{
  "conflicts": [],
  "coverage": {
    "cells": {},
    "data_levels": {},
    "single_method_states": [],
    "states": [],
    "techniques": [
      "xray",
      "cryoem",
      "nmr_dynamics",
      "nmr_shifts",
      "force_spectroscopy",
      "af_prediction"
    ],
    "unmapped_evidence": 102
  },
  "curation": {
    "as_of": "",
    "curator": "none",
    "file": "",
    "status": "uncurated"
  },
  "evidence": [
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "MMA"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.2,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FimH PROTEIN (chains B,D,F,H,J,L,N,P)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/1KIU",
      "evidence_id": "EV-PDB-1KIU-2",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.0
      },
      "provenance": {
        "deposit_id": "1KIU",
        "doi": "10.1046/j.1365-2958.2002.02915.x",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/1KIU"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "FimH adhesin Q133N mutant-FimC chaperone complex with methyl-alpha-D-mannose"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "MAN"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.2,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FIMH PROTEIN (chains B,D,F,H,J,L,N,P)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/1KLF",
      "evidence_id": "EV-PDB-1KLF-2",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.79
      },
      "provenance": {
        "deposit_id": "1KLF",
        "doi": "10.1046/j.1365-2958.2002.02915.x",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/1KLF"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "FIMH ADHESIN-FIMC CHAPERONE COMPLEX WITH D-MANNOSE"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.4,
        "salt_mM": null,
        "temperature_c": -100.15
      },
      "construct": {
        "description": "MANNOSE-SPECIFIC ADHESIN FIMH (chains B,D,F,H,J,L,N,P)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/1QUN",
      "evidence_id": "EV-PDB-1QUN-2",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.8
      },
      "provenance": {
        "deposit_id": "1QUN",
        "doi": "10.1126/science.285.5430.1061",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/1QUN"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "X-RAY STRUCTURE OF THE FIMC-FIMH CHAPERONE ADHESIN COMPLEX FROM UROPATHOGENIC E.COLI"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "CAC",
          "DEG",
          "MPD"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 6.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FimH protein (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/1TR7",
      "evidence_id": "EV-PDB-1TR7-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.1
      },
      "provenance": {
        "deposit_id": "1TR7",
        "doi": "10.1111/j.1365-2958.2004.04415.x",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/1TR7"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "FimH adhesin receptor binding domain from uropathogenic E. coli"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "EDO"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 6.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FimH protein (chains H)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/1ZE3",
      "evidence_id": "EV-PDB-1ZE3-2",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.84
      },
      "provenance": {
        "deposit_id": "1ZE3",
        "doi": "10.1038/sj.emboj.7600693",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/1ZE3"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal Structure of the Ternary Complex of FIMD (N-Terminal Domain) with FIMC and the Pilin Domain of FIMH"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "NI",
          "SO4",
          "branched: alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "PROTEIN FIMH (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/2VCO",
      "evidence_id": "EV-PDB-2VCO-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.1
      },
      "provenance": {
        "deposit_id": "2VCO",
        "doi": "10.1371/JOURNAL.PONE.0002040",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/2VCO"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of the fimbrial adhesin FimH in complex with its high-mannose epitope"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "SO4"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.5,
        "salt_mM": null,
        "temperature_c": -196.15
      },
      "construct": {
        "description": "Type 1 fimbrial adhesin (chains A,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/3RFZ",
      "evidence_id": "EV-PDB-3RFZ-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.8
      },
      "provenance": {
        "deposit_id": "3RFZ",
        "doi": "10.1038/nature10109",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/3RFZ"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of the FimD usher bound to its cognate FimC:FimH substrate"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "BWG",
          "CL"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "PROTEIN FIMH (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/3ZL1",
      "evidence_id": "EV-PDB-3ZL1-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.551
      },
      "provenance": {
        "deposit_id": "3ZL1",
        "doi": "10.1021/JM400723N",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/3ZL1"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "A thiazolyl-mannoside bound to FimH, monoclinic space group"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "HNV"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FIMH (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4ATT",
      "evidence_id": "EV-PDB-4ATT-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.251
      },
      "provenance": {
        "deposit_id": "4ATT",
        "doi": "10.1021/ML400269V",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4ATT"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "FimH lectin domain co-crystal with a alpha-D-mannoside O-linked to a propynyl para methoxy phenyl"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "HNW"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FIMH (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4AUJ",
      "evidence_id": "EV-PDB-4AUJ-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.527
      },
      "provenance": {
        "deposit_id": "4AUJ",
        "doi": "10.1021/ML400269V",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4AUJ"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "FimH lectin domain co-crystal with a alpha-D-mannoside O-linked to para hydroxypropargyl phenyl"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "HNV",
          "NI",
          "SO4"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.6,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FIMH (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4AV0",
      "evidence_id": "EV-PDB-4AV0-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.099
      },
      "provenance": {
        "deposit_id": "4AV0",
