{ "conflicts": [], "coverage": { "cells": { "KcsA-closed-collapsed": { "af_prediction": 0, "nmr_shifts": 0, "nmr_structure": 0, "xray": 2 }, "KcsA-closed-conductive": { "af_prediction": 0, "nmr_shifts": 0, "nmr_structure": 0, "xray": 1 }, "KcsA-open-inactivated": { "af_prediction": 0, "nmr_shifts": 0, "nmr_structure": 2, "xray": 17 } }, "data_levels": { "KcsA-closed-collapsed": { "xray": "processed" }, "KcsA-closed-conductive": { "xray": "processed" }, "KcsA-open-inactivated": { "nmr_structure": "processed", "xray": "processed" } }, "single_method_states": [ "KcsA-closed-conductive", "KcsA-closed-collapsed" ], "states": [ "KcsA-closed-conductive", "KcsA-closed-collapsed", "KcsA-open-inactivated" ], "techniques": [ "xray", "nmr_structure", "nmr_shifts", "af_prediction" ], "unmapped_evidence": 74 }, "curation": { "as_of": "2026-10-19", "curator": "draft (unreviewed)", "file": "P0A334.yaml", "status": "draft" }, "evidence": [ { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "PROTEIN (POTASSIUM CHANNEL PROTEIN) (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1BL8", "evidence_id": "EV-PDB-1BL8-1", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "1BL8", "doi": "10.1126/science.280.5360.69", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1BL8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "POTASSIUM CHANNEL (KCSA) FROM STREPTOMYCES LIVIDANS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K", "TBA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "VOLTAGE-GATED POTASSIUM CHANNEL (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1J95", "evidence_id": "EV-PDB-1J95-1", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "1J95", "doi": "10.1038/35079500", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1J95" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "KCSA potassium channel with TBA (tetrabutylammonium) and potassium" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -123.15 }, "construct": { "description": "VOLTAGE-GATED POTASSIUM CHANNEL (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JQ2", "evidence_id": "EV-PDB-1JQ2-1", "mappings": [ { "confidence": "medium", "justification": "Title describes an open or partially open gate.", "rule": "kcsa-open-title", "state_id": "KcsA-open-inactivated", "who": "rule:kcsa-open-title" } ], "molecule_id": "P0A334", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "1JQ2", "doi": "10.1038/nsb1001-883", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JQ2" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "POTASSIUM CHANNEL (KCSA) OPEN GATE MODEL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DGA", "F09", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.4, "salt_mM": null, "temperature_c": -73.15 }, "construct": { "description": "potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1K4C", "evidence_id": "EV-PDB-1K4C-3", "mappings": [ { "confidence": "high", "justification": "KcsA-Fab complex at high K+.", "rule": "curator_assignment", "state_id": "KcsA-closed-conductive", "who": "curator:draft (unreviewed)" } ], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1K4C", "doi": "10.1038/35102009", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1K4C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Potassium Channel KcsA-Fab complex in high concentration of K+" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DGA", "F09", "K", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.4, "salt_mM": null, "temperature_c": -73.15 }, "construct": { "description": "potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1K4D", "evidence_id": "EV-PDB-1K4D-3", "mappings": [ { "confidence": "high", "justification": "KcsA-Fab complex at low K+.", "rule": "curator_assignment", "state_id": "KcsA-closed-collapsed", "who": "curator:draft (unreviewed)" } ], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "1K4D", "doi": "10.1038/35102009", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1K4D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Potassium Channel KcsA-Fab complex in low concentration of K+" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DGA", "F09", "RB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1R3I", "evidence_id": "EV-PDB-1R3I-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "1R3I", "doi": "10.1016/j.jmb.2003.09.022", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1R3I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "potassium channel KcsA-Fab complex in Rb+" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DGA", "TL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1R3K", "evidence_id": "EV-PDB-1R3K-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "1R3K", "doi": "10.1016/j.jmb.2003.09.022", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1R3K" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "potassium channel KcsA-Fab complex in low concentration of Tl+" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CS", "DGA", "F09" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1R3L", "evidence_id": "EV-PDB-1R3L-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.41 }, "provenance": { "deposit_id": "1R3L", "doi": "10.1016/j.jmb.2003.09.022", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1R3L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "potassium channel KcsA-Fab complex in Cs+" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DGA", "F09", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -123.15 }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1ZWI", "evidence_id": "EV-PDB-1ZWI-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "1ZWI", "doi": "10.1038/nsmb1069", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1ZWI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of mutant KcsA potassium channel" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": 41.85 }, "construct": { "description": "Voltage-gated potassium channel (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2A9H", "evidence_id": "EV-PDB-2A9H-1", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2A9H", "doi": "10.1021/bi051656d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2A9H" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "NMR structural studies of a potassium channel / charybdotoxin complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "F09", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.4, "salt_mM": null, "temperature_c": -123.15 }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2ATK", "evidence_id": "EV-PDB-2ATK-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "2ATK", "doi": "10.1038/nsmb1069", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2ATK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of a mutant KcsA K+ channel" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CO", "TBA", "TL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.4, "salt_mM": null, "temperature_c": -73.15 }, "construct": { "description": "POTASSIUM CHANNEL KCSA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2BOB", "evidence_id": "EV-PDB-2BOB-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.76 }, "provenance": { "deposit_id": "2BOB", "doi": "10.1038/NSMB929", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2BOB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Potassium channel KcsA-Fab complex in thallium with tetrabutylammonium (TBA)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CO", "T1A", "TL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.4, "salt_mM": null, "temperature_c": -73.15 }, "construct": { "description": "POTASSIUM CHANNEL KCSA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2BOC", "evidence_id": "EV-PDB-2BOC-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.01 }, "provenance": { "deposit_id": "2BOC", "doi": "10.1038/NSMB929", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2BOC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Potassium channel KcsA-Fab complex in thallium with tetraethylarsonium (TEAs)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "F09", "L2C", "TBA", "TL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2DWD", "evidence_id": "EV-PDB-2DWD-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "2DWD", "doi": "10.1016/j.jmb.2006.11.081", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2DWD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "crystal structure of KcsA-FAB-TBA complex in Tl+" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "F09", "L2C", "RB", "TBA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2DWE", "evidence_id": "EV-PDB-2DWE-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "2DWE", "doi": "10.1016/j.jmb.2006.11.081", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2DWE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of KcsA-FAB-TBA complex in Rb+" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "B3H", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": null }, "construct": { "description": "KcsA Channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2H8P", "evidence_id": "EV-PDB-2H8P-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.25 }, "provenance": { "deposit_id": "2H8P", "doi": "10.1021/ja0631955", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2H8P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of a K channel with an amide to ester substitution in the selectivity filter" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "B3H", "CS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "KCSA CHANNEL (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2HG5", "evidence_id": "EV-PDB-2HG5-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.75 }, "provenance": { "deposit_id": "2HG5", "doi": "10.1021/ja0631955", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2HG5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Cs+ complex of a K channel with an amide to ester substitution in the selectivity filter" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K", "TBA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2HJF", "evidence_id": "EV-PDB-2HJF-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.9 }, "provenance": { "deposit_id": "2HJF", "doi": "10.1016/j.jmb.2006.09.069", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2HJF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Potassium channel kcsa-fab complex with tetrabutylammonium (TBA)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "F09", "K", "L2C", "TBA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2HVJ", "evidence_id": "EV-PDB-2HVJ-3", "mappings": [ { "confidence": "medium", "justification": "Title describes low K+ conditions, where the filter collapses.", "rule": "kcsa-low-k-title", "state_id": "KcsA-closed-collapsed", "who": "rule:kcsa-low-k-title" } ], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.75 }, "provenance": { "deposit_id": "2HVJ", "doi": "10.1016/j.jmb.2006.11.081", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2HVJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of KcsA-Fab-TBA complex in low K+" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "F09", "K", "L2C", "TBA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2HVK", "evidence_id": "EV-PDB-2HVK-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "2HVK", "doi": "10.1016/j.jmb.2006.11.081", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2HVK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "crystal structure of the KcsA-Fab-TBA complex in high K+" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1EM", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2IH3", "evidence_id": "EV-PDB-2IH3-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.72 }, "provenance": { "deposit_id": "2IH3", "doi": "10.1126/science.1133415", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2IH3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ion selectivity in a semi-synthetic K+ channel locked in the conductive conformation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -73.15 }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2ITC", "evidence_id": "EV-PDB-2ITC-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "2ITC", "doi": "10.1371/journal.pbio.0050121", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2ITC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Potassium Channel KcsA-Fab complex in Sodium Chloride" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.2, "salt_mM": null, "temperature_c": -73.15 }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2ITD", "evidence_id": "EV-PDB-2ITD-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "2ITD", "doi": "10.1371/journal.pbio.0050121", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2ITD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Potassium Channel KcsA-Fab complex in Barium Chloride" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CO", "F09", "HP6", "K", "L2C", "TBA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "VOLTAGE-GATED POTASSIUM CHANNEL (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2JK5", "evidence_id": "EV-PDB-2JK5-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "2JK5", "doi": "10.1021/BI500525S", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2JK5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Potassium Channel KcsA in complex with Tetrabutylammonium in high K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1EM", "F09", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2P7T", "evidence_id": "EV-PDB-2P7T-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.05 }, "provenance": { "deposit_id": "2P7T", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2P7T" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of