS",
        "doi": "10.1002/mds.70030",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9HGS"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "In vitro grown G14R Alpha-Synuclein Fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,C)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9HXA",
      "evidence_id": "EV-PDB-9HXA-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.7
      },
      "provenance": {
        "deposit_id": "9HXA",
        "doi": "10.1002/mds.70030",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9HXA"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "In vitro grown K58N Alpha-Synuclein Fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "7TT"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains B,C,E,G,I,L)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9IJP",
      "evidence_id": "EV-PDB-9IJP-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.1
      },
      "provenance": {
        "deposit_id": "9IJP",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9IJP"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Polyphosphate bound alpha-synuclein fibril"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains D,E,F,G,H,I)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9JC3",
      "evidence_id": "EV-PDB-9JC3-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.39
      },
      "provenance": {
        "deposit_id": "9JC3",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9JC3"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of Ac-G51DA53T P1 a-syn fibril."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9JC5",
      "evidence_id": "EV-PDB-9JC5-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.23
      },
      "provenance": {
        "deposit_id": "9JC5",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9JC5"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of Ac-G51DA53T P3 a-syn fibril."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9JD7",
      "evidence_id": "EV-PDB-9JD7-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.57
      },
      "provenance": {
        "deposit_id": "9JD7",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9JD7"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of Ac-G51DA53T a-syn fibril."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9JDK",
      "evidence_id": "EV-PDB-9JDK-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.32
      },
      "provenance": {
        "deposit_id": "9JDK",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9JDK"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of Ac-G51DA53T P6 a-syn fibril."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains C,D,E,F,G,H)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9JE2",
      "evidence_id": "EV-PDB-9JE2-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.06
      },
      "provenance": {
        "deposit_id": "9JE2",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9JE2"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of Ac-K58N_G51DA53T a-syn fibril."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9JE4",
      "evidence_id": "EV-PDB-9JE4-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.37
      },
      "provenance": {
        "deposit_id": "9JE4",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9JE4"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of Ac-E57A_G51DA53T a-syn fibril."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9JE6",
      "evidence_id": "EV-PDB-9JE6-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.43
      },
      "provenance": {
        "deposit_id": "9JE6",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9JE6"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of Ac-G51DA53T low salt a-syn fibril."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9JD8",
      "evidence_id": "EV-PDB-9JD8-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.86
      },
      "provenance": {
        "deposit_id": "9JD8",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9JD8"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of Ac-G51DA53T P5 a-syn fibril."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains B,C,D,F,G,H)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9JC4",
      "evidence_id": "EV-PDB-9JC4-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.95
      },
      "provenance": {
        "deposit_id": "9JC4",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9JC4"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of Ac-G51DA53T P2 a-syn fibril."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9JBY",
      "evidence_id": "EV-PDB-9JBY-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.49
      },
      "provenance": {
        "deposit_id": "9JBY",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9JBY"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of Ac-K58W_G51DA53T a-syn fibril."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains a,b,c,d,e,f,g,h,i,j,k,l,m,n)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9IC7",
      "evidence_id": "EV-PDB-9IC7-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.9
      },
      "provenance": {
        "deposit_id": "9IC7",
        "doi": "10.1002/advs.202505228",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9IC7"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of alpha-synuclein fibrils formed in artificial cerebrospinal fluid (aCSF)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L,M,N,O)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9HC9",
      "evidence_id": "EV-PDB-9HC9-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.76
      },
      "provenance": {
        "deposit_id": "9HC9",
        "doi": "10.1101/2025.04.21.649837",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9HC9"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The L2A-I alpha-synuclein fibril in the presence of MODAG-005 (long incubation)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L,M,N,O)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9HC7",
      "evidence_id": "EV-PDB-9HC7-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.85
      },
      "provenance": {
        "deposit_id": "9HC7",
        "doi": "10.1101/2025.04.21.649837",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9HC7"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The L2A-II alpha-synuclein fibril in the presence of MODAG-005 (short incubation)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L,M,N,O)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9HC6",
      "evidence_id": "EV-PDB-9HC6-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.79
      },
      "provenance": {
        "deposit_id": "9HC6",
        "doi": "10.1101/2025.04.21.649837",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9HC6"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The L2A-I alpha-synuclein fibril in the presence of MODAG-005 (short incubation)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "CL"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains I,J,K,L,M,N,O,P,Q,R)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9FYP",
      "evidence_id": "EV-PDB-9FYP-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.23
      },
      "provenance": {
        "deposit_id": "9FYP",
        "doi": "10.7554/eLife.93562",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9FYP"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo EM structure of the type 3B polymorph of alpha-synuclein at low pH."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "A1BGB"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9E8Y",
      "evidence_id": "EV-PDB-9E8Y-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.9
      },
      "provenance": {
        "deposit_id": "9E8Y",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9E8Y"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Complex fibril structure of MSA alpha-synuclein with CNS-11g at 15 hours"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "A1BGB"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9E8X",
      "evidence_id": "EV-PDB-9E8X-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.8
      },
      "provenance": {
        "deposit_id": "9E8X",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9E8X"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Complex fibril structure of MSA alpha-synuclein with CNS-11g at 10 hours"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "A1BGB"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9E8V",
      "evidence_id": "EV-PDB-9E8V-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.0
      },
      "provenance": {
        "deposit_id": "9E8V",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9E8V"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Complex fibril structure of MSA alpha-synuclein with CNS-11g at 4 hours"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9CKL",
      "evidence_id": "EV-PDB-9CKL-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.68
      },
      "provenance": {
        "deposit_id": "9CKL",
        "doi": "10.1101/2024.09.09.612142",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9CKL"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of acetylated alpha-synuclein A53T fibril - polymorph B"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9CKK",
      "evidence_id": "EV-PDB-9CKK-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.21
      },
      "provenance": {
        "deposit_id": "9CKK",
        "doi": "10.1101/2024.09.09.612142",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9CKK"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of acetylated alpha-synuclein A53T fibril - polymorph A"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "alpha-synuclein (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF/IHM",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9A1Q",
      "evidence_id": "EV-PDB-9A1Q-1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "9A1Q",
        "doi": "10.1016/j.str.2023.01.011",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9A1Q"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "integrative",
      "title": "The structural models of alpha-synuclein dimer"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "alpha-synuclein (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF/IHM",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9A1H",
      "evidence_id": "EV-PDB-9A1H-1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "9A1H",
        "doi": "10.1073/pnas.2201910120",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9A1H"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "integrative",
      "title": "Integrative structural model of alpha-synuclein compact states bound to membrane mimics"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8ZWK",
      "evidence_id": "EV-PDB-8ZWK-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.4
      },
      "provenance": {
        "deposit_id": "8ZWK",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8ZWK"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Polyadenylic acid bound alpha-synuclein fibril Polymorph 2"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,G)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8ZWJ",
      "evidence_id": "EV-PDB-8ZWJ-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.1
      },
      "provenance": {
        "deposit_id": "8ZWJ",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8ZWJ"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Polyadenylic acid bound alpha-synuclein fibril Polymorph 1"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8ZWI",
      "evidence_id": "EV-PDB-8ZWI-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.0
      },
      "provenance": {
        "deposit_id": "8ZWI",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8ZWI"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Chondroitin sulfate bound alpha-synuclein fibril"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "1KI"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8ZMY",
      "evidence_id": "EV-PDB-8ZMY-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.9
      },
      "provenance": {
        "deposit_id": "8ZMY",
        "doi": "10.1073/pnas.2321633121",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8ZMY"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "F0502B-bound WT polymorph 5a alpha-synuclein fibril"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains F,G,K,L,M,O)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9JI8",
      "evidence_id": "EV-PDB-9JI8-2",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.85
      },
      "provenance": {
        "deposit_id": "9JI8",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9JI8"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of alpha-synuclein-H21 fibril"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Alpha-synuclein (chains M)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9K7Q",
      "evidence_id": "EV-PDB-9K7Q-2",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 4.58
      },
      "provenance": {