        "doi": "10.1021/BI300251R",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4AV0"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of the FimH lectin domain in the trigonal space group, in complex with a methoxy phenyl propynyl alpha-D-mannoside at 2.1 A resolution"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "FYZ",
          "SO4"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.4,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FIMH (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4AV5",
      "evidence_id": "EV-PDB-4AV5-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.4
      },
      "provenance": {
        "deposit_id": "4AV5",
        "doi": "10.1021/BI300251R",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4AV5"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of a triclinic crystal of the FimH lectin domain in complex with a propynyl biphenyl alpha-D-mannoside, at 1.4 A resolution"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "NI",
          "SO4",
          "XNS"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.6,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FIMH (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4AVI",
      "evidence_id": "EV-PDB-4AVI-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.4
      },
      "provenance": {
        "deposit_id": "4AVI",
        "doi": "10.1021/BI300251R",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4AVI"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of the FimH lectin domain in the trigonal space group, in complex with a methyl ester octyl alpha-D-mannoside at 2.4 A resolution"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "CWX",
          "GOL"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 4.7,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "PROTEIN FIMH (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4CSS",
      "evidence_id": "EV-PDB-4CSS-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.069
      },
      "provenance": {
        "deposit_id": "4CSS",
        "doi": "10.1021/JM501524Q",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4CSS"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of FimH in complex with a sulfonamide biphenyl alpha D-mannoside"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "CWK"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "PROTEIN FIMH (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4CST",
      "evidence_id": "EV-PDB-4CST-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.1
      },
      "provenance": {
        "deposit_id": "4CST",
        "doi": "10.1021/JM501524Q",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4CST"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of FimH in complex with 3'-Chloro-4'-(alpha-D-mannopyranosyloxy)-biphenyl-4-carbonitrile"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Protein FimH (chains H)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4J3O",
      "evidence_id": "EV-PDB-4J3O-2",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.8
      },
      "provenance": {
        "deposit_id": "4J3O",
        "doi": "10.1038/nature12007",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4J3O"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of the FimD usher traversed by the pilus tip complex assembly composed of FimC:FimF:FimG:FimH"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "3XJ"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 4.7,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Protein FimH (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4X5P",
      "evidence_id": "EV-PDB-4X5P-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 0.997
      },
      "provenance": {
        "deposit_id": "4X5P",
        "doi": "10.1002/cbic.201402714",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4X5P"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of FimH in complex with a benzoyl-amidophenyl alpha-D-mannopyranoside"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "3XN"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 4.7,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Protein FimH (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4X5Q",
      "evidence_id": "EV-PDB-4X5Q-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.12
      },
      "provenance": {
        "deposit_id": "4X5Q",
        "doi": "10.1002/cbic.201402714",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4X5Q"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of FimH in complex with 5-nitro-indolinylphenyl alpha-D-mannopyranoside"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "3XO",
          "SO4"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.0,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Protein FimH (chains A,B,C)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4X5R",
      "evidence_id": "EV-PDB-4X5R-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.65
      },
      "provenance": {
        "deposit_id": "4X5R",
        "doi": "10.1002/cbic.201402714",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4X5R"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of FimH in complex with a squaryl-phenyl alpha-D-mannopyranoside derivative"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "KGM"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 5.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Protein FimH (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4XO8",
      "evidence_id": "EV-PDB-4XO8-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.698
      },
      "provenance": {
        "deposit_id": "4XO8",
        "doi": "10.1038/ncomms10738",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4XO8"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of the FimH lectin domain from E.coli K12 in complex with heptyl alpha-D-mannopyrannoside"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 5.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Protein FimH (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4XO9",
      "evidence_id": "EV-PDB-4XO9-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.14
      },
      "provenance": {
        "deposit_id": "4XO9",
        "doi": "10.1038/ncomms10738",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4XO9"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of a FimH*DsG complex from E.coli K12 in space group C2"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "KGM",
          "SO4"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 6.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Protein FimH (chains A,C,E,G)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4XOB",
      "evidence_id": "EV-PDB-4XOB-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.003
      },
      "provenance": {
        "deposit_id": "4XOB",
        "doi": "10.1038/ncomms10738",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4XOB"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of a FimH*DsF complex from E.coli K12 with bound heptyl alpha-D-mannopyrannoside"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "KGM"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FimH protein (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4XOC",