KcsA mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Voltage-gated potassium channel (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2QTO", "evidence_id": "EV-PDB-2QTO-1", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.201 }, "provenance": { "deposit_id": "2QTO", "doi": "10.1016/j.str.2007.06.012", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2QTO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "An anisotropic model for potassium channel KcsA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CO", "DGA", "F09", "HX0", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "VOLTAGE-GATED POTASSIUM CHANNEL (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2W0F", "evidence_id": "EV-PDB-2W0F-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "2W0F", "doi": "10.1021/BI500525S", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2W0F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Potassium Channel KcsA-Fab Complex with Tetraoctylammonium" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3F5W", "evidence_id": "EV-PDB-3F5W-3", "mappings": [ { "confidence": "high", "justification": "Title: open-inactivated state, 32 Å opening at T112.", "rule": "curator_assignment", "state_id": "KcsA-open-inactivated", "who": "curator:draft (unreviewed)" } ], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.3 }, "provenance": { "deposit_id": "3F5W", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3F5W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "KcsA Potassium channel in the open-inactivated state with 32 A opening at T112" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3F7V", "evidence_id": "EV-PDB-3F7V-3", "mappings": [ { "confidence": "medium", "justification": "Title describes an open or partially open gate.", "rule": "kcsa-open-title", "state_id": "KcsA-open-inactivated", "who": "rule:kcsa-open-title" } ], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "3F7V", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3F7V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "KcsA Potassium channel in the open-inactivated state with 23 A opening at T112" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3FB5", "evidence_id": "EV-PDB-3FB5-3", "mappings": [ { "confidence": "medium", "justification": "Title describes an open or partially open gate.", "rule": "kcsa-open-title", "state_id": "KcsA-open-inactivated", "who": "rule:kcsa-open-title" } ], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "3FB5", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3FB5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "KcsA potassium channel in the partially open state with 14.5 A opening at T112" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3FB6", "evidence_id": "EV-PDB-3FB6-3", "mappings": [ { "confidence": "medium", "justification": "Title describes an open or partially open gate.", "rule": "kcsa-open-title", "state_id": "KcsA-open-inactivated", "who": "rule:kcsa-open-title" } ], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "3FB6", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3FB6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "KcsA Potassium channel in the partially open state with 16 A opening at T112" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "RB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3FB7", "evidence_id": "EV-PDB-3FB7-3", "mappings": [ { "confidence": "medium", "justification": "Title describes an open or partially open gate.", "rule": "kcsa-open-title", "state_id": "KcsA-open-inactivated", "who": "rule:kcsa-open-title" } ], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.3 }, "provenance": { "deposit_id": "3FB7", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3FB7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Open KcsA potassium channel in the presence of Rb+ ion" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "RB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3FB8", "evidence_id": "EV-PDB-3FB8-3", "mappings": [ { "confidence": "medium", "justification": "Title describes an open or partially open gate.", "rule": "kcsa-open-title", "state_id": "KcsA-open-inactivated", "who": "rule:kcsa-open-title" } ], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.4 }, "provenance": { "deposit_id": "3FB8", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3FB8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "KcsA Potassium channel in the open-conductive state with 20 A opening at T112 in the presence of Rb+ ion" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DGA", "NI" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3GB7", "evidence_id": "EV-PDB-3GB7-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.85 }, "provenance": { "deposit_id": "3GB7", "doi": "10.1038/nsmb.1703", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3GB7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Potassium Channel KcsA-Fab complex in Li+" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3HPL", "evidence_id": "EV-PDB-3HPL-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "3HPL", "doi": "10.1038/nature09136", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3HPL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "KcsA E71H-F103A mutant in the closed state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -180.15 }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3OGC", "evidence_id": "EV-PDB-3OGC-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.8 }, "provenance": { "deposit_id": "3OGC", "doi": "10.1073/pnas.1014186108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3OGC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "KcsA E71A variant in presence of Na+" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3OR6", "evidence_id": "EV-PDB-3OR6-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "3OR6", "doi": "10.1038/nsmb.1968", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3OR6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "On the structural basis of modal gating behavior in K+channels - E71Q" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3OR7", "evidence_id": "EV-PDB-3OR7-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "3OR7", "doi": "10.1038/nsmb.1968", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3OR7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "On the structural basis of modal gating behavior in K+channels - E71I" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Voltage-gated potassium channel (chains K,L,M,N)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3PJS", "evidence_id": "EV-PDB-3PJS-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.8 }, "provenance": { "deposit_id": "3PJS", "doi": "10.1073/pnas.1105112108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3PJS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mechanism