        "deposit_id": "9K7Q",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9K7Q"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Parkinson disease protein 7 (DJ-1) and Alpha-synuclein (Alpha-syn) complex"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9KA4",
      "evidence_id": "EV-PDB-9KA4-1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.42
      },
      "provenance": {
        "deposit_id": "9KA4",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9KA4"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of MSA-like fold (P1) formed under the palette stratagy."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "A1EFL"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains L,M,N,P,Q,R,d,e,f,h,i,j)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9KCN",
      "evidence_id": "EV-PDB-9KCN-2",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.6
      },
      "provenance": {
        "deposit_id": "9KCN",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9KCN"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of FD4-bound alpha-synuclein fibril polymorph 6A6B"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "A1B9H"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9O4B",
      "evidence_id": "EV-PDB-9O4B-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.59
      },
      "provenance": {
        "deposit_id": "9O4B",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9O4B"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of in-vitro alpha-synuclein fibril bound with Exemplar-6 PET-radioligand"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9OBP",
      "evidence_id": "EV-PDB-9OBP-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.5
      },
      "provenance": {
        "deposit_id": "9OBP",
        "doi": "10.1038/s42003-025-08355-7",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9OBP"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of alpha-synuclein filaments derived from the frontal cortex of the case of atypical multiple system atrophy"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains G,H,I,J,K,L,M,N,O,P)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9QYN",
      "evidence_id": "EV-PDB-9QYN-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.13
      },
      "provenance": {
        "deposit_id": "9QYN",
        "doi": "10.1002/advs.202508441",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9QYN"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Alpha-synuclein K21A fibril type 1A polymorph in the presence of ATP"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9RBB",
      "evidence_id": "EV-PDB-9RBB-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.15
      },
      "provenance": {
        "deposit_id": "9RBB",
        "doi": "10.1016/j.neuron.2026.01.014",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9RBB"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Wild-type alpha-synuclein fibril - Type 5"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,H,I,J,L,M,N)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9TPT",
      "evidence_id": "EV-PDB-9TPT-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.43
      },
      "provenance": {
        "deposit_id": "9TPT",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9TPT"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Structure of recombinantly assembled E83Q alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "A1EO6"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9UFF",
      "evidence_id": "EV-PDB-9UFF-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.6
      },
      "provenance": {
        "deposit_id": "9UFF",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9UFF"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of BA21-bound alpha-synuclein fibril polymorph 6A6B"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains O,P,Q,U,V,W)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9W09",
      "evidence_id": "EV-PDB-9W09-2",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.1
      },
      "provenance": {
        "deposit_id": "9W09",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9W09"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of 30-140 P2 a-syn fibril."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains D,E,F,G,H,I)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9W08",
      "evidence_id": "EV-PDB-9W08-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.87
      },
      "provenance": {
        "deposit_id": "9W08",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9W08"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of 30-140 P1 a-syn fibril."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains C,D,E,F,G,H)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9W07",
      "evidence_id": "EV-PDB-9W07-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.03
      },
      "provenance": {
        "deposit_id": "9W07",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9W07"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of Ac-Y39EK45GK58G 30-140 a-syn fibril."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9W06",
      "evidence_id": "EV-PDB-9W06-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.6
      },
      "provenance": {
        "deposit_id": "9W06",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9W06"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of Y39EE83G a-syn fibril."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "A1EFL"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains c,d,e,f,g,h,i,j,k,o,p,q,r,s,t)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9V7C",
      "evidence_id": "EV-PDB-9V7C-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.3
      },
      "provenance": {
        "deposit_id": "9V7C",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9V7C"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of FD4_orientation2 bound Lewy fold fibril."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "A1EFL"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains c,d,e,f,g,h,i,j,k,o,p,q,r,s,t)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9V6U",
      "evidence_id": "EV-PDB-9V6U-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.3
      },
      "provenance": {
        "deposit_id": "9V6U",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9V6U"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of FD4 bound Lewy fold fibril."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9UJQ",
      "evidence_id": "EV-PDB-9UJQ-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.9
      },
      "provenance": {
        "deposit_id": "9UJQ",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9UJQ"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of HQY1027-bound alpha-synuclein fibril polymorph 6A6B"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "A1EPB"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9UG1",
      "evidence_id": "EV-PDB-9UG1-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.6
      },
      "provenance": {
        "deposit_id": "9UG1",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9UG1"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of HA32-bound alpha-synuclein fibril polymorph 6A6B"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "A1EPK"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9UG0",
      "evidence_id": "EV-PDB-9UG0-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.1
      },
      "provenance": {
        "deposit_id": "9UG0",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9UG0"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of HA31-bound alpha-synuclein fibril polymorph 6A6B"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "GO3"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9UFY",
      "evidence_id": "EV-PDB-9UFY-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.2
      },
      "provenance": {
        "deposit_id": "9UFY",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9UFY"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of HA21-bound alpha-synuclein fibril polymorph 6A6B"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "A1EPA"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9UFX",
      "evidence_id": "EV-PDB-9UFX-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.6
      },
      "provenance": {
        "deposit_id": "9UFX",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9UFX"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of HA11-bound alpha-synuclein fibril polymorph 6A6B"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9UFS",
      "evidence_id": "EV-PDB-9UFS-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.7
      },
      "provenance": {
        "deposit_id": "9UFS",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9UFS"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of BA23-bound alpha-synuclein fibril polymorph 6A6B"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9UFL",
      "evidence_id": "EV-PDB-9UFL-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.6
      },
      "provenance": {
        "deposit_id": "9UFL",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9UFL"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of BA22-bound alpha-synuclein fibril polymorph 6A6B"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "A1EO8"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains E,F,G,H,I,J,K,L,M,N,O,P)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9UFD",
      "evidence_id": "EV-PDB-9UFD-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.7
      },
      "provenance": {
        "deposit_id": "9UFD",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9UFD"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of BA12-bound alpha-synuclein fibril polymorph 6A6B"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "A1EO7"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains E,F,G,H,I,J,K,L,M,N,O,P)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9UF6",
      "evidence_id": "EV-PDB-9UF6-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.9
      },
      "provenance": {
        "deposit_id": "9UF6",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9UF6"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of BA1-1-bound alpha-synuclein fibril polymorph 6A6B"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9RBA",
      "evidence_id": "EV-PDB-9RBA-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.54
      },
      "provenance": {
        "deposit_id": "9RBA",
        "doi": "10.1016/j.neuron.2026.01.014",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9RBA"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Wild-type alpha-synuclein fibril - Type 4"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9RB9",
      "evidence_id": "EV-PDB-9RB9-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.04
      },
      "provenance": {
        "deposit_id": "9RB9",
        "doi": "10.1016/j.neuron.2026.01.014",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9RB9"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Wild-type alpha-synuclein fibril - Type 3-2"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9RB8",
      "evidence_id": "EV-PDB-9RB8-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.64
      },
      "provenance": {
        "deposit_id": "9RB8",
        "doi": "10.1016/j.neuron.2026.01.014",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9RB8"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Wild-type alpha-synuclein fibril - Type 3-1"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9RB7",
      "evidence_id": "EV-PDB-9RB7-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.45
      },
      "provenance": {
        "deposit_id": "9RB7",
        "doi": "10.1016/j.neuron.2026.01.014",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9RB7"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Wild-type alpha-synuclein fibril - Type 1"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9RB6",
      "evidence_id": "EV-PDB-9RB6-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.02
      },
      "provenance": {
        "deposit_id": "9RB6",
        "doi": "10.1016/j.neuron.2026.01.014",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9RB6"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "A53T alpha-synuclein fibril - Type 2"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9RB3",
      "evidence_id": "EV-PDB-9RB3-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.4
      },
      "provenance": {
        "deposit_id": "9RB3",
        "doi": "10.1016/j.neuron.2026.01.014",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9RB3"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "A53T alpha-synuclein fibril - Type 1"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains E,F,G,H,J,K,L,M,N,O,P,Q,e,f,g,h,j,k,l,m,n,o,p,q)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9QYL",
      "evidence_id": "EV-PDB-9QYL-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.08
      },
      "provenance": {
        "deposit_id": "9QYL",