      "evidence_id": "EV-PDB-4XOC-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.42
      },
      "provenance": {
        "deposit_id": "4XOC",
        "doi": "10.1038/ncomms10738",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4XOC"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of the FimH lectin domain from E.coli F18 in complex with heptyl alpha-D-mannopyrannoside"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 5.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FimH protein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4XOD",
      "evidence_id": "EV-PDB-4XOD-2",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.14
      },
      "provenance": {
        "deposit_id": "4XOD",
        "doi": "10.1038/ncomms10738",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4XOD"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of a FimH*DsG complex from E.coli F18"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "CAC",
          "KGM"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 6.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FimH protein (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4XOE",
      "evidence_id": "EV-PDB-4XOE-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.4
      },
      "provenance": {
        "deposit_id": "4XOE",
        "doi": "10.1038/ncomms10738",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4XOE"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of a FimH*DsG complex from E.coli F18 with bound heptyl alpha-D-mannopyrannoside"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "NI",
          "Z47"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.6,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FIMH (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5ABZ",
      "evidence_id": "EV-PDB-5ABZ-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.4
      },
      "provenance": {
        "deposit_id": "5ABZ",
        "doi": "10.1107/S2052252516002487",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5ABZ"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Complex of the FimH lectin with a C-linked naphtyl alpha-D-mannoside in soaked trigonal crystals at 2.40 A resolution"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "51C",
          "SO4"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 5.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Protein FimH (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5CGB",
      "evidence_id": "EV-PDB-5CGB-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.6
      },
      "provenance": {
        "deposit_id": "5CGB",
        "doi": "10.1039/c7sc04289b",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5CGB"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of FimH in complex with heptyl alpha-D-septanoside"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "5U7",
          "GOL"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 5.8,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Protein FimH (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5F2F",
      "evidence_id": "EV-PDB-5F2F-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.665
      },
      "provenance": {
        "deposit_id": "5F2F",
        "doi": "10.1002/cmdc.201600006",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5F2F"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of para-biphenyl-2-methyl-3', 5' di-methyl amide mannoside bound to FimH lectin domain"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "KGM",
          "NA"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 6.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FIMH (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5FS5",
      "evidence_id": "EV-PDB-5FS5-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.42
      },
      "provenance": {
        "deposit_id": "5FS5",
        "doi": "10.1107/S2052252516016675",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5FS5"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Breaking down the wall: mutation of the tyrosine gate of the universal Escherichia coli fimbrial adhesin FimH"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "3X8"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.8,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FimH (chains A,B,C,D,E,F,G,H)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5FWR",
      "evidence_id": "EV-PDB-5FWR-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.13
      },
      "provenance": {
        "deposit_id": "5FWR",
        "doi": "10.1107/S2052252516016675",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5FWR"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Breaking down the wall: mutation of the tyrosine gate of the universal Escherichia coli fimbrial adhesin FimH"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "EDT"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FimH (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5FX3",
      "evidence_id": "EV-PDB-5FX3-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.9
      },
      "provenance": {
        "deposit_id": "5FX3",
        "doi": "10.1107/S2052252516016675",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5FX3"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Breaking down the wall: mutation of the tyrosine gate of the universal Escherichia coli fimbrial adhesin FimH"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "6LS"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Protein FimH (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5L4T",
      "evidence_id": "EV-PDB-5L4T-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.9
      },
      "provenance": {
        "deposit_id": "5L4T",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5L4T"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of FimH lectin domain in complex with 2-Deoxy-Heptylmannoside"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "6KU"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Protein FimH (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5L4X",
      "evidence_id": "EV-PDB-5L4X-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.9
      },
      "provenance": {
        "deposit_id": "5L4X",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5L4X"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of FimH lectin domain in complex with 4-Deoxy-Heptylmannoside"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "6KH"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Protein FimH (chains A,B,C)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5L4W",
      "evidence_id": "EV-PDB-5L4W-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.9
      },
      "provenance": {
        "deposit_id": "5L4W",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5L4W"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of FimH lectin domain in complex with 3-Fluoro-Heptylmannoside"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "6KW"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Protein FimH (chains A,B,C)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5L4V",