of Activation Gating in the Full-Length KcsA K+ Channel" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CD", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3STL", "evidence_id": "EV-PDB-3STL-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "3STL", "doi": "10.1016/j.str.2012.03.027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3STL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "KcsA potassium channel mutant Y82C with Cadmium bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DGA", "NI" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3IGA", "evidence_id": "EV-PDB-3IGA-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.75 }, "provenance": { "deposit_id": "3IGA", "doi": "10.1038/nsmb.1703", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3IGA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Potassium Channel KcsA-Fab complex in Li+ and K+" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K", "MTN", "TBA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Voltage-gated potassium channel (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3IFX", "evidence_id": "EV-PDB-3IFX-1", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.56 }, "provenance": { "deposit_id": "3IFX", "doi": "10.1021/bi9016523", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3IFX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the Spin-labeled KcsA mutant V48R1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3F7Y", "evidence_id": "EV-PDB-3F7Y-3", "mappings": [ { "confidence": "medium", "justification": "Title describes an open or partially open gate.", "rule": "kcsa-open-title", "state_id": "KcsA-open-inactivated", "who": "rule:kcsa-open-title" } ], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.4 }, "provenance": { "deposit_id": "3F7Y", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3F7Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "KcsA Potassium channel in the partially open state with 17 A opening at T112" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Voltage-gated potassium channel (chains K,L,M,N)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3EFF", "evidence_id": "EV-PDB-3EFF-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.8 }, "provenance": { "deposit_id": "3EFF", "doi": "10.1073/pnas.0810663106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3EFF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The Crystal Structure of Full-Length KcsA in its Closed Conformation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DGA", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -73.15 }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2NLJ", "evidence_id": "EV-PDB-2NLJ-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.52 }, "provenance": { "deposit_id": "2NLJ", "doi": "10.1371/journal.pbio.0050121", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2NLJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Potassium Channel KcsA(M96V)-Fab complex in KCl" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1EM", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2IH1", "evidence_id": "EV-PDB-2IH1-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "2IH1", "doi": "10.1126/science.1133415", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2IH1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ion selectivity in a semi-synthetic K+ channel locked in the conductive conformation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DGA", "F09", "TL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1R3J", "evidence_id": "EV-PDB-1R3J-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1R3J", "doi": "10.1016/j.jmb.2003.09.022", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1R3J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "potassium channel KcsA-Fab complex in high concentration of Tl+" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "RB", "TBA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Voltage-gated potassium channel (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JVM", "evidence_id": "EV-PDB-1JVM-1", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "1JVM", "doi": "10.1038/35102000", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JVM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "KCSA POTASSIUM CHANNEL WITH TBA (TETRABUTYLAMMONIUM) AND RUBIDIUM" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -123.15 }, "construct": { "description": "VOLTAGE-GATED POTASSIUM CHANNEL (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JQ1", "evidence_id": "EV-PDB-1JQ1-1", "mappings": [ { "confidence": "medium", "justification": "Title describes an open or partially open gate.", "rule": "kcsa-open-title", "state_id": "KcsA-open-inactivated", "who": "rule:kcsa-open-title" } ], "molecule_id": "P0A334", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "1JQ1", "doi": "10.1038/nsb1001-883", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JQ1" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "POTASSIUM CHANNEL (KCSA) OPEN GATE MODEL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.2, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "VOLTAGE-GATED POTASSIUM CHANNEL (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1F6G", "evidence_id": "EV-PDB-1F6G-1", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "1F6G", "doi": "10.1085/jgp.117.2.165", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1F6G" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "POTASSIUM CHANNEL (KCSA) FULL-LENGTH FOLD" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K", "MTN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Voltage-gated potassium channel (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3STZ", "evidence_id": "EV-PDB-3STZ-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "3STZ", "doi": "10.1016/j.str.2012.03.027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3STZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "KcsA potassium channel mutant Y82C with nitroxide spin label" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DGA", "F09", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -80.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LBE", "evidence_id": "EV-PDB-4LBE-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.751 }, "provenance": { "deposit_id": "4LBE", "doi": "10.1085/jgp.201311057", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LBE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of KcsA with R122A mutation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DGA", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -180.