        "doi": "10.1002/advs.202508441",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9QYL"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Alpha-synuclein fibril type 1A polymorph in the presence of ATP"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9PTC",
      "evidence_id": "EV-PDB-9PTC-1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.0
      },
      "provenance": {
        "deposit_id": "9PTC",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9PTC"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Alpha-synuclein acetylated lysine 80 A"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9PTB",
      "evidence_id": "EV-PDB-9PTB-1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.94
      },
      "provenance": {
        "deposit_id": "9PTB",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9PTB"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Alpha-synuclein acetylated lysine 80 B"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9PTA",
      "evidence_id": "EV-PDB-9PTA-1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.0
      },
      "provenance": {
        "deposit_id": "9PTA",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9PTA"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Alpha-synuclein A"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9PT9",
      "evidence_id": "EV-PDB-9PT9-1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.06
      },
      "provenance": {
        "deposit_id": "9PT9",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9PT9"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Alpha-synuclein B"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J,K,L)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9PT8",
      "evidence_id": "EV-PDB-9PT8-1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.0
      },
      "provenance": {
        "deposit_id": "9PT8",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9PT8"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Alpha-synuclein acetylated lysine 80"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9O9K",
      "evidence_id": "EV-PDB-9O9K-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.9
      },
      "provenance": {
        "deposit_id": "9O9K",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9O9K"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of alpha-synuclein filaments from Parkinson's disease with H50Q variant in SNCA"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,D)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9O9J",
      "evidence_id": "EV-PDB-9O9J-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.3
      },
      "provenance": {
        "deposit_id": "9O9J",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9O9J"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of alpha-synuclein filaments from Parkinson's disease with G51D mutaion in SNCA"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9M5L",
      "evidence_id": "EV-PDB-9M5L-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.27
      },
      "provenance": {
        "deposit_id": "9M5L",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9M5L"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of in situ amplified (ISA) alpha-synuclein fibrils from DLB homogenate"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9M5K",
      "evidence_id": "EV-PDB-9M5K-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.1
      },
      "provenance": {
        "deposit_id": "9M5K",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9M5K"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of in situ amplified (ISA) alpha-synuclein fibrils from PD homogenate"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains D,E,F,G,H,I)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9KCP",
      "evidence_id": "EV-PDB-9KCP-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.7
      },
      "provenance": {
        "deposit_id": "9KCP",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9KCP"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of ACI-12589-bound alpha-synuclein fibril polymorph 6A6B"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "A1EFL"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains F,G,H,I,J,K,L,M,N,O,P,Q)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9KCO",
      "evidence_id": "EV-PDB-9KCO-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.1
      },
      "provenance": {
        "deposit_id": "9KCO",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9KCO"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of FD4-bound alpha-synuclein MSA-like fibril"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "A1EFK"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains C,D,E,F,G,H)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9KC2",
      "evidence_id": "EV-PDB-9KC2-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.9
      },
      "provenance": {
        "deposit_id": "9KC2",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9KC2"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of ZSQ07-bound alpha-synuclein fibril polymorph 6A6B"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9KAL",
      "evidence_id": "EV-PDB-9KAL-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.36
      },
      "provenance": {
        "deposit_id": "9KAL",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9KAL"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of Ac-E57A_G51DA53T a-syn fibril."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9KA3",
      "evidence_id": "EV-PDB-9KA3-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.72
      },
      "provenance": {
        "deposit_id": "9KA3",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9KA3"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of Ac-K58D_G51DA53T a-syn fibril."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.5,
        "salt_mM": null,
        "temperature_c": 10.0
      },
      "construct": {
        "description": "Alpha-synuclein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + NMR restraints",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9JO6",
      "evidence_id": "EV-PDB-9JO6-1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "9JO6",
        "doi": "10.31635/ccschem.025.202505587",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9JO6"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_structure",
      "title": "The complex of alpha-synuclein in the presence of PD6"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9JKE",
      "evidence_id": "EV-PDB-9JKE-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.4
      },
      "provenance": {
        "deposit_id": "9JKE",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9JKE"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of Ac-K58W_G51DA53T P2 a-syn fibril."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains B,C,D,E,F,G)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9JE8",
      "evidence_id": "EV-PDB-9JE8-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.6
      },
      "provenance": {
        "deposit_id": "9JE8",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9JE8"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of Ac-G51DA53T 30days a-syn fibril."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,C,E)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9JE7",
      "evidence_id": "EV-PDB-9JE7-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.36
      },
      "provenance": {
        "deposit_id": "9JE7",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9JE7"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of Ac-E57Q_G51DA53T a-syn fibril."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains M,N,O)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9W1T",
      "evidence_id": "EV-PDB-9W1T-2",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.0
      },
      "provenance": {
        "deposit_id": "9W1T",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9W1T"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "The cryo-EM structure of 30-140 P3 a-syn fibril."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.5,
        "salt_mM": null,
        "temperature_c": -0.15
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E)",
        "labels": []
      },
      "data_format": "mmCIF + NMR restraints",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9YFC",
      "evidence_id": "EV-PDB-9YFC-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "9YFC",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9YFC"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_structure",
      "title": "Structure of A30P Alpha-synuclein Fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Alpha-synuclein (chains A,B,C,D,E,F,G,H,I,J)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9Y0S",
      "evidence_id": "EV-PDB-9Y0S-1",
      "mappings": [
        {
          "confidence": "high",
          "justification": "Structure titled as a fibril, filament or amyloid polymorph.",
          "rule": "as-fibril-title",
          "state_id": "aS-fibril",
          "who": "rule:as-fibril-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.72
      },
      "provenance": {
        "deposit_id": "9Y0S",
        "doi": "10.1101/2025.09.12.675751",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9Y0S"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "CryoEM structure of alpha-synuclein fibril induced by psychosine"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 6.5,
        "salt_mM": null,
        "temperature_c": 24.85
      },
      "construct": {
        "description": "BMRB data: 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=15095",
      "evidence_id": "EV-BMRB-15095",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr15095",
        "doi": "10.13018/BMR15095",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=15095"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Solution Structure of a Dodecapeptide from Alpha-Synuclein Bound with Synphilin-1"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.4,
        "salt_mM": null,
        "temperature_c": 15.05
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=16300",
      "evidence_id": "EV-BMRB-16300",
      "mappings": [
        {
          "confidence": "low",
          "justification": "NMR entry not titled as fibril, micelle, membrane or complex: most describe the free monomer.",
          "rule": "as-nmr-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-nmr-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr16300",
        "doi": "10.13018/BMR16300",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=16300"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "intrinsically unfolded alpha-synuclein"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.4,
        "salt_mM": null,
        "temperature_c": 25.05
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=16302",
      "evidence_id": "EV-BMRB-16302",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr16302",
        "doi": "10.13018/BMR16302",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=16302"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "SLAS-bound alpha-synuclein"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 3.0,
        "salt_mM": null,
        "temperature_c": 14.85
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts, heteronuclear NOE values, residual dipolar couplings",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=16342",
      "evidence_id": "EV-BMRB-16342",
      "mappings": [
        {
          "confidence": "low",
          "justification": "NMR entry not titled as fibril, micelle, membrane or complex: most describe the free monomer.",
          "rule": "as-nmr-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-nmr-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "relaxation_rate",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr16342",
        "doi": "10.13018/BMR16342",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=16342"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_dynamics",
      "title": "Backbone 1H, 13C, 15N and 13C-beta Chemical Shift Assignments for alpha-synuclein at pH 3"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 6.0,
        "salt_mM": null,
        "temperature_c": 19.85
      },
      "construct": {
        "description": "BMRB data: 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=16543",
      "evidence_id": "EV-BMRB-16543",
      "mappings": [
        {
          "confidence": "low",
          "justification": "NMR entry not titled as fibril, micelle, membrane or complex: most describe the free monomer.",
          "rule": "as-nmr-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-nmr-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr16543",
        "doi": "10.13018/BMR16543",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=16543"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Backbone 1H and 15N Chemical Shifts for Disordered alpha-Synuclein"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 6.0,
        "salt_mM": null,
        "temperature_c": 19.85
      },
