{
  "conflicts": [],
  "coverage": {
    "cells": {},
    "data_levels": {},
    "single_method_states": [],
    "states": [],
    "techniques": [
      "xray",
      "nmr_structure",
      "nmr_shifts",
      "force_spectroscopy",
      "af_prediction"
    ],
    "unmapped_evidence": 14
  },
  "curation": {
    "as_of": "",
    "curator": "none",
    "file": "",
    "status": "uncurated"
  },
  "evidence": [
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "CA"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 6.8,
        "salt_mM": null,
        "temperature_c": 29.85
      },
      "construct": {
        "description": "L-selectin (chains B)",
        "labels": []
      },
      "data_format": "mmCIF + NMR restraints",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/2LGF",
      "evidence_id": "EV-PDB-2LGF-2",
      "mappings": [],
      "molecule_id": "P14151",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "2LGF",
        "doi": "10.1074/jbc.M112.373373",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/2LGF"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_structure",
      "title": "Solution structure of Ca2+/calmodulin complexed with a peptide representing the calmodulin-binding domain of L-selectin"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "CA",
          "NAG",
          "branched: alpha-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "L-selectin (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/3CFW",
      "evidence_id": "EV-PDB-3CFW-1",
      "mappings": [],
      "molecule_id": "P14151",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.2
      },
      "provenance": {
        "deposit_id": "3CFW",
        "doi": "10.1074/jbc.M116.767186",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/3CFW"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "L-selectin lectin and EGF domains"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "CA",
          "GOL",
          "PEG",
          "PG4",
          "branched: beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "L-selectin (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5VC1",
      "evidence_id": "EV-PDB-5VC1-1",
      "mappings": [],
      "molecule_id": "P14151",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.94
      },
      "provenance": {
        "deposit_id": "5VC1",
        "doi": "10.1002/cbic.201700220",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5VC1"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of L-selectin lectin/EGF domains"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 6.8,
        "salt_mM": null,
        "temperature_c": 29.85
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=17807",
      "evidence_id": "EV-BMRB-17807",
      "mappings": [],
      "molecule_id": "P14151",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr17807",
        "doi": "10.13018/BMR17807",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=17807"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Solution structure of Ca2+/calmodulin complexed with a peptide representing the calmodulin-binding domain of L-selectin"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_silico",
        "ions": [],
        "ligands": [],
        "notes": "Computed prediction; no experimental conditions.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "AlphaFold Monomer v2.0 pipeline, residues 1-372",
        "labels": []
      },
      "data_format": "mmCIF, PAE JSON",
      "data_level": "processed",
      "data_link": "https://alphafold.ebi.ac.uk/entry/P14151",
      "evidence_id": "EV-AFDB-AF-P14151-F1",
      "mappings": [],
      "molecule_id": "P14151",
      "observable": {
        "type": "plddt",
        "uncertainty": null,
        "unit": "pLDDT",
        "value": 85.31
      },
      "provenance": {
        "deposit_id": "AF-P14151-F1",
        "doi": null,
        "licence": "CC BY 4.0",
        "retrieved": "2026-10-19",
        "source": "AlphaFold DB",
        "url": "https://alphafold.ebi.ac.uk/entry/P14151"
      },
      "reader": null,
      "source_kind": "computed",
      "technique": "af_prediction",
      "title": "AlphaFold DB prediction AF-P14151-F1"
    }
  ],
  "models": [],
  "molecule": {
    "components": [],
    "domains": [
      {
        "end": 155,
        "name": "C-type lectin",
        "start": 55
      },
      {
        "end": 192,
        "name": "EGF-like",
        "start": 156
      },
      {
        "end": 256,
        "name": "Sushi 1",
        "start": 195
      },
      {
        "end": 318,
        "name": "Sushi 2",
        "start": 257
      }
    ],
    "gene": "SELL",
    "identifiers": {
      "genbank": null,
      "isoform": null,
      "nakb": null,
      "pdb": [],
      "rfam": null,
      "rnacentral": null,
      "uniprot": "P14151"
    },
    "ligands": [
      "Ca(2+)"
    ],
    "modifications": [],
    "molecule_id": "P14151",
    "molecule_type": "protein",
    "name": "L-selectin",
    "organism": {
      "name": "Homo sapiens",
      "taxon_id": 9606
    },
    "provenance": {
      "deposit_id": "P14151",
      "doi": null,
      "licence": "CC BY 4.0 (UniProt)",
      "retrieved": "2026-10-19",
      "source": "UniProtKB",
      "url": "https://www.uniprot.org/uniprotkb/P14151/entry"
    },
    "sequence": "MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY",
    "sequence_length": 372
  },
  "molecule_id": "P14151",
  "states": [],
  "transitions": []
}