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LCU", "evidence_id": "EV-PDB-4LCU-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.752 }, "provenance": { "deposit_id": "4LCU", "doi": "10.1085/jgp.201311057", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LCU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of KcsA with E118A mutation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DGA", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4MSW", "evidence_id": "EV-PDB-4MSW-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.06 }, "provenance": { "deposit_id": "4MSW", "doi": "10.1073/pnas.1314356110", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4MSW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Y78 ester mutant of KcsA in high K+" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CO", "DGA", "F09", "IND", "K", "PO4", "XA7" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "VOLTAGE-GATED POTASSIUM CHANNEL KCSA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4UUJ", "evidence_id": "EV-PDB-4UUJ-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "4UUJ", "doi": "10.1021/BI500525S", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4UUJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "POTASSIUM CHANNEL KCSA-FAB WITH TETRAHEXYLAMMONIUM" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.75, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5E1A", "evidence_id": "EV-PDB-5E1A-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.4 }, "provenance": { "deposit_id": "5E1A", "doi": "10.1085/jgp.201611602", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5E1A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of KcsA with L24C/R117C mutations" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DGA", "F09", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -193.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5EBL", "evidence_id": "EV-PDB-5EBL-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "5EBL", "doi": "10.1016/j.str.2016.02.021", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5EBL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "KcsA T75G in the Conductive State" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DGA", "F09", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -193.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5EBM", "evidence_id": "EV-PDB-5EBM-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "5EBM", "doi": "10.1016/j.str.2016.02.021", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5EBM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "KcsA T75G mutant in the nonconductive state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DGA", "F09", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -193.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5EBW", "evidence_id": "EV-PDB-5EBW-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "5EBW", "doi": "10.1016/j.str.2016.02.021", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5EBW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "KcsA with G77ester mutation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DGA", "F09", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -193.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5EC2", "evidence_id": "EV-PDB-5EC2-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "5EC2", "doi": "10.1016/j.str.2016.02.021", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5EC2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "KcsA with V76ester+G77dA mutations" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -193.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5J9P", "evidence_id": "EV-PDB-5J9P-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.85 }, "provenance": { "deposit_id": "5J9P", "doi": "10.1021/acs.biochem.6b00488", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5J9P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "KcsA in vitro" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1EM", "F09", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -123.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5VKE", "evidence_id": "EV-PDB-5VKE-3", "mappings": [ { "confidence": "medium", "justification": "Title describes an open or partially open gate.", "rule": "kcsa-open-title", "state_id": "KcsA-open-inactivated", "who": "rule:kcsa-open-title" } ], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.37 }, "provenance": { "deposit_id": "5VKE", "doi": "10.7554/eLife.28032", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5VKE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Open conformation of KcsA deep-inactivated" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DGA", "F09", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6PA0", "evidence_id": "EV-PDB-6PA0-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.05 }, "provenance": { "deposit_id": "6PA0", "doi": "10.1073/pnas.1901888116", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6PA0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the G77A mutant in Sodium Chloride" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BA", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -175.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6W0A", "evidence_id": "EV-PDB-6W0A-3", "mappings": [ { "confidence": "medium", "justification": "Title describes an open or partially open gate.", "rule": "kcsa-open-title", "state_id": "KcsA-open-inactivated", "who": "rule:kcsa-open-title" } ], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.237 }, "provenance": { "deposit_id": "6W0A", "doi": "10.1016/j.jmb.2020.06.012", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6W0A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Open-gate KcsA soaked in 1 mM BaCl2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BA", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -175.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6W0C", "evidence_id": "EV-PDB-6W0C-3", "mappings": [ { "confidence": "medium", "justification": "Title describes an open or partially open gate.", "rule": "kcsa-open-title", "state_id": "KcsA-open-inactivated", "who": "rule:kcsa-open-title" } ], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.556 }, "provenance": { "deposit_id": "6W0C", "doi": "10.1016/j.jmb.2020.06.012", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6W0C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Open-gate KcsA soaked in 4 mM BaCl2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BA", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -175.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6W0D", "evidence_id": "EV-PDB-6W0D-3", "mappings": [ { "confidence": "medium", "justification": "Title describes an open or partially open gate.", "rule": "kcsa-open-title", "state_id": "KcsA-open-inactivated", "who": "rule:kcsa-open-title" } ], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.639 }, "provenance": { "deposit_id": "6W0D", "doi": "10.1016/j.jmb.2020.06.012", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6W0D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Open-gate KcsA soaked in 5 mM BaCl2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BA", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -175.