      "construct": {
        "description": "BMRB data: 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=16546",
      "evidence_id": "EV-BMRB-16546",
      "mappings": [
        {
          "confidence": "low",
          "justification": "NMR entry not titled as fibril, micelle, membrane or complex: most describe the free monomer.",
          "rule": "as-nmr-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-nmr-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr16546",
        "doi": "10.13018/BMR16546",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=16546"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Backbone 1H and 15N Chemical Shifts for Disordered A30P alpha-Synuclein"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 6.0,
        "salt_mM": null,
        "temperature_c": 19.85
      },
      "construct": {
        "description": "BMRB data: 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=16547",
      "evidence_id": "EV-BMRB-16547",
      "mappings": [
        {
          "confidence": "low",
          "justification": "NMR entry not titled as fibril, micelle, membrane or complex: most describe the free monomer.",
          "rule": "as-nmr-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-nmr-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr16547",
        "doi": "10.13018/BMR16547",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=16547"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Backbone 1H and 15N Chemical Shifts for Disordered E46K alpha-Synuclein"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 6.0,
        "salt_mM": null,
        "temperature_c": 19.85
      },
      "construct": {
        "description": "BMRB data: 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=16548",
      "evidence_id": "EV-BMRB-16548",
      "mappings": [
        {
          "confidence": "low",
          "justification": "NMR entry not titled as fibril, micelle, membrane or complex: most describe the free monomer.",
          "rule": "as-nmr-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-nmr-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr16548",
        "doi": "10.13018/BMR16548",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=16548"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Backbone 1H and 15N Chemical Shifts for Disordered A53T alpha-Synuclein"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.4,
        "salt_mM": null,
        "temperature_c": 14.85
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts, T2 relaxation values",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=16904",
      "evidence_id": "EV-BMRB-16904",
      "mappings": [
        {
          "confidence": "low",
          "justification": "NMR entry not titled as fibril, micelle, membrane or complex: most describe the free monomer.",
          "rule": "as-nmr-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-nmr-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "relaxation_rate",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr16904",
        "doi": "10.13018/BMR16904",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=16904"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_dynamics",
      "title": "Backbone assignment of human alpha-synuclein in viscous 2 M glucose solution"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.5,
        "salt_mM": null,
        "temperature_c": 9.85
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=16939",
      "evidence_id": "EV-BMRB-16939",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr16939",
        "doi": "10.13018/BMR16939",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=16939"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "WT alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.5,
        "salt_mM": null,
        "temperature_c": -0.15
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=17214",
      "evidence_id": "EV-BMRB-17214",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr17214",
        "doi": "10.13018/BMR17214",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=17214"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "A30P alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.5,
        "salt_mM": null,
        "temperature_c": -0.15
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=17498",
      "evidence_id": "EV-BMRB-17498",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr17498",
        "doi": "10.13018/BMR17498",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=17498"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Solid-state NMR assignment of alpha-synuclein amyloid fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.5,
        "salt_mM": null,
        "temperature_c": -0.15
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=17648",
      "evidence_id": "EV-BMRB-17648",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr17648",
        "doi": "10.13018/BMR17648",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=17648"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Partial 13C,15N chemical shift assignments of A30P alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.5,
        "salt_mM": null,
        "temperature_c": 9.85
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=17654",
      "evidence_id": "EV-BMRB-17654",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr17654",
        "doi": "10.13018/BMR17654",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=17654"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Partial 13C, 15N chemical shift assignments of E46K alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.4,
        "salt_mM": null,
        "temperature_c": -0.15
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=17910",
      "evidence_id": "EV-BMRB-17910",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr17910",
        "doi": "10.13018/BMR17910",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=17910"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "WT alpha-synuclein fibrils in the presence of phospholipid vesicles"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.4,
        "salt_mM": null,
        "temperature_c": -0.15
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=18207",
      "evidence_id": "EV-BMRB-18207",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr18207",
        "doi": "10.13018/BMR18207",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=18207"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "A53T alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.4,
        "salt_mM": null,
        "temperature_c": 9.85
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=18208",
      "evidence_id": "EV-BMRB-18208",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr18208",
        "doi": "10.13018/BMR18208",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=18208"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Chemical shift assignments of the E46K alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.4,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=18243",
      "evidence_id": "EV-BMRB-18243",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr18243",
        "doi": "10.13018/BMR18243",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=18243"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "WT AS fibrils (1H detection experiments)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 2.16,
        "salt_mM": null,
        "temperature_c": 9.85
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=18857",
      "evidence_id": "EV-BMRB-18857",
      "mappings": [
        {
          "confidence": "low",
          "justification": "NMR entry not titled as fibril, micelle, membrane or complex: most describe the free monomer.",
          "rule": "as-nmr-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-nmr-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr18857",
        "doi": "10.13018/BMR18857",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=18857"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Backbone 1H, 13C,and 15N chemical shift assignments for alpha-synuclein at different pH and temperature"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.5,
        "salt_mM": null,
        "temperature_c": 4.85
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=18860",
      "evidence_id": "EV-BMRB-18860",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr18860",
        "doi": "10.13018/BMR18860",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=18860"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "solid-state NMR assignment of a-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 6.36,
        "salt_mM": null,
        "temperature_c": 36.85
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=19036",
      "evidence_id": "EV-BMRB-19036",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr19036",
        "doi": "10.13018/BMR19036",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=19036"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "NMR structure of the complex of an N-terminally acetylated alpha-synuclein peptide with calmodulin"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 6.2,
        "salt_mM": null,
        "temperature_c": 3.85
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=19257",
      "evidence_id": "EV-BMRB-19257",
      "mappings": [
        {
          "confidence": "low",
          "justification": "NMR entry not titled as fibril, micelle, membrane or complex: most describe the free monomer.",
          "rule": "as-nmr-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-nmr-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr19257",
        "doi": "10.13018/BMR19257",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=19257"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "1H, 13C, and 15N chemical shift assignments for alpha-synuclein in living E. coli cells"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.4,
        "salt_mM": null,
        "temperature_c": -0.15
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=19337",
      "evidence_id": "EV-BMRB-19337",
      "mappings": [
        {
          "confidence": "low",
          "justification": "NMR entry not titled as fibril, micelle, membrane or complex: most describe the free monomer.",
          "rule": "as-nmr-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-nmr-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr19337",
        "doi": "10.13018/BMR19337",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=19337"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "alpha synuclein in PBS"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.4,
        "salt_mM": null,
        "temperature_c": -0.15
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=19338",
      "evidence_id": "EV-BMRB-19338",
      "mappings": [
        {
          "confidence": "low",
          "justification": "NMR entry not titled as fibril, micelle, membrane or complex: most describe the free monomer.",
          "rule": "as-nmr-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-nmr-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr19338",
        "doi": "10.13018/BMR19338",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=19338"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "alpha synuclein mutant A53T in PBS"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.4,
        "salt_mM": null,
        "temperature_c": -0.15
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=19344",
      "evidence_id": "EV-BMRB-19344",
      "mappings": [
        {
          "confidence": "low",
          "justification": "NMR entry not titled as fibril, micelle, membrane or complex: most describe the free monomer.",
          "rule": "as-nmr-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-nmr-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr19344",
        "doi": "10.13018/BMR19344",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=19344"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "alpha synuclein mutant S87N in PBS - human/mouse chimera"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.4,
        "salt_mM": null,
        "temperature_c": -0.15
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=19345",
      "evidence_id": "EV-BMRB-19345",
      "mappings": [
        {
          "confidence": "low",
          "justification": "NMR entry not titled as fibril, micelle, membrane or complex: most describe the free monomer.",
          "rule": "as-nmr-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-nmr-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr19345",
        "doi": "10.13018/BMR19345",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=19345"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "alpha synuclein mutant A53T & S87N in PBS - human/mouse chimera"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.4,
        "salt_mM": null,
        "temperature_c": -0.15
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=19350",
      "evidence_id": "EV-BMRB-19350",
      "mappings": [
        {