      "evidence_id": "EV-PDB-5L4V-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.99
      },
      "provenance": {
        "deposit_id": "5L4V",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5L4V"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of FimH lectin domain in complex with 3-Deoxy-Heptylmannoside"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "6KS"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Protein FimH (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5L4U",
      "evidence_id": "EV-PDB-5L4U-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.1
      },
      "provenance": {
        "deposit_id": "5L4U",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5L4U"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of FimH lectin domain in complex with 2-Fluoro-Heptylmannoside"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "MMA"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Protein FimH (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5JCR",
      "evidence_id": "EV-PDB-5JCR-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.701
      },
      "provenance": {
        "deposit_id": "5JCR",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5JCR"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of the FimH lectin domain from E.coli K12 in complex with methyl alpha-D-mannopyrannoside in spacegroup P212121"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "MMA",
          "SO4"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Protein FimH (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5JCQ",
      "evidence_id": "EV-PDB-5JCQ-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.602
      },
      "provenance": {
        "deposit_id": "5JCQ",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5JCQ"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of the FimH lectin domain from E.coli K12 in complex with methyl alpha-D-mannopyrannoside in spacegroup P21"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "5US"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 5.8,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Protein FimH (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5F3F",
      "evidence_id": "EV-PDB-5F3F-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.76
      },
      "provenance": {
        "deposit_id": "5F3F",
        "doi": "10.1021/acs.jmedchem.6b00948",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5F3F"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of para-biphenyl-2-methyl-3'-methyl amide mannoside bound to FimH lectin domain"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 5.0,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Protein FimH (chains A,C,E,G)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4XOA",
      "evidence_id": "EV-PDB-4XOA-2",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.541
      },
      "provenance": {
        "deposit_id": "4XOA",
        "doi": "10.1038/ncomms10738",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4XOA"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of a FimH*DsG complex from E.coli K12 in space group P1"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "3X8"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.0,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Protein FimH (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4X50",
      "evidence_id": "EV-PDB-4X50-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.0
      },
      "provenance": {
        "deposit_id": "4X50",
        "doi": "10.1002/cbic.201402714",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4X50"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of FimH in complex with biphenyl alpha-D-mannopyranoside"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "GOL",
          "KGM",
          "NA"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Protein FimH (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4LOV",
      "evidence_id": "EV-PDB-4LOV-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.5
      },
      "provenance": {
        "deposit_id": "4LOV",
        "doi": "10.1021/jm401666c",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4LOV"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of FimH in complex with Heptylmannoside"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "FVQ",
          "NI",
          "SO4"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.6,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FIMH (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4AVK",
      "evidence_id": "EV-PDB-4AVK-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.4
      },
      "provenance": {
        "deposit_id": "4AVK",
        "doi": "10.1021/BI300251R",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4AVK"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of trigonal FimH lectin domain crystal soaked with an alpha- D-mannoside O-linked to propynyl pyridine at 2.4A resolution"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "J73",
          "NI",
          "SO4"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.6,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FIMH (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4AVJ",
      "evidence_id": "EV-PDB-4AVJ-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.105
      },
      "provenance": {
        "deposit_id": "4AVJ",
        "doi": "10.1021/BI300251R",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4AVJ"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of the FimH lectin domain in the trigonal space group, in complex with a methanol triazol ethyl phenyl alpha-D-mannoside at 2.1 A resolution"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "FK9",
          "NI",
          "SO4"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.6,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FIMH (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4AVH",
      "evidence_id": "EV-PDB-4AVH-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.105
      },
      "provenance": {
        "deposit_id": "4AVH",
        "doi": "10.1021/BI300251R",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4AVH"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of the FimH lectin domain in the trigonal space group, in complex with a thioalkyl alpha-D-mannoside at 2.1 A resolution"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "FVQ"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.6,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FIMH (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4AV4",
      "evidence_id": "EV-PDB-4AV4-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.9
      },
      "provenance": {
        "deposit_id": "4AV4",
        "doi": "10.1021/BI300251R",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4AV4"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "FimH lectin domain co-crystal with a alpha-D-mannoside O-linked to a propynyl pyridine"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "HNW",