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6W0E", "evidence_id": "EV-PDB-6W0E-3", "mappings": [ { "confidence": "medium", "justification": "Title describes an open or partially open gate.", "rule": "kcsa-open-title", "state_id": "KcsA-open-inactivated", "who": "rule:kcsa-open-title" } ], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.512 }, "provenance": { "deposit_id": "6W0E", "doi": "10.1016/j.jmb.2020.06.012", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6W0E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Open-gate KcsA soaked in 10 mM BaCl2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -175.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6W0F", "evidence_id": "EV-PDB-6W0F-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "6W0F", "doi": "10.1016/j.jmb.2020.06.012", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6W0F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Closed-gate KcsA soaked in 0mM KCl/5mM BaCl2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -175.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6W0G", "evidence_id": "EV-PDB-6W0G-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "6W0G", "doi": "10.1016/j.jmb.2020.06.012", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6W0G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Closed-gate KcsA soaked in 1mM KCl/5mM BaCl2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -175.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6W0I", "evidence_id": "EV-PDB-6W0I-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.328 }, "provenance": { "deposit_id": "6W0I", "doi": "10.1016/j.jmb.2020.06.012", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6W0I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Closed-gate KcsA soaked in 10mM KCl/5mM BaCl2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -175.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6W0J", "evidence_id": "EV-PDB-6W0J-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "6W0J", "doi": "10.1016/j.jmb.2020.06.012", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6W0J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Closed-gate KcsA incubated in BaCl2/NaCl" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -180.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7M2J", "evidence_id": "EV-PDB-7M2J-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.201 }, "provenance": { "deposit_id": "7M2J", "doi": "10.1016/j.jmb.2021.167296", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7M2J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structural Snapshots of Intermediates in the Gating of a K+ Channel" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7MDJ", "evidence_id": "EV-PDB-7MDJ-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.75 }, "provenance": { "deposit_id": "7MDJ", "doi": "10.1085/jgp.202112965", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7MDJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The structure of KcsA in complex with a synthetic Fab" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BA", "DGA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -175.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7MHX", "evidence_id": "EV-PDB-7MHX-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.85 }, "provenance": { "deposit_id": "7MHX", "doi": "10.1038/s41467-022-28866-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7MHX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "KcsA E71V closed gate with Ba2+" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -175.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7MK6", "evidence_id": "EV-PDB-7MK6-3", "mappings": [ { "confidence": "medium", "justification": "Title describes an open or partially open gate.", "rule": "kcsa-open-title", "state_id": "KcsA-open-inactivated", "who": "rule:kcsa-open-title" } ], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "7MK6", "doi": "10.1038/s41467-022-28866-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7MK6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "KcsA open gate E71V mutant with sodium" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DGA", "F09", "K", "TBA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.25, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7RP0", "evidence_id": "EV-PDB-7RP0-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.48 }, "provenance": { "deposit_id": "7RP0", "doi": "10.1016/j.jmb.2021.167296", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7RP0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structural Snapshots of Intermediates in the Gating of a K+ Channel" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K", "TBA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.25, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8THN", "evidence_id": "EV-PDB-8THN-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.9 }, "provenance": { "deposit_id": "8THN", "doi": "10.1016/j.jbc.2023.105517", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8THN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "KcsA M96V mutant with Y78ester in High K+" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -175.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7MUB", "evidence_id": "EV-PDB-7MUB-3", "mappings": [ { "confidence": "medium", "justification": "Title describes an open or partially open gate.", "rule": "kcsa-open-title", "state_id": "KcsA-open-inactivated", "who": "rule:kcsa-open-title" } ], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "7MUB", "doi": "10.1038/s41467-022-28866-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7MUB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "KcsA Open gate E71V mutant in Potassium" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -175.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7MJT", "evidence_id": "EV-PDB-7MJT-3", "mappings": [ { "confidence": "medium", "justification": "Title describes an open or partially open gate.", "rule": "kcsa-open-title", "state_id": "KcsA-open-inactivated", "who": "rule:kcsa-open-title" } ], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.3 }, "provenance": { "deposit_id": "7MJT", "doi": "10.1038/s41467-022-28866-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7MJT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "KcsA open gate E71V mutant with Barium" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -175.