          "confidence": "low",
          "justification": "NMR entry not titled as fibril, micelle, membrane or complex: most describe the free monomer.",
          "rule": "as-nmr-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-nmr-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr19350",
        "doi": "10.13018/BMR19350",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=19350"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Acetylated alpha synuclein in PBS"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.4,
        "salt_mM": null,
        "temperature_c": -0.15
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=19351",
      "evidence_id": "EV-BMRB-19351",
      "mappings": [
        {
          "confidence": "low",
          "justification": "NMR entry not titled as fibril, micelle, membrane or complex: most describe the free monomer.",
          "rule": "as-nmr-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-nmr-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr19351",
        "doi": "10.13018/BMR19351",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=19351"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Acetylated alpha synuclein A53T familiar mutant in PBS"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.4,
        "salt_mM": null,
        "temperature_c": 29.85
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=19353",
      "evidence_id": "EV-BMRB-19353",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr19353",
        "doi": "10.13018/BMR19353",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=19353"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Structure of alpha-synuclein in complex with an engineered binding protein"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.5,
        "salt_mM": null,
        "temperature_c": 9.85
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=25227",
      "evidence_id": "EV-BMRB-25227",
      "mappings": [
        {
          "confidence": "low",
          "justification": "NMR entry not titled as fibril, micelle, membrane or complex: most describe the free monomer.",
          "rule": "as-nmr-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-nmr-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr25227",
        "doi": "10.13018/BMR25227",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=25227"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "1H, 13C, and 15N chemical shift assignments for alpha-synuclein monomer (WT)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.5,
        "salt_mM": null,
        "temperature_c": 9.85
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=25228",
      "evidence_id": "EV-BMRB-25228",
      "mappings": [
        {
          "confidence": "low",
          "justification": "NMR entry not titled as fibril, micelle, membrane or complex: most describe the free monomer.",
          "rule": "as-nmr-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-nmr-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr25228",
        "doi": "10.13018/BMR25228",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=25228"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "1H, 13C, and 15N chemical shift assignments for alpha-synuclein (H50Q)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.0,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=25518",
      "evidence_id": "EV-BMRB-25518",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr25518",
        "doi": "10.13018/BMR25518",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=25518"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Atomic-resolution structure of alpha-synuclein fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.6,
        "salt_mM": null,
        "temperature_c": -0.15
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=31068",
      "evidence_id": "EV-BMRB-31068",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr31068",
        "doi": "10.13018/BMR31068",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=31068"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "STRUCTURE OF ALPHA-SYNUCLEIN FIBRILS DERIVED FROM HUMAN LEWY BODY DEMENTIA TISSUE"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.5,
        "salt_mM": null,
        "temperature_c": -0.15
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=31269",
      "evidence_id": "EV-BMRB-31269",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr31269",
        "doi": "10.13018/BMR31269",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=31269"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Structure of A30P Alpha-synuclein Fibrils"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 6.5,
        "salt_mM": null,
        "temperature_c": 24.85
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=34800",
      "evidence_id": "EV-BMRB-34800",
      "mappings": [
        {
          "confidence": "low",
          "justification": "NMR entry not titled as fibril, micelle, membrane or complex: most describe the free monomer.",
          "rule": "as-nmr-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-nmr-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr34800",
        "doi": "10.13018/BMR34800",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=34800"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Solution NMR Structure of Alpha-Synuclein 1-25 Peptide in 50% TFE."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 6.5,
        "salt_mM": null,
        "temperature_c": 24.85
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=34801",
      "evidence_id": "EV-BMRB-34801",
      "mappings": [
        {
          "confidence": "low",
          "justification": "NMR entry not titled as fibril, micelle, membrane or complex: most describe the free monomer.",
          "rule": "as-nmr-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-nmr-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr34801",
        "doi": "10.13018/BMR34801",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=34801"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Solution NMR Structure of Lactamised Alpha-Synuclein 2-12 Peptide in 50% TFE."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.4,
        "salt_mM": null,
        "temperature_c": 7.85
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=35086",
      "evidence_id": "EV-BMRB-35086",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr35086",
        "doi": "10.13018/BMR35086",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=35086"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Cu(II)-bound alpha-synuclein monomer complex - local structure of N-terminal binding site"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.4,
        "salt_mM": null,
        "temperature_c": 7.85
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=35087",
      "evidence_id": "EV-BMRB-35087",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr35087",
        "doi": "10.13018/BMR35087",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=35087"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Cu(II) - alpha-synuclein monomer complex - local structure of binding site His50 with Gly47 as ligand"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.4,
        "salt_mM": null,
        "temperature_c": 7.85
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=35088",
      "evidence_id": "EV-BMRB-35088",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr35088",
        "doi": "10.13018/BMR35088",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=35088"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Cu(II) - alpha-synuclein monomer complex - local structure of binding site His50 with Glu46 as ligand"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.5,
        "salt_mM": null,
        "temperature_c": 10.0
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=36696",
      "evidence_id": "EV-BMRB-36696",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr36696",
        "doi": "10.13018/BMR36696",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=36696"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "The complex of alpha-synuclein in the presence of PD6"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 5.5,
        "salt_mM": null,
        "temperature_c": 49.85
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=50996",
      "evidence_id": "EV-BMRB-50996",
      "mappings": [
        {
          "confidence": "medium",
          "justification": "Structure titled as micelle-bound.",
          "rule": "as-micelle-title",
          "state_id": "aS-micelle-helix",
          "who": "rule:as-micelle-title"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr50996",
        "doi": "10.13018/BMR50996",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=50996"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "SDS-Micelle bound alpha-Synuclein"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.5,
        "salt_mM": null,
        "temperature_c": 15.0
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=51120",
      "evidence_id": "EV-BMRB-51120",
      "mappings": [
        {
          "confidence": "low",
          "justification": "NMR entry not titled as fibril, micelle, membrane or complex: most describe the free monomer.",
          "rule": "as-nmr-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-nmr-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr51120",
        "doi": "10.13018/BMR51120",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=51120"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Single residue switches of aggregation in the N-terminal 'master controller' region of alpha-synuclein"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.5,
        "salt_mM": null,
        "temperature_c": 15.0
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=51121",
      "evidence_id": "EV-BMRB-51121",
      "mappings": [
        {
          "confidence": "low",
          "justification": "NMR entry not titled as fibril, micelle, membrane or complex: most describe the free monomer.",
          "rule": "as-nmr-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-nmr-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr51121",
        "doi": "10.13018/BMR51121",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=51121"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Single residue switches of aggregation in the N-terminal 'master controller' region of alpha-synuclein"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 5.5,
        "salt_mM": null,
        "temperature_c": 49.85
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=51148",
      "evidence_id": "EV-BMRB-51148",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr51148",
        "doi": "10.13018/BMR51148",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=51148"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Bicelle-bound alpha-Synuclein"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 5.5,
        "salt_mM": null,
        "temperature_c": 49.85
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=51152",
      "evidence_id": "EV-BMRB-51152",
      "mappings": [
        {
          "confidence": "low",
          "justification": "NMR entry not titled as fibril, micelle, membrane or complex: most describe the free monomer.",
          "rule": "as-nmr-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-nmr-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr51152",
        "doi": "10.13018/BMR51152",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=51152"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "alpha-Synuclein at low pH and high Temperature"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.4,
        "salt_mM": null,
        "temperature_c": 24.85
      },
      "construct": {
        "description": "BMRB data: 1H chemical shifts, 13C chemical shifts, 15N chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=5744",
      "evidence_id": "EV-BMRB-5744",
      "mappings": [
        {
          "confidence": "low",
          "justification": "NMR entry not titled as fibril, micelle, membrane or complex: most describe the free monomer.",
          "rule": "as-nmr-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-nmr-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr5744",
        "doi": "10.13018/BMR5744",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=5744"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Backbone Assignments of folded alpha-synuclein"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 6.5,
        "salt_mM": null,
        "temperature_c": 12.35
      },
      "construct": {
        "description": "BMRB data: 1H chemical shifts, 13C chemical shifts, 15N chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=6968",
      "evidence_id": "EV-BMRB-6968",
      "mappings": [
        {
          "confidence": "low",
          "justification": "NMR entry not titled as fibril, micelle, membrane or complex: most describe the free monomer.",
          "rule": "as-nmr-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-nmr-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr6968",
