{ "conflicts": [], "coverage": { "cells": {}, "data_levels": {}, "single_method_states": [], "states": [], "techniques": [ "xray", "nmr_structure", "nmr_shifts", "cd", "force_spectroscopy", "af_prediction" ], "unmapped_evidence": 35 }, "curation": { "as_of": "", "curator": "none", "file": "", "status": "uncurated" }, "evidence": [ { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Synaptotagmin-1 (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2K45", "evidence_id": "EV-PDB-2K45-1", "mappings": [], "molecule_id": "P21579", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2K45", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2K45" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "C2A domain of synaptototagmin I solution structure in the FGF-1-C2A binary complex: key component in the fibroblast growthfactor non-classical pathway" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Synaptotagmin-1 (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2K4A", "evidence_id": "EV-PDB-2K4A-1", "mappings": [], "molecule_id": "P21579", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2K4A", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2K4A" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "FGF-1-C2A binary complex structure: a key component in the fibroblast growthfactor non-classical pathway" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Synaptotagmin-1 (chains A,F)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2KI6", "evidence_id": "EV-PDB-2KI6-1", "mappings": [], "molecule_id": "P21579", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2KI6", "doi": "10.1074/jbc.M109.066357", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2KI6" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "The FGF1-S100A13-C2A hetero-hexameric complex structure: A component in the non-classical pathway for FGF1 secretion" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "IHP" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Synaptotagmin-1 (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2LHA", "evidence_id": "EV-PDB-2LHA-1", "mappings": [], "molecule_id": "P21579", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2LHA", "doi": "10.1021/bi300005w", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2LHA" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution structure of C2B with IP6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Synaptotagmin-1 (chains E)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2N1T", "evidence_id": "EV-PDB-2N1T-5", "mappings": [], "molecule_id": "P21579", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2N1T", "doi": "10.1038/nsmb.3035", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2N1T" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Dynamic binding mode of a synaptotagmin-1-SNARE complex in solution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CU", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Synaptotagmin-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3F01", "evidence_id": "EV-PDB-3F01-1", "mappings": [], "molecule_id": "P21579", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "3F01", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3F01" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Synaptotagmin I C2A domain with Cu(II)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MN", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Synaptotagmin-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3F05", "evidence_id": "EV-PDB-3F05-1", "mappings": [], "molecule_id": "P21579", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "3F05", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3F05" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Synaptotagmin I C2A domain with Mn(II)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "SYNAPTOTAGMIN-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4V11", "evidence_id": "EV-PDB-4V11-1", "mappings": [], "molecule_id": "P21579", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "4V11", "doi": "10.1523/JNEUROSCI.4248-14.2015", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4V11" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Synaptotagmin-1 with SV2A peptide phosphorylated at Thr84" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "branched: N-acetyl-alpha-neuraminic acid-(2-3)-beta-D-galactopyranose-(1-3)-2-acetamido-2-deoxy-beta-D-galactopyranose-(1-4)-[N-acetyl-alpha-neuraminic acid-(2-3)]beta-D-galactopyranose-(1-4)-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Synaptotagmin-1 (chains S)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QNS", "evidence_id": "EV-PDB-6QNS-2", "mappings": [], "molecule_id": "P21579", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "6QNS", "doi": "10.1371/journal.pbio.3000618", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QNS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the binding domain of Botulinum Neurotoxin type B mutant I1248W/V1249W in complex with human synaptotagmin 1 and GD1a receptors" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Synaptotagmin-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6TZ3", "evidence_id": "EV-PDB-6TZ3-1", "mappings": [], "molecule_id": "P21579", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.17 }, "provenance": { "deposit_id": "6TZ3", "doi": "10.1016/j.neuron.2020.04.003", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6TZ3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Human Synaptotagmin 1 C2B without Ca2+" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Synaptotagmin-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6U41", "evidence_id": "EV-PDB-6U41-1", "mappings": [], "molecule_id": "P21579", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "6U41", "doi": "10.1016/j.neuron.2020.04.003", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6U41" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "1.7 angstrom structure of a pathogenic human Syt 1 C2B (D304G)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Synaptotagmin-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6U4W", "evidence_id": "EV-PDB-6U4W-1", "mappings": [], "molecule_id": "P21579", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "6U4W", "doi": "10.1016/j.neuron.2020.04.003", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6U4W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "1.4 A structure of a pathogenic human Syt 1 C2B (D366E)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Synaptotagmin-1 (chains I,J,K,L,M,N,O,P)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8B8I", "evidence_id": "EV-PDB-8B8I-2", "mappings": [], "molecule_id": "P21579", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.75 }, "provenance": { "deposit_id": "8B8I", "doi": "10.1186/s12951-026-04489-w", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8B8I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Nanobody (NbLumSyt1) bound to human Syt1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Synaptotagmin-1 (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7U4Q", "evidence_id": "EV-PDB-7U4Q-1", "mappings": [], "molecule_id": "P21579", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.56 }, "provenance": { "deposit_id": "7U4Q", "doi": "10.1016/j.bpj.2024.11.009", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7U4Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Human Synaptotagmin-1 C2A Y181F Ca2+ bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Synaptotagmin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7TUA", "evidence_id": "EV-PDB-7TUA-1", "mappings": [], "molecule_id": "P21579", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "7TUA", "doi": "10.1016/j.bpj.2024.11.009", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7TUA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Human Synaptotagmin-1 C2B Y312F without Ca2+" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Synaptotagmin-1 (chains BBB)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6ZVN", "evidence_id": "EV-PDB-6ZVN-2", "mappings": [], "molecule_id": "P21579", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "6ZVN", "doi": "10.3390/toxins12090603", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6ZVN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Botulinum neurotoxin B2 binding domain in complex with human synaptotagmin I" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Synaptotagmin-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6U4U", "evidence_id": "EV-PDB-6U4U-1", "mappings": [], "molecule_id": "P21579", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "6U4U", "doi": "10.1016/j.neuron.2020.04.003", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6U4U" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "1.3 A structure of a pathogenic human Syt 1 C2B (I368T)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Synaptotagmin-1 (chains 33,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6G5K", "evidence_id": "EV-PDB-6G5K-2", "mappings": [], "molecule_id": "P21579", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "6G5K", "doi": "10.1126/sciadv.aau7196", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6G5K" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the binding domain of Botulinum Neurotoxin type B in complex with human synaptotagmin 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "MLI" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Synaptotagmin-1 (chains P)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6G5F", "evidence_id": "EV-PDB-6G5F-2", "mappings": [], "molecule_id": "P21579", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "6G5F", "doi": "10.1126/sciadv.aau7196", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6G5F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of an engineered Botulinum Neurotoxin type B mutant E1191M/S1199Y in complex with human synaptotagmin 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Synaptotagmin-1 (chains D,E,F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4ISQ", "evidence_id": "EV-PDB-4ISQ-2", "mappings": [], "molecule_id": "P21579", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.65 }, "provenance": { "deposit_id": "4ISQ", "doi": "10.1016/j.str.2013.06.026", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4ISQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Binding domain of Botulinum neurotoxin DC in complex with human synaptotagmin I" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Synaptotagmin-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3F04", "evidence_id": "EV-PDB-3F04-1", "mappings": [], "molecule_id": "P21579", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "3F04", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3F04" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Synaptotagmin I C2A domain" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CU", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Synaptotagmin-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3F00", "evidence_id": "EV-PDB-3F00-1", "mappings": [], "molecule_id": "P21579", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.36 }, "provenance": { "deposit_id": "3F00", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3F00" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Synaptotagmin I C2A domain with Cu(II)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Synaptotagmin-1 (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2R83", "evidence_id": "EV-PDB-2R83-1", "mappings": [], "molecule_id": "P21579", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "2R83", "doi": "10.1021/bi701651k", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2R83" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure analysis of human synaptotagmin 1 C2A-C2B" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Putative uncharacterized protein (chains A,D)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2K8M", "evidence_id": "EV-PDB-2K8M-1", "mappings": [], "molecule_id": "P21579", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2K8M", "doi": "10.1016/j.bbrc.2009.01.143", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2K8M" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "S100A13-C2A binary complex structure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=15785", "evidence_id": "EV-BMRB-15785", "mappings": [], "molecule_id": "P21579", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr15785", "doi": "10.13018/BMR15785", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=15785" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "C2A domain of synaptototagmin I solution structure in the FGF-1-C2A binary complex: key component in the fibroblast growthfactor non-classical pathway" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "DisProt annotations do not record sample conditions.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "residues 81-142; evidence: far-UV circular dichroism evidence used in manual assertion", "labels": [] }, "data_format": null, "data_level": "reported", "data_link": "https://europepmc.org/article/MED/27191789", "evidence_id": "EV-DISPROT-DP04145r004", "mappings": [], "molecule_id": "P21579", "observable": { "type": "disorder_region", "uncertainty": null, "unit": "residues", "value": 62 }, "provenance": { "deposit_id": "DP04145r004", "doi": null, "licence": "CC BY 4.0", "retrieved": "2026-10-19", "source": "DisProt", "url": "https://disprot.org/DP04145" }, "reader": null, "source_kind": "literature", "technique": "cd", "title": "DisProt DP04145: disorder, residues 81-142" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_silico", "ions": [], "ligands": [], "notes": "Computed prediction; no experimental conditions.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "AlphaFold Monomer v2.0 pipeline, residues 1-422", "labels": [] }, "data_format": "mmCIF, PAE JSON", "data_level": "processed", "data_link": "https://alphafold.ebi.ac.uk/entry/P21579", "evidence_id": "EV-AFDB-AF-P21579-F1", "mappings": [], "molecule_id": "P21579", "observable": { "type": "plddt", "uncertainty": null, "unit": "pLDDT", "value": 81.81 }, "provenance": { "deposit_id": "AF-P21579-F1", "doi": null, "licence": "CC BY 4.0", "retrieved": "2026-10-19", "source": "AlphaFold DB", "url": "https://alphafold.ebi.ac.uk/entry/P21579" }, "reader": null, "source_kind": "computed", "technique": "af_prediction", "title": "AlphaFold DB prediction AF-P21579-F1" } ], "models": [], "molecule": { "components": [], "domains": [ { "end": 261, "name": "C2 1", "start": 142 }, { "end": 406, "name": "C2 2", "start": 273 } ], "gene": "SYT1", "identifiers": { "genbank": null, "isoform": null, "nakb": null, "pdb": [], "rfam": null, "rnacentral": null, "uniprot": "P21579" }, "ligands": [ "Ca(2+)" ], "modifications": [ { "kind": "ptm", "name": "Phosphothreonine", "position": 129, "source": "UniProtKB" }, { "kind": "ptm", "name": "Phosphotyrosine", "position": 230, "source": "UniProtKB" }, { "kind": "ptm", "name": "Phosphoserine", "position": 265, "source": "UniProtKB" }, { "kind": "ptm", "name": "Phosphoserine", "position": 343, "source": "UniProtKB" }, { "kind": "ptm", "name": "Phosphoserine", "position": 345, "source": "UniProtKB" } ], "molecule_id": "P21579", "molecule_type": "protein", "name": "Synaptotagmin-1", "organism": { "name": "Homo sapiens", "taxon_id": 9606 }, "provenance": { "deposit_id": "P21579", "doi": null, "licence": "CC BY 4.0 (UniProt)", "retrieved": "2026-10-19", "source": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P21579/entry" }, "sequence": "MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK", "sequence_length": 422 }, "molecule_id": "P21579", "states": [], "transitions": [] }