{
  "conflicts": [],
  "coverage": {
    "cells": {},
    "data_levels": {},
    "single_method_states": [],
    "states": [],
    "techniques": [
      "xray",
      "nmr_shifts",
      "force_spectroscopy",
      "af_prediction"
    ],
    "unmapped_evidence": 38
  },
  "curation": {
    "as_of": "",
    "curator": "none",
    "file": "",
    "status": "uncurated"
  },
  "evidence": [
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.5,
        "salt_mM": null,
        "temperature_c": -170.15
      },
      "construct": {
        "description": "SINGLE-STRAND DNA-BINDING PROTEIN (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/1EYG",
      "evidence_id": "EV-PDB-1EYG-2",
      "mappings": [],
      "molecule_id": "P0AGE0",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.8
      },
      "provenance": {
        "deposit_id": "1EYG",
        "doi": "10.1038/77943",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/1EYG"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of chymotryptic fragment of E. coli ssb bound to two 35-mer single strand DNAS"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "SINGLE-STRANDED DNA BINDING PROTEIN (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/1KAW",
      "evidence_id": "EV-PDB-1KAW-1",
      "mappings": [],
      "molecule_id": "P0AGE0",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.9
      },
      "provenance": {
        "deposit_id": "1KAW",
        "doi": "10.1073/pnas.94.13.6652",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/1KAW"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "STRUCTURE OF SINGLE STRANDED DNA BINDING PROTEIN (SSB)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 9.0,
        "salt_mM": null,
        "temperature_c": 14.85
      },
      "construct": {
        "description": "SINGLE STRANDED DNA BINDING PROTEIN MONOMER (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/1QVC",
      "evidence_id": "EV-PDB-1QVC-1",
      "mappings": [],
      "molecule_id": "P0AGE0",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.2
      },
      "provenance": {
        "deposit_id": "1QVC",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/1QVC"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "CRYSTAL STRUCTURE ANALYSIS OF SINGLE STRANDED DNA BINDING PROTEIN (SSB) FROM E.COLI"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Single-strand binding protein (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/1SRU",
      "evidence_id": "EV-PDB-1SRU-1",
      "mappings": [],
      "molecule_id": "P0AGE0",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.3
      },
      "provenance": {
        "deposit_id": "1SRU",
        "doi": "10.1110/ps.04661904",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/1SRU"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of full length E. coli SSB protein"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "MG"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.0,
        "salt_mM": null,
        "temperature_c": -163.15
      },
      "construct": {
        "description": "Single-stranded DNA-binding C-terminal tail peptide (chains B,C)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/3C94",
      "evidence_id": "EV-PDB-3C94-2",
      "mappings": [],
      "molecule_id": "P0AGE0",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.7
      },
      "provenance": {
        "deposit_id": "3C94",
        "doi": "10.1073/pnas.0800741105",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/3C94"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "ExoI/SSB-Ct complex"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "CPS",
          "GOL",
          "MLT"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 6.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Single-stranded DNA-binding protein (chains E,F)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/3Q8D",
      "evidence_id": "EV-PDB-3Q8D-2",
      "mappings": [],
      "molecule_id": "P0AGE0",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.3
      },
      "provenance": {
        "deposit_id": "3Q8D",
        "doi": "10.1093/nar/gkr199",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/3Q8D"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "E. coli RecO complex with SSB C-terminus"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "SO4"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 6.5,
        "salt_mM": null,
        "temperature_c": -163.15
      },
      "construct": {
        "description": "Single-stranded DNA-binding protein (chains B,C)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/3UF7",
      "evidence_id": "EV-PDB-3UF7-2",
      "mappings": [],
      "molecule_id": "P0AGE0",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.2
      },
      "provenance": {
        "deposit_id": "3UF7",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/3UF7"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Co-crystal structure of Escherichia coli uracil-DNA glycosylase and a C-terminal fragement of the single-stranded DNA-binding protein"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.0,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "SSB-Ct Peptide (chains D,E)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4Z0U",
      "evidence_id": "EV-PDB-4Z0U-2",
      "mappings": [],
      "molecule_id": "P0AGE0",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.0
      },
      "provenance": {
        "deposit_id": "4Z0U",
        "doi": "10.1074/jbc.M115.655134",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4Z0U"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "RNase HI/SSB-Ct complex"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.6,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Plasmid-derived single-stranded DNA-binding protein (chains C,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8TG7",
      "evidence_id": "EV-PDB-8TG7-2",
      "mappings": [],
      "molecule_id": "P0AGE0",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.775
      },
      "provenance": {
        "deposit_id": "8TG7",
        "doi": "10.1016/j.jmb.2024.168590",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8TG7"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 2"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.6,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "TRP-MET-ASP-PHE-ASP-ASP-ASP-ILE-PRO-PHE (chains B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8TG8",