        "doi": "10.13018/BMR6968",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=6968"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "1H, 13C and 15N assignment of C', CA, CB, N, HN, HA and HB of intrinsically disordered alpha-synuclein"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": "20mM HEPES",
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample.",
        "ph": 7.2,
        "salt_mM": null,
        "temperature_c": 20.0
      },
      "construct": {
        "description": "Alpha-synuclein",
        "labels": []
      },
      "data_format": "scattering curve",
      "data_level": "processed",
      "data_link": "https://www.sasbdb.org/data/SASD2J3/",
      "evidence_id": "EV-SASBDB-SASD2J3",
      "mappings": [
        {
          "confidence": "low",
          "justification": "SAXS of alpha-synuclein alone, not titled as fibril, oligomer or complex.",
          "rule": "as-saxs-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-saxs-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "radius_of_gyration",
        "uncertainty": 0.028,
        "unit": "nm",
        "value": 2.912
      },
      "provenance": {
        "deposit_id": "SASD2J3",
        "doi": null,
        "licence": "CC BY 4.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "SASBDB",
        "url": "https://www.sasbdb.org/data/SASD2J3/"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "saxs_sans",
      "title": "α-Synuclein with K to R mutations and different NaCl concentration"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": "20mM HEPES",
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample.",
        "ph": 7.2,
        "salt_mM": null,
        "temperature_c": 20.0
      },
      "construct": {
        "description": "Alpha-synuclein",
        "labels": []
      },
      "data_format": "scattering curve",
      "data_level": "processed",
      "data_link": "https://www.sasbdb.org/data/SASD2K3/",
      "evidence_id": "EV-SASBDB-SASD2K3",
      "mappings": [
        {
          "confidence": "low",
          "justification": "SAXS of alpha-synuclein alone, not titled as fibril, oligomer or complex.",
          "rule": "as-saxs-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-saxs-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "radius_of_gyration",
        "uncertainty": 0.02,
        "unit": "nm",
        "value": 2.938
      },
      "provenance": {
        "deposit_id": "SASD2K3",
        "doi": null,
        "licence": "CC BY 4.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "SASBDB",
        "url": "https://www.sasbdb.org/data/SASD2K3/"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "saxs_sans",
      "title": "α-Synuclein with K to R mutations and different NaCl concentration"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": "20mM HEPES",
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample.",
        "ph": 7.2,
        "salt_mM": null,
        "temperature_c": 20.0
      },
      "construct": {
        "description": "Alpha-synuclein",
        "labels": []
      },
      "data_format": "scattering curve",
      "data_level": "processed",
      "data_link": "https://www.sasbdb.org/data/SASD2L3/",
      "evidence_id": "EV-SASBDB-SASD2L3",
      "mappings": [
        {
          "confidence": "low",
          "justification": "SAXS of alpha-synuclein alone, not titled as fibril, oligomer or complex.",
          "rule": "as-saxs-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-saxs-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "radius_of_gyration",
        "uncertainty": 0.016,
        "unit": "nm",
        "value": 2.926
      },
      "provenance": {
        "deposit_id": "SASD2L3",
        "doi": null,
        "licence": "CC BY 4.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "SASBDB",
        "url": "https://www.sasbdb.org/data/SASD2L3/"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "saxs_sans",
      "title": "α-Synuclein with K to R mutations and different NaCl concentration"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": "20mM HEPES",
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample.",
        "ph": 7.2,
        "salt_mM": null,
        "temperature_c": 20.0
      },
      "construct": {
        "description": "Alpha-synuclein",
        "labels": []
      },
      "data_format": "scattering curve",
      "data_level": "processed",
      "data_link": "https://www.sasbdb.org/data/SASD2M3/",
      "evidence_id": "EV-SASBDB-SASD2M3",
      "mappings": [
        {
          "confidence": "low",
          "justification": "SAXS of alpha-synuclein alone, not titled as fibril, oligomer or complex.",
          "rule": "as-saxs-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-saxs-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "radius_of_gyration",
        "uncertainty": 0.026,
        "unit": "nm",
        "value": 3.416
      },
      "provenance": {
        "deposit_id": "SASD2M3",
        "doi": null,
        "licence": "CC BY 4.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "SASBDB",
        "url": "https://www.sasbdb.org/data/SASD2M3/"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "saxs_sans",
      "title": "α-Synuclein with K to R mutations and different NaCl concentration"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": "20mM HEPES",
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample.",
        "ph": 7.2,
        "salt_mM": null,
        "temperature_c": 20.0
      },
      "construct": {
        "description": "Alpha-synuclein",
        "labels": []
      },
      "data_format": "scattering curve",
      "data_level": "processed",
      "data_link": "https://www.sasbdb.org/data/SASD2N3/",
      "evidence_id": "EV-SASBDB-SASD2N3",
      "mappings": [
        {
          "confidence": "low",
          "justification": "SAXS of alpha-synuclein alone, not titled as fibril, oligomer or complex.",
          "rule": "as-saxs-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-saxs-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "radius_of_gyration",
        "uncertainty": 0.018,
        "unit": "nm",
        "value": 3.37
      },
      "provenance": {
        "deposit_id": "SASD2N3",
        "doi": null,
        "licence": "CC BY 4.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "SASBDB",
        "url": "https://www.sasbdb.org/data/SASD2N3/"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "saxs_sans",
      "title": "α-Synuclein with K to R mutations and different NaCl concentration"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": "20mM HEPES",
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample.",
        "ph": 7.2,
        "salt_mM": null,
        "temperature_c": 20.0
      },
      "construct": {
        "description": "Alpha-synuclein",
        "labels": []
      },
      "data_format": "scattering curve",
      "data_level": "processed",
      "data_link": "https://www.sasbdb.org/data/SASD2P3/",
      "evidence_id": "EV-SASBDB-SASD2P3",
      "mappings": [
        {
          "confidence": "low",
          "justification": "SAXS of alpha-synuclein alone, not titled as fibril, oligomer or complex.",
          "rule": "as-saxs-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-saxs-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "radius_of_gyration",
        "uncertainty": 0.026,
        "unit": "nm",
        "value": 3.423
      },
      "provenance": {
        "deposit_id": "SASD2P3",
        "doi": null,
        "licence": "CC BY 4.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "SASBDB",
        "url": "https://www.sasbdb.org/data/SASD2P3/"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "saxs_sans",
      "title": "α-Synuclein with K to R mutations and different NaCl concentration"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": "20mM HEPES",
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample.",
        "ph": 7.2,
        "salt_mM": null,
        "temperature_c": 20.0
      },
      "construct": {
        "description": "Alpha-synuclein",
        "labels": []
      },
      "data_format": "scattering curve",
      "data_level": "processed",
      "data_link": "https://www.sasbdb.org/data/SASD2Q3/",
      "evidence_id": "EV-SASBDB-SASD2Q3",
      "mappings": [
        {
          "confidence": "low",
          "justification": "SAXS of alpha-synuclein alone, not titled as fibril, oligomer or complex.",
          "rule": "as-saxs-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-saxs-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "radius_of_gyration",
        "uncertainty": 0.017,
        "unit": "nm",
        "value": 3.421
      },
      "provenance": {
        "deposit_id": "SASD2Q3",
        "doi": null,
        "licence": "CC BY 4.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "SASBDB",
        "url": "https://www.sasbdb.org/data/SASD2Q3/"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "saxs_sans",
      "title": "α-Synuclein with K to R mutations and different NaCl concentration"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": "20mM HEPES",
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample.",
        "ph": 7.2,
        "salt_mM": null,
        "temperature_c": 20.0
      },
      "construct": {
        "description": "Alpha-synuclein",
        "labels": []
      },
      "data_format": "scattering curve",
      "data_level": "processed",
      "data_link": "https://www.sasbdb.org/data/SASD2R3/",
      "evidence_id": "EV-SASBDB-SASD2R3",
      "mappings": [
        {
          "confidence": "low",
          "justification": "SAXS of alpha-synuclein alone, not titled as fibril, oligomer or complex.",
          "rule": "as-saxs-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-saxs-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "radius_of_gyration",
        "uncertainty": 0.014,
        "unit": "nm",
        "value": 3.418
      },
      "provenance": {
        "deposit_id": "SASD2R3",
        "doi": null,
        "licence": "CC BY 4.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "SASBDB",
        "url": "https://www.sasbdb.org/data/SASD2R3/"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "saxs_sans",
      "title": "α-Synuclein with K to R mutations and different NaCl concentration"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": "20mM HEPES",
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample.",
        "ph": 7.2,
        "salt_mM": null,
        "temperature_c": 20.0
      },
      "construct": {
        "description": "Alpha-synuclein",
        "labels": []
      },
      "data_format": "scattering curve",
      "data_level": "processed",
      "data_link": "https://www.sasbdb.org/data/SASD2S3/",
      "evidence_id": "EV-SASBDB-SASD2S3",
      "mappings": [
        {
          "confidence": "low",
          "justification": "SAXS of alpha-synuclein alone, not titled as fibril, oligomer or complex.",
          "rule": "as-saxs-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-saxs-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "radius_of_gyration",
        "uncertainty": 0.025,
        "unit": "nm",
        "value": 3.438
      },
      "provenance": {
        "deposit_id": "SASD2S3",
        "doi": null,
        "licence": "CC BY 4.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "SASBDB",
        "url": "https://www.sasbdb.org/data/SASD2S3/"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "saxs_sans",
      "title": "α-Synuclein with K to R mutations and different NaCl concentration"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": "20mM HEPES",
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample.",
        "ph": 7.2,
        "salt_mM": null,
        "temperature_c": 20.0
      },
      "construct": {
        "description": "Alpha-synuclein",
        "labels": []
      },
      "data_format": "scattering curve",
      "data_level": "processed",
      "data_link": "https://www.sasbdb.org/data/SASD2T3/",
      "evidence_id": "EV-SASBDB-SASD2T3",
      "mappings": [
        {
          "confidence": "low",
          "justification": "SAXS of alpha-synuclein alone, not titled as fibril, oligomer or complex.",
          "rule": "as-saxs-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-saxs-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "radius_of_gyration",
        "uncertainty": 0.017,
        "unit": "nm",
        "value": 3.407
      },
      "provenance": {
        "deposit_id": "SASD2T3",
        "doi": null,
        "licence": "CC BY 4.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "SASBDB",
        "url": "https://www.sasbdb.org/data/SASD2T3/"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "saxs_sans",
      "title": "α-Synuclein with K to R mutations and different NaCl concentration"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": "20mM HEPES",
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample.",
        "ph": 7.2,
        "salt_mM": null,
        "temperature_c": 20.0
      },
      "construct": {