          "NI",
          "SO4"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.6,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FIMH (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4AUY",
      "evidence_id": "EV-PDB-4AUY-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.102
      },
      "provenance": {
        "deposit_id": "4AUY",
        "doi": "10.1021/BI300251R",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4AUY"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of the FimH lectin domain in the trigonal space group, in complex with an hydroxyl propynyl phenyl alpha-D-mannoside at 2.1 A resolution"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "EDO",
          "NI",
          "SO4"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.6,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FIMH (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/4AUU",
      "evidence_id": "EV-PDB-4AUU-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.6
      },
      "provenance": {
        "deposit_id": "4AUU",
        "doi": "10.1021/BI300251R",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/4AUU"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of apo FimH lectin domain at 1.5 A resolution"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "BWG"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 6.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "PROTEIN FIMH (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/3ZL2",
      "evidence_id": "EV-PDB-3ZL2-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.251
      },
      "provenance": {
        "deposit_id": "3ZL2",
        "doi": "10.1021/JM400723N",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/3ZL2"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "A thiazolyl-mannoside bound to FimH, orthorhombic space group"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "DEG",
          "GOL"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FIMH PROTEIN (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/1UWF",
      "evidence_id": "EV-PDB-1UWF-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.69
      },
      "provenance": {
        "deposit_id": "1UWF",
        "doi": "10.1111/J.1365-2958.2004.04415.X",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/1UWF"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "1.7 A resolution structure of the receptor binding domain of the FimH adhesin from uropathogenic E. coli"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "6K3"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Protein FimH (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5L4Y",
      "evidence_id": "EV-PDB-5L4Y-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.9
      },
      "provenance": {
        "deposit_id": "5L4Y",
        "doi": null,
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5L4Y"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of FimH lectin domain in complex with 4-Fluoro-Heptylmannoside"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "SO4"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Protein FimH (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5MCA",
      "evidence_id": "EV-PDB-5MCA-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.604
      },
      "provenance": {
        "deposit_id": "5MCA",
        "doi": "10.1074/jbc.M117.802942",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5MCA"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of FimH-LD R60P variant in the apo state"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "NI",
          "XKA"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Protein FimH (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5MTS",
      "evidence_id": "EV-PDB-5MTS-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.6
      },
      "provenance": {
        "deposit_id": "5MTS",
        "doi": "10.1002/cmdc.201700061",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5MTS"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Complex of FimH lectin with a TazMan (thiazolylaminomannosides) family member known as potent anti-adhesive agent at 2.6 A resolution"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "AH2"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Protein FimH (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/5MUC",
      "evidence_id": "EV-PDB-5MUC-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.6
      },
      "provenance": {
        "deposit_id": "5MUC",
        "doi": "10.1002/chem.201802599",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/5MUC"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of the FimH lectin domain in complex with 1,5-Anhydromannitol"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Type 1 fimbrin D-mannose specific adhesin (chains H)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6E14",
      "evidence_id": "EV-PDB-6E14-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 4.0
      },
      "provenance": {
        "deposit_id": "6E14",
        "doi": "10.1038/s41586-018-0587-z",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6E14"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Handover mechanism of the growing pilus by the bacterial outer membrane usher FimD"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Type 1 fimbrin D-mannose specific adhesin (chains H)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6E15",
      "evidence_id": "EV-PDB-6E15-5",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 5.1
      },
      "provenance": {
        "deposit_id": "6E15",
        "doi": "10.1038/s41586-018-0587-z",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6E15"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Handover mechanism of the growing pilus by the bacterial outer membrane usher FimD"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "EJK",
          "EPE",
          "SO4"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Type 1 fimbrin D-mannose specific adhesin (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6G2R",
      "evidence_id": "EV-PDB-6G2R-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.1
      },
      "provenance": {
        "deposit_id": "6G2R",
        "doi": "10.1002/cmdc.201900051",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6G2R"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of FimH in complex with a tetraflourinated biphenyl alpha D-mannoside"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "EJN",
          "SO4"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Type 1 fimbrin D-mannose specific adhesin (chains A,B,C,D,E,F,G,H,I)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6G2S",
      "evidence_id": "EV-PDB-6G2S-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.2
      },
      "provenance": {
        "deposit_id": "6G2S",
        "doi": "10.1002/cmdc.201900051",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6G2S"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of FimH in complex with a pentaflourinated biphenyl alpha D-mannoside"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "SO4",
