{
  "conflicts": [],
  "coverage": {
    "cells": {},
    "data_levels": {},
    "single_method_states": [],
    "states": [],
    "techniques": [
      "nmr_structure",
      "nmr_shifts",
      "force_spectroscopy",
      "af_prediction",
      "md"
    ],
    "unmapped_evidence": 19
  },
  "curation": {
    "as_of": "",
    "curator": "none",
    "file": "",
    "status": "uncurated"
  },
  "evidence": [
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 6.8,
        "salt_mM": null,
        "temperature_c": 34.85
      },
      "construct": {
        "description": "DNA-binding protein H-NS (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + NMR restraints",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/1NI8",
      "evidence_id": "EV-PDB-1NI8-1",
      "mappings": [],
      "molecule_id": "P0ACF8",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "1NI8",
        "doi": "10.1038/nsb904",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/1NI8"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_structure",
      "title": "H-NS dimerization motif"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.0,
        "salt_mM": null,
        "temperature_c": 21.85
      },
      "construct": {
        "description": "DNA-binding protein H-NS (chains B,C)",
        "labels": []
      },
      "data_format": "mmCIF + NMR restraints",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/2MW2",
      "evidence_id": "EV-PDB-2MW2-2",
      "mappings": [],
      "molecule_id": "P0ACF8",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "2MW2",
        "doi": "10.1074/jbc.M114.630400",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/2MW2"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_structure",
      "title": "Hha-H-NS46 charge zipper complex"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.0,
        "salt_mM": null,
        "temperature_c": 24.85
      },
      "construct": {
        "description": "dna-binding protein h-ns (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + NMR restraints",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/1LR1",
      "evidence_id": "EV-PDB-1LR1-1",
      "mappings": [],
      "molecule_id": "P0ACF8",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "1LR1",
        "doi": "10.1016/S0022-2836(02)01141-5",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/1LR1"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_structure",
      "title": "Solution Structure of the Oligomerization Domain of the Bacterial Chromatin-Structuring Protein H-NS"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "H-NS (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + NMR restraints",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/1HNS",
      "evidence_id": "EV-PDB-1HNS-1",
      "mappings": [],
      "molecule_id": "P0ACF8",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "1HNS",
        "doi": "10.1016/0014-5793(95)00079-O",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/1HNS"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_structure",
      "title": "H-NS (DNA-BINDING DOMAIN)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "H-NS (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + NMR restraints",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/1HNR",
      "evidence_id": "EV-PDB-1HNR-1",
      "mappings": [],
      "molecule_id": "P0ACF8",
      "observable": {
        "type": "structure",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "1HNR",
        "doi": "10.1016/0014-5793(95)00079-O",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/1HNR"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_structure",
      "title": "H-NS (DNA-BINDING DOMAIN)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.0,
        "salt_mM": null,
        "temperature_c": 21.85
      },
      "construct": {
        "description": "BMRB data: 15N chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=25296",
      "evidence_id": "EV-BMRB-25296",
      "mappings": [],
      "molecule_id": "P0ACF8",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr25296",
        "doi": "10.13018/BMR25296",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=25296"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Hha-H-NS46 charge zipper complex"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.0,
        "salt_mM": null,
        "temperature_c": 24.85
      },
      "construct": {
        "description": "BMRB data: 1H chemical shifts, 13C chemical shifts, 15N chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=4802",
      "evidence_id": "EV-BMRB-4802",
      "mappings": [],
      "molecule_id": "P0ACF8",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr4802",
        "doi": "10.13018/BMR4802",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=4802"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "1H, 13C, and 15N sequential assignment of the triple labelled N-terminal domain of the Histone like Nucleoid Structuring protein (H-NS) from Salmonella typhimurium (first 64 residues of the protein)"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.0,
        "salt_mM": null,
        "temperature_c": 24.85
      },
      "construct": {
        "description": "BMRB data: 1H chemical shifts, 13C chemical shifts, 15N chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=5390",
      "evidence_id": "EV-BMRB-5390",
      "mappings": [],
      "molecule_id": "P0ACF8",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr5390",
        "doi": "10.13018/BMR5390",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=5390"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "1H,13C and 15N Chemical Shifts Assignments for the Oligomerization Domain of H-NS"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_silico",
        "ions": [],
        "ligands": [],
        "notes": "Computed prediction; no experimental conditions.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "AlphaFold Monomer v2.0 pipeline, residues 1-137",
        "labels": []
      },
      "data_format": "mmCIF, PAE JSON",
      "data_level": "processed",
      "data_link": "https://alphafold.ebi.ac.uk/entry/P0ACF8",
      "evidence_id": "EV-AFDB-AF-P0ACF8-F1",
      "mappings": [],
      "molecule_id": "P0ACF8",
      "observable": {
        "type": "plddt",
        "uncertainty": null,
        "unit": "pLDDT",
        "value": 85.81
      },
      "provenance": {
        "deposit_id": "AF-P0ACF8-F1",
        "doi": null,
        "licence": "CC BY 4.0",
        "retrieved": "2026-10-19",
        "source": "AlphaFold DB",
        "url": "https://alphafold.ebi.ac.uk/entry/P0ACF8"
      },
      "reader": null,
      "source_kind": "computed",
      "technique": "af_prediction",
      "title": "AlphaFold DB prediction AF-P0ACF8-F1"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_silico",
        "ions": [],
        "ligands": [],
        "notes": "Simulation; temperature is the thermostat setting.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": 26.85
      },
      "construct": {
        "description": "start 1HNR; Amber Parm99",
        "labels": []
      },
      "data_format": "trajectory",
      "data_level": "processed",
      "data_link": "https://mmb.mddbr.eu/#/id/A00JF/overview",
      "evidence_id": "EV-MDDB-A00JF",
      "mappings": [],
      "molecule_id": "P0ACF8",
      "observable": {
        "type": "trajectory",
        "uncertainty": null,
        "unit": "ns",
        "value": 10.0
      },
      "provenance": {
        "deposit_id": "A00JF",
        "doi": "10.1016/j.str.2010.07.013",
        "licence": "This trajectory dataset is released under a Creative Commons Attribution 4.0 International Public License",
        "retrieved": "2026-10-19",
        "source": "MDDB",
        "url": "https://mmb.mddbr.eu/#/id/A00JF/overview"
      },
      "reader": null,
      "source_kind": "computed",
      "technique": "md",
      "title": "MoDEL 1HNR"
    }
  ],
  "models": [],
  "molecule": {
    "components": [],
    "domains": [],
    "gene": "hns",
    "identifiers": {
      "genbank": null,
      "isoform": null,
      "nakb": null,
      "pdb": [],
      "rfam": null,
      "rnacentral": null,
      "uniprot": "P0ACF8"
    },
    "ligands": [],
    "modifications": [
      {
        "kind": "ptm",
        "name": "N6-(2-hydroxyisobutyryl)lysine",
        "position": 121,
        "source": "UniProtKB"
      }
    ],
    "molecule_id": "P0ACF8",
    "molecule_type": "protein",
    "name": "DNA-binding protein H-NS",
    "organism": {
      "name": "Escherichia coli (strain K12)",
      "taxon_id": 83333
    },
    "provenance": {
      "deposit_id": "P0ACF8",
      "doi": null,
      "licence": "CC BY 4.0 (UniProt)",
      "retrieved": "2026-10-19",
      "source": "UniProtKB",
      "url": "https://www.uniprot.org/uniprotkb/P0ACF8/entry"
    },
    "sequence": "MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ",
    "sequence_length": 137
  },
  "molecule_id": "P0ACF8",
  "states": [],
  "transitions": []
}