        "description": "Alpha-synuclein",
        "labels": []
      },
      "data_format": "scattering curve",
      "data_level": "processed",
      "data_link": "https://www.sasbdb.org/data/SASD2U3/",
      "evidence_id": "EV-SASBDB-SASD2U3",
      "mappings": [
        {
          "confidence": "low",
          "justification": "SAXS of alpha-synuclein alone, not titled as fibril, oligomer or complex.",
          "rule": "as-saxs-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-saxs-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "radius_of_gyration",
        "uncertainty": 0.013,
        "unit": "nm",
        "value": 3.434
      },
      "provenance": {
        "deposit_id": "SASD2U3",
        "doi": null,
        "licence": "CC BY 4.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "SASBDB",
        "url": "https://www.sasbdb.org/data/SASD2U3/"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "saxs_sans",
      "title": "α-Synuclein with K to R mutations and different NaCl concentration"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "DisProt annotations do not record sample conditions.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "residues 1-140; evidence: sodium dodecyl sulfate polyacrylamide gel electrophoresis evidence used in manual assertion",
        "labels": []
      },
      "data_format": null,
      "data_level": "reported",
      "data_link": "https://europepmc.org/article/MED/8901511",
      "evidence_id": "EV-DISPROT-DP00070r001",
      "mappings": [
        {
          "confidence": "medium",
          "justification": "DisProt region annotated as disorder.",
          "rule": "as-disprot-disorder",
          "state_id": "aS-disordered",
          "who": "rule:as-disprot-disorder"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "disorder_region",
        "uncertainty": null,
        "unit": "residues",
        "value": 140
      },
      "provenance": {
        "deposit_id": "DP00070r001",
        "doi": null,
        "licence": "CC BY 4.0",
        "retrieved": "2026-10-19",
        "source": "DisProt",
        "url": "https://disprot.org/DP00070"
      },
      "reader": null,
      "source_kind": "literature",
      "technique": "gel_electrophoresis",
      "title": "DisProt DP00070: disorder, residues 1-140"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "DisProt annotations do not record sample conditions.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "residues 100-140; evidence: nuclear magnetic resonance spectroscopy evidence used in manual assertion",
        "labels": []
      },
      "data_format": null,
      "data_level": "reported",
      "data_link": "https://europepmc.org/article/MED/11286556",
      "evidence_id": "EV-DISPROT-DP00070r007",
      "mappings": [
        {
          "confidence": "medium",
          "justification": "DisProt region annotated as disorder.",
          "rule": "as-disprot-disorder",
          "state_id": "aS-disordered",
          "who": "rule:as-disprot-disorder"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "disorder_region",
        "uncertainty": null,
        "unit": "residues",
        "value": 41
      },
      "provenance": {
        "deposit_id": "DP00070r007",
        "doi": null,
        "licence": "CC BY 4.0",
        "retrieved": "2026-10-19",
        "source": "DisProt",
        "url": "https://disprot.org/DP00070"
      },
      "reader": null,
      "source_kind": "literature",
      "technique": "nmr_shifts",
      "title": "DisProt DP00070: disorder, residues 100-140"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "DisProt annotations do not record sample conditions.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "residues 1-140; evidence: far-UV circular dichroism evidence used in manual assertion",
        "labels": []
      },
      "data_format": null,
      "data_level": "reported",
      "data_link": "https://europepmc.org/article/MED/22315227",
      "evidence_id": "EV-DISPROT-DP00070r011",
      "mappings": [
        {
          "confidence": "medium",
          "justification": "DisProt region annotated as disorder.",
          "rule": "as-disprot-disorder",
          "state_id": "aS-disordered",
          "who": "rule:as-disprot-disorder"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "disorder_region",
        "uncertainty": null,
        "unit": "residues",
        "value": 140
      },
      "provenance": {
        "deposit_id": "DP00070r011",
        "doi": null,
        "licence": "CC BY 4.0",
        "retrieved": "2026-10-19",
        "source": "DisProt",
        "url": "https://disprot.org/DP00070"
      },
      "reader": null,
      "source_kind": "literature",
      "technique": "cd",
      "title": "DisProt DP00070: disorder, residues 1-140"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "DisProt annotations do not record sample conditions.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "residues 42-92; evidence: site-directed spin-labelling electron paramagnetic resonance evidence used in manual assertion",
        "labels": []
      },
      "data_format": null,
      "data_level": "reported",
      "data_link": "https://europepmc.org/article/MED/20524659",
      "evidence_id": "EV-DISPROT-DP00070r013",
      "mappings": [
        {
          "confidence": "medium",
          "justification": "DisProt region annotated as disorder.",
          "rule": "as-disprot-disorder",
          "state_id": "aS-disordered",
          "who": "rule:as-disprot-disorder"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "disorder_region",
        "uncertainty": null,
        "unit": "residues",
        "value": 51
      },
      "provenance": {
        "deposit_id": "DP00070r013",
        "doi": null,
        "licence": "CC BY 4.0",
        "retrieved": "2026-10-19",
        "source": "DisProt",
        "url": "https://disprot.org/DP00070"
      },
      "reader": null,
      "source_kind": "literature",
      "technique": "epr_deer",
      "title": "DisProt DP00070: disorder, residues 42-92"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "DisProt annotations do not record sample conditions.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "residues 42-92; evidence: site-directed spin-labelling electron paramagnetic resonance evidence used in manual assertion",
        "labels": []
      },
      "data_format": null,
      "data_level": "reported",
      "data_link": "https://europepmc.org/article/MED/20524659",
      "evidence_id": "EV-DISPROT-DP00070r014",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "disorder_region",
        "uncertainty": null,
        "unit": "residues",
        "value": 51
      },
      "provenance": {
        "deposit_id": "DP00070r014",
        "doi": null,
        "licence": "CC BY 4.0",
        "retrieved": "2026-10-19",
        "source": "DisProt",
        "url": "https://disprot.org/DP00070"
      },
      "reader": null,
      "source_kind": "literature",
      "technique": "epr_deer",
      "title": "DisProt DP00070: disorder to order, residues 42-92"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "DisProt annotations do not record sample conditions.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "residues 1-140; evidence: far-UV circular dichroism evidence used in manual assertion",
        "labels": []
      },
      "data_format": null,
      "data_level": "reported",
      "data_link": "https://europepmc.org/article/MED/27628239",
      "evidence_id": "EV-DISPROT-DP00070r016",
      "mappings": [
        {
          "confidence": "medium",
          "justification": "DisProt region annotated as disorder.",
          "rule": "as-disprot-disorder",
          "state_id": "aS-disordered",
          "who": "rule:as-disprot-disorder"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "disorder_region",
        "uncertainty": null,
        "unit": "residues",
        "value": 140
      },
      "provenance": {
        "deposit_id": "DP00070r016",
        "doi": null,
        "licence": "CC BY 4.0",
        "retrieved": "2026-10-19",
        "source": "DisProt",
        "url": "https://disprot.org/DP00070"
      },
      "reader": null,
      "source_kind": "literature",
      "technique": "cd",
      "title": "DisProt DP00070: disorder, residues 1-140"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "DisProt annotations do not record sample conditions.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "residues 1-140; evidence: far-UV circular dichroism evidence used in manual assertion",
        "labels": []
      },
      "data_format": null,
      "data_level": "reported",
      "data_link": "https://europepmc.org/article/MED/27628239",
      "evidence_id": "EV-DISPROT-DP00070r018",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "disorder_region",
        "uncertainty": null,
        "unit": "residues",
        "value": 140
      },
      "provenance": {
        "deposit_id": "DP00070r018",
        "doi": null,
        "licence": "CC BY 4.0",
        "retrieved": "2026-10-19",
        "source": "DisProt",
        "url": "https://disprot.org/DP00070"
      },
      "reader": null,
      "source_kind": "literature",
      "technique": "cd",
      "title": "DisProt DP00070: disorder to order, residues 1-140"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "DisProt annotations do not record sample conditions.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "residues 1-140; evidence: far-UV circular dichroism evidence used in manual assertion",
        "labels": []
      },
      "data_format": null,
      "data_level": "reported",
      "data_link": "https://europepmc.org/article/MED/11286556",
      "evidence_id": "EV-DISPROT-DP00070r020",
      "mappings": [
        {
          "confidence": "medium",
          "justification": "DisProt region annotated as disorder.",
          "rule": "as-disprot-disorder",
          "state_id": "aS-disordered",
          "who": "rule:as-disprot-disorder"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "disorder_region",
        "uncertainty": null,
        "unit": "residues",
        "value": 140
      },
      "provenance": {
        "deposit_id": "DP00070r020",
        "doi": null,
        "licence": "CC BY 4.0",
        "retrieved": "2026-10-19",
        "source": "DisProt",
        "url": "https://disprot.org/DP00070"
      },
      "reader": null,
      "source_kind": "literature",
      "technique": "cd",
      "title": "DisProt DP00070: disorder, residues 1-140"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "DisProt annotations do not record sample conditions.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "residues 1-102; evidence: nuclear magnetic resonance spectroscopy evidence used in manual assertion",
        "labels": []
      },
      "data_format": null,
      "data_level": "reported",
      "data_link": "https://europepmc.org/article/MED/11286556",
      "evidence_id": "EV-DISPROT-DP00070r026",
      "mappings": [
        {
          "confidence": "low",
          "justification": "NMR entry not titled as fibril, micelle, membrane or complex: most describe the free monomer.",
          "rule": "as-nmr-monomer",
          "state_id": "aS-disordered",
          "who": "rule:as-nmr-monomer"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "disorder_region",
        "uncertainty": null,
        "unit": "residues",
        "value": 102
      },
      "provenance": {
        "deposit_id": "DP00070r026",
        "doi": null,
        "licence": "CC BY 4.0",
        "retrieved": "2026-10-19",
        "source": "DisProt",
        "url": "https://disprot.org/DP00070"
      },
      "reader": null,
      "source_kind": "literature",
      "technique": "nmr_shifts",
      "title": "DisProt DP00070: disorder to order, residues 1-102"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "DisProt annotations do not record sample conditions.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "residues 1-140; evidence: nuclear magnetic resonance spectroscopy evidence used in manual assertion",
        "labels": []
      },
      "data_format": null,
      "data_level": "reported",
      "data_link": "https://europepmc.org/article/MED/26808899",
      "evidence_id": "EV-DISPROT-DP00070r028",
      "mappings": [
        {
          "confidence": "medium",
          "justification": "DisProt region annotated as disorder.",
          "rule": "as-disprot-disorder",
          "state_id": "aS-disordered",
          "who": "rule:as-disprot-disorder"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "disorder_region",
        "uncertainty": null,
        "unit": "residues",
        "value": 140
      },
      "provenance": {
        "deposit_id": "DP00070r028",
        "doi": null,
        "licence": "CC BY 4.0",
        "retrieved": "2026-10-19",
        "source": "DisProt",
        "url": "https://disprot.org/DP00070"
      },
      "reader": null,
      "source_kind": "literature",
      "technique": "nmr_shifts",