          "branched: alpha-D-mannopyranose-(1-2)-methyl alpha-D-mannopyranoside"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Type 1 fimbrin D-mannose specific adhesin (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6GTX",
      "evidence_id": "EV-PDB-6GTX-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.5
      },
      "provenance": {
        "deposit_id": "6GTX",
        "doi": "10.1021/jacs.8b10736",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6GTX"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of the FimH lectin domain from E.coli K12 in complex with the dimannoside Man(alpha1-2)Man"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "branched: alpha-D-mannopyranose-(1-6)-methyl alpha-D-mannopyranoside"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Type 1 fimbrin D-mannose specific adhesin (chains A,B,C,D,E)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6GTY",
      "evidence_id": "EV-PDB-6GTY-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.9
      },
      "provenance": {
        "deposit_id": "6GTY",
        "doi": "10.1021/jacs.8b10736",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6GTY"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of the FimH lectin domain from E.coli K12 in complex with the dimannoside Man(alpha1-6)Man"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "HP6",
          "MAN",
          "TA5",
          "branched: Cycloheptakis-(1-4)-(alpha-D-glucopyranose)"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 6.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FimH (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/6YHW",
      "evidence_id": "EV-PDB-6YHW-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.962
      },
      "provenance": {
        "deposit_id": "6YHW",
        "doi": "10.1002/cbic.201600018",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/6YHW"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Co-crystals in the P212121 space group, of a beta-cyclodextrin spacered by triazole heptyl from alpha-D-mannose, with FimH lectin at 2.00 A resolution."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "EDO",
          "SBQ"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Type 1 fimbrin D-mannose specific adhesin (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7AYN",
      "evidence_id": "EV-PDB-7AYN-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.42
      },
      "provenance": {
        "deposit_id": "7AYN",
        "doi": "10.1016/j.ejmech.2020.113093",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7AYN"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal structure of the lectin domain of the FimH variant Arg98Ala, in complex with Methyl 3-chloro-4-D-mannopyranosyloxy-3-biphenylcarboxylate"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "NI",
          "SO4",
          "branched: alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 9.0,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Type 1 fimbrin D-mannose specific adhesin (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7BHD",
      "evidence_id": "EV-PDB-7BHD-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.4
      },
      "provenance": {
        "deposit_id": "7BHD",
        "doi": "10.1016/j.jbc.2023.104627",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7BHD"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "FimH in complex with alpha1,6 core-fucosylated oligomannose-3, crystallized in the trigonal space group"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "NI",
          "SO4",
          "branched: alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FimH (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7QUO",
      "evidence_id": "EV-PDB-7QUO-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.0
      },
      "provenance": {
        "deposit_id": "7QUO",
        "doi": "10.1016/j.jbc.2023.104627",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7QUO"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "FimH lectin domain in complex with oligomannose-6"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "GOL"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "FimH,F1C putative fimbrial adhesin fusion (chains H,N)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/7SZO",
      "evidence_id": "EV-PDB-7SZO-4",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.8
      },
      "provenance": {
        "deposit_id": "7SZO",
        "doi": "10.1016/j.jmb.2022.167681",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/7SZO"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure of a bacterial fimbrial tip containing FocH"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "RLO"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 5.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Type 1 fimbrin D-mannose specific adhesin (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8BVD",
      "evidence_id": "EV-PDB-8BVD-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 2.995
      },
      "provenance": {
        "deposit_id": "8BVD",
        "doi": "10.3390/pharmaceutics15020527",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8BVD"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "FimH lectin domain in complex with mannose C-linked to quinoline"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "NI",
          "SO4",
          "branched: alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 9.0,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Type 1 fimbrin D-mannose specific adhesin (chains A,B)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8BXY",
      "evidence_id": "EV-PDB-8BXY-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.45
      },
      "provenance": {
        "deposit_id": "8BXY",
        "doi": "10.1016/j.jbc.2023.104627",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8BXY"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "FimH in complex with alpha1,6 core-fucosylated oligomannose-3, crystallized in the trigonal space group"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "NI",
          "SO4",
          "branched: alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 8.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Type 1 fimbrin D-mannose specific adhesin (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8BY3",
      "evidence_id": "EV-PDB-8BY3-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.186
      },
      "provenance": {
        "deposit_id": "8BY3",
        "doi": "10.1016/j.jbc.2023.104627",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8BY3"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "FimH lectin domain in complex with oligomannose-6"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "NAG"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 4.5,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Type 1 fimbrin D-mannose specific adhesin,Protein FimG (chains A,B,C,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8V3J",
      "evidence_id": "EV-PDB-8V3J-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.898