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7MHR", "evidence_id": "EV-PDB-7MHR-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.77 }, "provenance": { "deposit_id": "7MHR", "doi": "10.1038/s41467-022-28866-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7MHR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "KcsA E71V closed gate with K+" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1EM", "F09", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -180.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7M2I", "evidence_id": "EV-PDB-7M2I-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.695 }, "provenance": { "deposit_id": "7M2I", "doi": "10.1016/j.jmb.2021.167296", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7M2I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structural Snapshots of Intermediates in the Gating of a K+ Channel" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DGA", "F09", "K", "TBA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.25, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C,F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7M2H", "evidence_id": "EV-PDB-7M2H-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.642 }, "provenance": { "deposit_id": "7M2H", "doi": "10.1016/j.jmb.2021.167296", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7M2H" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structural Snapshots of Intermediates in the Gating of a K+ Channel" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -175.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6W0H", "evidence_id": "EV-PDB-6W0H-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "6W0H", "doi": "10.1016/j.jmb.2020.06.012", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6W0H" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Closed-gate KcsA soaked in 5mM KCl/5mM BaCl2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BA", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -175.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6W0B", "evidence_id": "EV-PDB-6W0B-3", "mappings": [ { "confidence": "medium", "justification": "Title describes an open or partially open gate.", "rule": "kcsa-open-title", "state_id": "KcsA-open-inactivated", "who": "rule:kcsa-open-title" } ], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.604 }, "provenance": { "deposit_id": "6W0B", "doi": "10.1016/j.jmb.2020.06.012", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6W0B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Open-gate KcsA soaked in 2 mM BaCl2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1EM", "F09", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6NFV", "evidence_id": "EV-PDB-6NFV-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.13 }, "provenance": { "deposit_id": "6NFV", "doi": "10.1073/pnas.1901888116", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6NFV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the KcsA-G77C mutant or the 2,4-ion bound configuration of a K+ channel selectivity filter." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1EM", "F09", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6NFU", "evidence_id": "EV-PDB-6NFU-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.09 }, "provenance": { "deposit_id": "6NFU", "doi": "10.1073/pnas.1901888116", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6NFU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the KcsA-G77A mutant or the 2,4-ion bound configuration of a K+ channel selectivity filter." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1EM", "F09", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5VKH", "evidence_id": "EV-PDB-5VKH-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.25 }, "provenance": { "deposit_id": "5VKH", "doi": "10.7554/eLife.28032", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5VKH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Closed conformation of KcsA Y82A-F103A mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1EM", "F09", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5VK6", "evidence_id": "EV-PDB-5VK6-3", "mappings": [ { "confidence": "medium", "justification": "Title describes an open or partially open gate.", "rule": "kcsa-open-title", "state_id": "KcsA-open-inactivated", "who": "rule:kcsa-open-title" } ], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.25 }, "provenance": { "deposit_id": "5VK6", "doi": "10.7554/eLife.28032", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5VK6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Open conformation of KcsA non-inactivating E71A mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DGA", "F09", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -193.15 }, "construct": { "description": "pH-gated potassium channel KcsA (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5EC1", "evidence_id": "EV-PDB-5EC1-3", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.75 }, "provenance": { "deposit_id": "5EC1", "doi": "10.1016/j.str.2016.02.021", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5EC1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "KcsA with V76ester mutation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.2, "salt_mM": null, "temperature_c": 49.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=15853", "evidence_id": "EV-BMRB-15853", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr15853", "doi": "10.13018/BMR15853", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=15853" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Local and global structure of the monomeric subunit of the potassium channel KcsA probed by NMR" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.0, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=27676", "evidence_id": "EV-BMRB-27676", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr27676", "doi": "10.13018/BMR27676", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=27676" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H/13C/15N Assignments for the TM domains of the KcsA potassium channel" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.0, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=27678", "evidence_id": "EV-BMRB-27678", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr27678", "doi": "10.13018/BMR27678", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=27678" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H/13C/15N Assignments for the TM domains of the KcsA potassium channel" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.0, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=27679", "evidence_id": "EV-BMRB-27679", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr27679", "doi": "10.13018/BMR27679", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=27679" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H/13C/15N Assignments for the TM domains of the KcsA potassium channel" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.0, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=27680", "evidence_id": "EV-BMRB-27680", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr27680", "doi": "10.13018/BMR27680", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=27680" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H/13C/15N Assignments for the TM domains of the KcsA potassium channel" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.0, "salt_mM": null, "temperature_c": 49.