      "title": "DisProt DP00070: disorder, residues 1-140"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "DisProt annotations do not record sample conditions.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "residues 1-140; evidence: circular dichroism evidence used in manual assertion",
        "labels": []
      },
      "data_format": null,
      "data_level": "reported",
      "data_link": "https://europepmc.org/article/MED/8901511",
      "evidence_id": "EV-DISPROT-DP00070r030",
      "mappings": [
        {
          "confidence": "medium",
          "justification": "DisProt region annotated as disorder.",
          "rule": "as-disprot-disorder",
          "state_id": "aS-disordered",
          "who": "rule:as-disprot-disorder"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "disorder_region",
        "uncertainty": null,
        "unit": "residues",
        "value": 140
      },
      "provenance": {
        "deposit_id": "DP00070r030",
        "doi": null,
        "licence": "CC BY 4.0",
        "retrieved": "2026-10-19",
        "source": "DisProt",
        "url": "https://disprot.org/DP00070"
      },
      "reader": null,
      "source_kind": "literature",
      "technique": "cd",
      "title": "DisProt DP00070: disorder, residues 1-140"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "DisProt annotations do not record sample conditions.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "residues 1-140; evidence: Fourier-transform infrared spectroscopy evidence used in manual assertion",
        "labels": []
      },
      "data_format": null,
      "data_level": "reported",
      "data_link": "https://europepmc.org/article/MED/8901511",
      "evidence_id": "EV-DISPROT-DP00070r032",
      "mappings": [
        {
          "confidence": "medium",
          "justification": "DisProt region annotated as disorder.",
          "rule": "as-disprot-disorder",
          "state_id": "aS-disordered",
          "who": "rule:as-disprot-disorder"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "disorder_region",
        "uncertainty": null,
        "unit": "residues",
        "value": 140
      },
      "provenance": {
        "deposit_id": "DP00070r032",
        "doi": null,
        "licence": "CC BY 4.0",
        "retrieved": "2026-10-19",
        "source": "DisProt",
        "url": "https://disprot.org/DP00070"
      },
      "reader": null,
      "source_kind": "literature",
      "technique": "ftir_raman",
      "title": "DisProt DP00070: disorder, residues 1-140"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "DisProt annotations do not record sample conditions.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "residues 1-102; evidence: far-UV circular dichroism evidence used in manual assertion",
        "labels": []
      },
      "data_format": null,
      "data_level": "reported",
      "data_link": "https://europepmc.org/article/MED/11286556",
      "evidence_id": "EV-DISPROT-DP00070r035",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "disorder_region",
        "uncertainty": null,
        "unit": "residues",
        "value": 102
      },
      "provenance": {
        "deposit_id": "DP00070r035",
        "doi": null,
        "licence": "CC BY 4.0",
        "retrieved": "2026-10-19",
        "source": "DisProt",
        "url": "https://disprot.org/DP00070"
      },
      "reader": null,
      "source_kind": "literature",
      "technique": "cd",
      "title": "DisProt DP00070: disorder to order, residues 1-102"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "DisProt annotations do not record sample conditions.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "residues 1-103; evidence: nuclear magnetic resonance spectroscopy evidence used in manual assertion",
        "labels": []
      },
      "data_format": null,
      "data_level": "reported",
      "data_link": "https://europepmc.org/article/MED/11286556",
      "evidence_id": "EV-DISPROT-DP00070r037",
      "mappings": [
        {
          "confidence": "medium",
          "justification": "DisProt region annotated as disorder.",
          "rule": "as-disprot-disorder",
          "state_id": "aS-disordered",
          "who": "rule:as-disprot-disorder"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "disorder_region",
        "uncertainty": null,
        "unit": "residues",
        "value": 103
      },
      "provenance": {
        "deposit_id": "DP00070r037",
        "doi": null,
        "licence": "CC BY 4.0",
        "retrieved": "2026-10-19",
        "source": "DisProt",
        "url": "https://disprot.org/DP00070"
      },
      "reader": null,
      "source_kind": "literature",
      "technique": "nmr_shifts",
      "title": "DisProt DP00070: disorder, residues 1-103"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "DisProt annotations do not record sample conditions.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "residues 101-140; evidence: nuclear magnetic resonance spectroscopy evidence used in manual assertion",
        "labels": []
      },
      "data_format": null,
      "data_level": "reported",
      "data_link": "https://europepmc.org/article/MED/33797711",
      "evidence_id": "EV-DISPROT-DP00070r039",
      "mappings": [
        {
          "confidence": "medium",
          "justification": "DisProt region annotated as disorder.",
          "rule": "as-disprot-disorder",
          "state_id": "aS-disordered",
          "who": "rule:as-disprot-disorder"
        }
      ],
      "molecule_id": "P37840",
      "observable": {
        "type": "disorder_region",
        "uncertainty": null,
        "unit": "residues",
        "value": 40
      },
      "provenance": {
        "deposit_id": "DP00070r039",
        "doi": null,
        "licence": "CC BY 4.0",
        "retrieved": "2026-10-19",
        "source": "DisProt",
        "url": "https://disprot.org/DP00070"
      },
      "reader": null,
      "source_kind": "literature",
      "technique": "nmr_shifts",
      "title": "DisProt DP00070: disorder, residues 101-140"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_silico",
        "ions": [],
        "ligands": [],
        "notes": "Computed prediction; no experimental conditions.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "AlphaFold Monomer v2.0 pipeline, residues 1-140",
        "labels": []
      },
      "data_format": "mmCIF, PAE JSON",
      "data_level": "processed",
      "data_link": "https://alphafold.ebi.ac.uk/entry/P37840",
      "evidence_id": "EV-AFDB-AF-P37840-F1",
      "mappings": [],
      "molecule_id": "P37840",
      "observable": {
        "type": "plddt",
        "uncertainty": null,
        "unit": "pLDDT",
        "value": 75.19
      },
      "provenance": {
        "deposit_id": "AF-P37840-F1",
        "doi": null,
        "licence": "CC BY 4.0",
        "retrieved": "2026-10-19",
        "source": "AlphaFold DB",
        "url": "https://alphafold.ebi.ac.uk/entry/P37840"
      },
      "reader": null,
      "source_kind": "computed",
      "technique": "af_prediction",
      "title": "AlphaFold DB prediction AF-P37840-F1"
    }
  ],
  "models": [
    {
      "assumptions": null,
      "basis": "observed",
      "constraints_used": [
        "EV-PDB-1XQ8-1"
      ],
      "file": "models/P37840/aS-micelle-helix.cif",
      "format": "mmCIF",
      "model_id": "aS-micelle-helix-cif",
      "molecule_id": "P37840",
      "provenance": {
        "deposit_id": "1XQ8",
        "doi": "10.1074/jbc.M411805200",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://files.rcsb.org/download/1XQ8.cif"
      },
      "state_id": "aS-micelle-helix"
    },
    {
      "assumptions": null,
      "basis": "observed",
      "constraints_used": [
        "EV-PDB-1XQ8-1"
      ],
      "file": "models/P37840/aS-micelle-helix.pdb",
      "format": "PDB",
      "model_id": "aS-micelle-helix-pdb",
      "molecule_id": "P37840",
      "provenance": {
        "deposit_id": "1XQ8",
        "doi": "10.1074/jbc.M411805200",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://files.rcsb.org/download/1XQ8.pdb"
      },
      "state_id": "aS-micelle-helix"
    },
    {
      "assumptions": null,
      "basis": "observed",
      "constraints_used": [
        "EV-PDB-6A6B-1"
      ],
      "file": "models/P37840/aS-fibril.cif",
      "format": "mmCIF",
      "model_id": "aS-fibril-cif",
      "molecule_id": "P37840",
      "provenance": {
        "deposit_id": "6A6B",
        "doi": "10.1038/s41422-018-0075-x",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://files.rcsb.org/download/6A6B.cif"
      },
      "state_id": "aS-fibril"
    },
    {
      "assumptions": null,
      "basis": "observed",
      "constraints_used": [
        "EV-PDB-6A6B-1"
      ],
      "file": "models/P37840/aS-fibril.pdb",
      "format": "PDB",
      "model_id": "aS-fibril-pdb",
      "molecule_id": "P37840",
      "provenance": {
        "deposit_id": "6A6B",
        "doi": "10.1038/s41422-018-0075-x",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://files.rcsb.org/download/6A6B.pdb"
      },
      "state_id": "aS-fibril"
    }
  ],
  "molecule": {
    "components": [],
    "domains": [],
    "gene": "SNCA",
    "identifiers": {
      "genbank": null,
      "isoform": null,
      "nakb": null,
      "pdb": [],
      "rfam": null,
      "rnacentral": null,
      "uniprot": "P37840"
    },
    "ligands": [
      "Cu cation"
    ],
    "modifications": [
      {
        "kind": "ptm",
        "name": "N-acetylmethionine",
        "position": 1,
        "source": "UniProtKB"
      },
      {
        "kind": "ptm",
        "name": "Phosphoserine",
        "position": 87,
        "source": "UniProtKB"
      },
      {
        "kind": "ptm",
        "name": "Phosphotyrosine; by FYN",
        "position": 125,
        "source": "UniProtKB"
      },
      {
        "kind": "ptm",
        "name": "Phosphoserine; by GRK2, PLK2, CK2, CK1 and GRK5",
        "position": 129,
        "source": "UniProtKB"
      }
    ],
    "molecule_id": "P37840",
    "molecule_type": "protein",
    "name": "Alpha-synuclein",
    "organism": {
      "name": "Homo sapiens",
      "taxon_id": 9606
    },
    "provenance": {
      "deposit_id": "P37840",
      "doi": null,
      "licence": "CC BY 4.0 (UniProt)",
      "retrieved": "2026-10-19",
      "source": "UniProtKB",
      "url": "https://www.uniprot.org/uniprotkb/P37840/entry"
    },
    "sequence": "MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA",
    "sequence_length": 140
  },
  "molecule_id": "P37840",
  "states": [
    {
      "assumptions": [
        "No observed structure of the free monomer exists; the state is defined by the absence of a folded model.",
        "Ensemble descriptions from PED, NMR, SAXS and smFRET are not yet ingested. No model is exported.",
        "Assumes unbound, monomeric protein under the conditions of the source experiments."
      ],
      "basis": "inferred",
      "description": "Intrinsically disordered monomer. No observed structure; ensemble descriptions are not yet ingested.",
      "family_label": null,
      "molecule_id": "P37840",
      "name": "disordered monomer",
      "parent_state": null,
      "population": null,
      "provenance": {
        "deposit_id": null,
        "doi": null,
        "licence": "Project licence (pending decision)",
        "retrieved": "2026-10-19",
        "source": "Conformome curation (P37840.yaml)",
        "url": "https://github.com/matth55/conformome/blob/HEAD/curation/P37840.yaml"
      },
      "representative_model": null,
      "secondary_structure": null,
      "state_id": "aS-disordered",
      "status": "draft"
    },
    {
      "assumptions": [],
      "basis": "observed",
      "description": "Helical conformation on a membrane-mimetic micelle, as in 1XQ8 (human).",
      "family_label": null,
      "molecule_id": "P37840",
      "name": "helical, micelle-bound",
      "parent_state": null,
      "population": null,
      "provenance": {
        "deposit_id": null,
        "doi": null,
        "licence": "Project licence (pending decision)",
        "retrieved": "2026-10-19",
        "source": "Conformome curation (P37840.yaml)",
        "url": "https://github.com/matth55/conformome/blob/HEAD/curation/P37840.yaml"
      },
      "representative_model": "aS-micelle-helix-cif",
      "secondary_structure": null,
      "state_id": "aS-micelle-helix",
      "status": "draft"
    },
    {
      "assumptions": [],
      "basis": "observed",
      "description": "Cross-beta fibril, as in 6A6B. Polymorph differences are not separated in the pilot.",
      "family_label": null,
      "molecule_id": "P37840",
      "name": "fibril",
      "parent_state": null,
      "population": null,
      "provenance": {
        "deposit_id": null,
        "doi": null,
        "licence": "Project licence (pending decision)",
        "retrieved": "2026-10-19",
        "source": "Conformome curation (P37840.yaml)",
        "url": "https://github.com/matth55/conformome/blob/HEAD/curation/P37840.yaml"
      },
      "representative_model": "aS-fibril-cif",
      "secondary_structure": null,
      "state_id": "aS-fibril",
      "status": "draft"
    }
  ],
  "transitions": []
}