      },
      "provenance": {
        "deposit_id": "8V3J",
        "doi": "10.1371/journal.ppat.1012325",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8V3J"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Structure-Based Engineering of a Highly Immunogenic, Conformationally Stabilized FimH Antigen for a Urinary Tract Infection Vaccine"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Type 1 fimbrin D-mannose specific adhesin FimH, Donor strand complemented with FimG peptide 'triple mutant' (chains D)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/8V93",
      "evidence_id": "EV-PDB-8V93-4",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.12
      },
      "provenance": {
        "deposit_id": "8V93",
        "doi": "10.1371/journal.ppat.1012325",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/8V93"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of E. coli FimH lectin domain bound to Fabs 329-2 and 454-3"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Type 1 fimbrin D-mannose specific adhesin (chains H)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9BOG",
      "evidence_id": "EV-PDB-9BOG-4",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.99
      },
      "provenance": {
        "deposit_id": "9BOG",
        "doi": "10.1073/pnas.2410594121",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9BOG"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Structural basis for adhesin secretion by the outer-membrane usher in type 1 pili"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Type 1 fimbiral adhesin FimH (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9CCS",
      "evidence_id": "EV-PDB-9CCS-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.17
      },
      "provenance": {
        "deposit_id": "9CCS",
        "doi": "10.1126/sciadv.adw0698",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9CCS"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "CryoEM Structure of Escherichia coli FimCH in complex with 2H04 Fab"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Type 1 fimbiral adhesin FimH (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9CCT",
      "evidence_id": "EV-PDB-9CCT-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.46
      },
      "provenance": {
        "deposit_id": "9CCT",
        "doi": "10.1126/sciadv.adw0698",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9CCT"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "CryoEM Structure of Escherichia coli FimCH in complex with B7 Fab"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Type 1 fimbiral adhesin FimH (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9CCU",
      "evidence_id": "EV-PDB-9CCU-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.8
      },
      "provenance": {
        "deposit_id": "9CCU",
        "doi": "10.1126/sciadv.adw0698",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9CCU"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "CryoEM Structure of Escherichia coli FimCH in complex with F7 Fab"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Type 1 fimbiral adhesin FimH (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9CCW",
      "evidence_id": "EV-PDB-9CCW-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.69
      },
      "provenance": {
        "deposit_id": "9CCW",
        "doi": "10.1126/sciadv.adw0698",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9CCW"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "CryoEM Structure of Escherichia coli FimCH in complex with 2C07 Fab"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Type 1 fimbrin D-mannose specific adhesin FimH, Donor strand complemented with FimG peptide 'triple mutant' (chains D)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9D6F",
      "evidence_id": "EV-PDB-9D6F-5",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 4.24
      },
      "provenance": {
        "deposit_id": "9D6F",
        "doi": "10.1371/journal.ppat.1012325",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9D6F"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of E. coli FimH lectin domain bound to Fabs 440-2 and 454-3"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Type 1 fimbrin D-mannose specific adhesin (chains H)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9FY9",
      "evidence_id": "EV-PDB-9FY9-5",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.3
      },
      "provenance": {
        "deposit_id": "9FY9",
        "doi": "10.1038/s41467-025-60325-z",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9FY9"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Cryo-EM structure of the type 1 chaperone-usher pilus FimD-tip complex (FimDHGFC) - Conformer 1"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "branched: alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Type 1 fimbrin D-mannose specific adhesin (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9ME4",
      "evidence_id": "EV-PDB-9ME4-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.2
      },
      "provenance": {
        "deposit_id": "9ME4",
        "doi": "10.1038/s41467-025-65666-3",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9ME4"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Antibody fragments from mAb475 and mAb824 bound to the adhesin protein FimH"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "branched: alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Type 1 fimbrin D-mannose specific adhesin (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9ME6",
      "evidence_id": "EV-PDB-9ME6-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.2
      },
      "provenance": {
        "deposit_id": "9ME6",
        "doi": "10.1038/s41467-025-65666-3",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9ME6"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Antibody fragments from mAb21, mAb475, and mAb824 bound to the adhesin protein FimH"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [
          "MMA"
        ],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Type 1 fimbrin D-mannose specific adhesin (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9ME7",
      "evidence_id": "EV-PDB-9ME7-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.1
      },
      "provenance": {
        "deposit_id": "9ME7",
        "doi": "10.1038/s41467-025-65666-3",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9ME7"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Antibody fragments from mAb21 and mAb824 bound to the adhesin protein FimH containing alpha-methyl mannose"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Type 1 fimbrin D-mannose specific adhesin (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9PTM",
      "evidence_id": "EV-PDB-9PTM-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.4
      },
      "provenance": {
        "deposit_id": "9PTM",
        "doi": "10.1038/s41467-025-65666-3",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9PTM"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Antibody fragment from mAb824 bound to the adhesin protein FimH."