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=7428", "evidence_id": "EV-BMRB-7428", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr7428", "doi": "10.13018/BMR7428", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=7428" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Local and global structure of the monomeric subunit of the potassium channel KcsA probed by NMR" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_silico", "ions": [], "ligands": [], "notes": "Computed prediction; no experimental conditions.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "AlphaFold Monomer v2.0 pipeline, residues 1-160", "labels": [] }, "data_format": "mmCIF, PAE JSON", "data_level": "processed", "data_link": "https://alphafold.ebi.ac.uk/entry/P0A334", "evidence_id": "EV-AFDB-AF-P0A334-F1", "mappings": [], "molecule_id": "P0A334", "observable": { "type": "plddt", "uncertainty": null, "unit": "pLDDT", "value": 89.62 }, "provenance": { "deposit_id": "AF-P0A334-F1", "doi": null, "licence": "CC BY 4.0", "retrieved": "2026-10-19", "source": "AlphaFold DB", "url": "https://alphafold.ebi.ac.uk/entry/P0A334" }, "reader": null, "source_kind": "computed", "technique": "af_prediction", "title": "AlphaFold DB prediction AF-P0A334-F1" } ], "models": [ { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-1K4C-3" ], "file": "models/P0A334/KcsA-closed-conductive.cif", "format": "mmCIF", "model_id": "KcsA-closed-conductive-cif", "molecule_id": "P0A334", "provenance": { "deposit_id": "1K4C", "doi": "10.1038/35102009", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/1K4C.cif" }, "state_id": "KcsA-closed-conductive" }, { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-1K4C-3" ], "file": "models/P0A334/KcsA-closed-conductive.pdb", "format": "PDB", "model_id": "KcsA-closed-conductive-pdb", "molecule_id": "P0A334", "provenance": { "deposit_id": "1K4C", "doi": "10.1038/35102009", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/1K4C.pdb" }, "state_id": "KcsA-closed-conductive" }, { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-1K4D-3" ], "file": "models/P0A334/KcsA-closed-collapsed.cif", "format": "mmCIF", "model_id": "KcsA-closed-collapsed-cif", "molecule_id": "P0A334", "provenance": { "deposit_id": "1K4D", "doi": "10.1038/35102009", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/1K4D.cif" }, "state_id": "KcsA-closed-collapsed" }, { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-1K4D-3" ], "file": "models/P0A334/KcsA-closed-collapsed.pdb", "format": "PDB", "model_id": "KcsA-closed-collapsed-pdb", "molecule_id": "P0A334", "provenance": { "deposit_id": "1K4D", "doi": "10.1038/35102009", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/1K4D.pdb" }, "state_id": "KcsA-closed-collapsed" }, { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-3F5W-3" ], "file": "models/P0A334/KcsA-open-inactivated.cif", "format": "mmCIF", "model_id": "KcsA-open-inactivated-cif", "molecule_id": "P0A334", "provenance": { "deposit_id": "3F5W", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/3F5W.cif" }, "state_id": "KcsA-open-inactivated" }, { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-3F5W-3" ], "file": "models/P0A334/KcsA-open-inactivated.pdb", "format": "PDB", "model_id": "KcsA-open-inactivated-pdb", "molecule_id": "P0A334", "provenance": { "deposit_id": "3F5W", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/3F5W.pdb" }, "state_id": "KcsA-open-inactivated" } ], "molecule": { "components": [], "domains": [], "gene": "kcsA", "identifiers": { "genbank": null, "isoform": null, "nakb": null, "pdb": [], "rfam": null, "rnacentral": null, "uniprot": "P0A334" }, "ligands": [], "modifications": [], "molecule_id": "P0A334", "molecule_type": "protein", "name": "pH-gated potassium channel KcsA", "organism": { "name": "Streptomyces lividans", "taxon_id": 1916 }, "provenance": { "deposit_id": "P0A334", "doi": null, "licence": "CC BY 4.0 (UniProt)", "retrieved": "2026-10-19", "source": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P0A334/entry" }, "sequence": "MPPMLSGLLARLVKLLLGRHGSALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGHFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR", "sequence_length": 160 }, "molecule_id": "P0A334", "states": [ { "assumptions": [], "basis": "observed", "description": "Inner gate closed and selectivity filter in the conductive conformation at high K+, as in 1K4C.", "family_label": null, "molecule_id": "P0A334", "name": "gate closed, selectivity filter conductive (high K+)", "parent_state": null, "population": null, "provenance": { "deposit_id": null, "doi": null, "licence": "Project licence (pending decision)", "retrieved": "2026-10-19", "source": "Conformome curation (P0A334.yaml)", "url": "https://github.com/matth55/conformome/blob/HEAD/curation/P0A334.yaml" }, "representative_model": "KcsA-closed-conductive-cif", "secondary_structure": null, "state_id": "KcsA-closed-conductive", "status": "draft" }, { "assumptions": [], "basis": "observed", "description": "Selectivity filter collapsed at low K+, as in 1K4D.", "family_label": null, "molecule_id": "P0A334", "name": "gate closed, selectivity filter collapsed (low K+)", "parent_state": null, "population": null, "provenance": { "deposit_id": null, "doi": null, "licence": "Project licence (pending decision)", "retrieved": "2026-10-19", "source": "Conformome curation (P0A334.yaml)", "url": "https://github.com/matth55/conformome/blob/HEAD/curation/P0A334.yaml" }, "representative_model": "KcsA-closed-collapsed-cif", "secondary_structure": null, "state_id": "KcsA-closed-collapsed", "status": "draft" }, { "assumptions": [], "basis": "observed", "description": "Inner gate open (32 Å at T112) with an inactivated filter, as in 3F5W.", "family_label": null, "molecule_id": "P0A334", "name": "gate open, filter inactivated", "parent_state": null, "population": null, "provenance": { "deposit_id": null, "doi": null, "licence": "Project licence (pending decision)", "retrieved": "2026-10-19", "source": "Conformome curation (P0A334.yaml)", "url": "https://github.com/matth55/conformome/blob/HEAD/curation/P0A334.yaml" }, "representative_model": "KcsA-open-inactivated-cif", "secondary_structure": null, "state_id": "KcsA-open-inactivated", "status": "draft" } ], "transitions": [] }