      "evidence_id": "EV-PDB-8TG8-2",
      "mappings": [],
      "molecule_id": "P0AGE0",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.576
      },
      "provenance": {
        "deposit_id": "8TG8",
        "doi": "10.1016/j.jmb.2024.168590",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8TG8"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 3"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Plasmid-derived single-stranded DNA-binding protein (chains C,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8TGC",
      "evidence_id": "EV-PDB-8TGC-2",
      "mappings": [],
      "molecule_id": "P0AGE0",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.484
      },
      "provenance": {
        "deposit_id": "8TGC",
        "doi": "10.1016/j.jmb.2024.168590",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8TGC"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of Red beta C-terminal domain in complex with SSB C-terminal peptide, Form 4"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Single-stranded DNA-binding protein (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4MZ9",
      "evidence_id": "EV-PDB-4MZ9-1",
      "mappings": [],
      "molecule_id": "P0AGE0",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.2
      },
      "provenance": {
        "deposit_id": "4MZ9",
        "doi": "10.1093/nar/gkt1238",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4MZ9"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Revised structure of E. coli SSB"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 4.6,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "SSB peptide (chains C)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/3SXU",
      "evidence_id": "EV-PDB-3SXU-3",
      "mappings": [],
      "molecule_id": "P0AGE0",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.85
      },
      "provenance": {
        "deposit_id": "3SXU",
        "doi": "10.1038/emboj.2011.305",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/3SXU"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of the E. coli SSB-DNA polymerase III interface"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 9.0,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "SINGLE STRANDED DNA BINDING PROTEIN (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/1EQQ",
      "evidence_id": "EV-PDB-1EQQ-2",
      "mappings": [],
      "molecule_id": "P0AGE0",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.2
      },
      "provenance": {
        "deposit_id": "1EQQ",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/1EQQ"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "SINGLE STRANDED DNA BINDING PROTEIN AND SSDNA COMPLEX"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 3.4,
        "salt_mM": null,
        "temperature_c": 24.85
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=19446",
      "evidence_id": "EV-BMRB-19446",
      "mappings": [],
      "molecule_id": "P0AGE0",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr19446",
        "doi": "10.13018/BMR19446",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=19446"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Single-stranded DNA binding protein from E. coli (SSB)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "DisProt annotations do not record sample conditions.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "residues 114-178; evidence: X-ray crystallography-based structural model with missing residue coordinates used in manual assertion",
        "labels": []
      },
      "data_format": null,
      "data_level": "reported",
      "data_link": "https://europepmc.org/article/MED/15169953",
      "evidence_id": "EV-DISPROT-DP02137r001",
      "mappings": [],
      "molecule_id": "P0AGE0",
      "observable": {
        "type": "disorder_region",
        "uncertainty": null,
        "unit": "residues",
        "value": 65
      },
      "provenance": {
        "deposit_id": "DP02137r001",
        "doi": null,
        "licence": "CC BY 4.0",
        "retrieved": "2026-10-19",
        "source": "DisProt",
        "url": "https://disprot.org/DP02137"
      },
      "reader": null,
      "source_kind": "literature",
      "technique": "xray",
      "title": "DisProt DP02137: disorder, residues 114-178"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_silico",
        "ions": [],
        "ligands": [],
        "notes": "Computed prediction; no experimental conditions.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "AlphaFold Monomer v2.0 pipeline, residues 1-178",
        "labels": []
      },
      "data_format": "mmCIF, PAE JSON",
      "data_level": "processed",
      "data_link": "https://alphafold.ebi.ac.uk/entry/P0AGE0",
      "evidence_id": "EV-AFDB-AF-P0AGE0-F1",
      "mappings": [],
      "molecule_id": "P0AGE0",
      "observable": {
        "type": "plddt",
        "uncertainty": null,
        "unit": "pLDDT",
        "value": 80.75
      },
      "provenance": {
        "deposit_id": "AF-P0AGE0-F1",
        "doi": null,
        "licence": "CC BY 4.0",
        "retrieved": "2026-10-19",
        "source": "AlphaFold DB",
        "url": "https://alphafold.ebi.ac.uk/entry/P0AGE0"
      },
      "reader": null,
      "source_kind": "computed",
      "technique": "af_prediction",
      "title": "AlphaFold DB prediction AF-P0AGE0-F1"
    }
  ],
  "models": [],
  "molecule": {
    "components": [],
    "domains": [
      {
        "end": 111,
        "name": "SSB",
        "start": 6
      }
    ],
    "gene": "ssb",
    "identifiers": {
      "genbank": null,
      "isoform": null,
      "nakb": null,
      "pdb": [],
      "rfam": null,
      "rnacentral": null,
      "uniprot": "P0AGE0"
    },
    "ligands": [],
    "modifications": [],
    "molecule_id": "P0AGE0",
    "molecule_type": "protein",
    "name": "Single-stranded DNA-binding protein",
    "organism": {
      "name": "Escherichia coli (strain K12)",
      "taxon_id": 83333
    },
    "provenance": {
      "deposit_id": "P0AGE0",
      "doi": null,
      "licence": "CC BY 4.0 (UniProt)",
      "retrieved": "2026-10-19",
      "source": "UniProtKB",
      "url": "https://www.uniprot.org/uniprotkb/P0AGE0/entry"
    },
    "sequence": "MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQPQGGWGQPQQPQGGNQFSGGAQSRPQQSAPAAPSNEPPMDFDDDIPF",
    "sequence_length": 178
  },
  "molecule_id": "P0AGE0",
  "states": [],
  "transitions": []
}