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": 7.0,
        "salt_mM": null,
        "temperature_c": -173.15
      },
      "construct": {
        "description": "Type 1 fimbrin D-mannose specific adhesin (chains B,D)",
        "labels": []
      },
      "data_format": "mmCIF + structure factors",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9Q1V",
      "evidence_id": "EV-PDB-9Q1V-2",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 1.75
      },
      "provenance": {
        "deposit_id": "9Q1V",
        "doi": "10.1101/2025.08.18.670751",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9Q1V"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "xray",
      "title": "Crystal Structure of de novo design FimH minibinder F7 complex"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "Type 1 fimbrin D-mannose specific adhesin (chains A)",
        "labels": []
      },
      "data_format": "mmCIF + EMDB map",
      "data_level": "processed",
      "data_link": "https://www.rcsb.org/structure/9ME5",
      "evidence_id": "EV-PDB-9ME5-1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "resolution",
        "uncertainty": null,
        "unit": "Å",
        "value": 3.1
      },
      "provenance": {
        "deposit_id": "9ME5",
        "doi": "10.1038/s41467-025-65666-3",
        "licence": "CC0 1.0 (wwPDB archive data)",
        "retrieved": "2026-10-19",
        "source": "RCSB PDB",
        "url": "https://www.rcsb.org/structure/9ME5"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "cryoem",
      "title": "Antibody fragments from mAb824 and mAb926 bound to the adhesin protein FimH"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 6.0,
        "salt_mM": null,
        "temperature_c": 24.85
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts, T1 relaxation values, T2 relaxation values",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=19066",
      "evidence_id": "EV-BMRB-19066",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "relaxation_rate",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr19066",
        "doi": "10.13018/BMR19066",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=19066"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_dynamics",
      "title": "Solution structure of the FimH adhesin carbohydrate-binding domain"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 6.0,
        "salt_mM": null,
        "temperature_c": 24.85
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts, T1 relaxation values, T2 relaxation values",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=19256",
      "evidence_id": "EV-BMRB-19256",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "relaxation_rate",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr19256",
        "doi": "10.13018/BMR19256",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=19256"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_dynamics",
      "title": "NMR assignments and backbone amide relaxation data (T1-T2) for the complex of the FimH adhesin carbohydrate-binding domain with heptyl-mannose"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_vitro",
        "ions": [],
        "ligands": [],
        "notes": "From the first sample condition list of the entry.",
        "ph": 7.0,
        "salt_mM": null,
        "temperature_c": 19.85
      },
      "construct": {
        "description": "BMRB data: 13C chemical shifts, 1H chemical shifts",
        "labels": []
      },
      "data_format": "NMR-STAR",
      "data_level": "processed",
      "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=21033",
      "evidence_id": "EV-BMRB-21033",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "chemical_shift",
        "uncertainty": null,
        "unit": null,
        "value": null
      },
      "provenance": {
        "deposit_id": "bmr21033",
        "doi": "10.13018/BMR21033",
        "licence": "CC0 1.0 (verify)",
        "retrieved": "2026-10-19",
        "source": "BMRB",
        "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=21033"
      },
      "reader": null,
      "source_kind": "deposit",
      "technique": "nmr_shifts",
      "title": "Solution structure of Lewis x (Gal-beta1,4-[Fuc-alpha1,3]-GlcNAc-beta) attached to a protein"
    },
    {
      "conditions": {
        "applied_force_pn": null,
        "buffer": null,
        "environment": "in_silico",
        "ions": [],
        "ligands": [],
        "notes": "Computed prediction; no experimental conditions.",
        "ph": null,
        "salt_mM": null,
        "temperature_c": null
      },
      "construct": {
        "description": "AlphaFold Monomer v2.0 pipeline, residues 1-300",
        "labels": []
      },
      "data_format": "mmCIF, PAE JSON",
      "data_level": "processed",
      "data_link": "https://alphafold.ebi.ac.uk/entry/P08191",
      "evidence_id": "EV-AFDB-AF-P08191-F1",
      "mappings": [],
      "molecule_id": "P08191",
      "observable": {
        "type": "plddt",
        "uncertainty": null,
        "unit": "pLDDT",
        "value": 93.12
      },
      "provenance": {
        "deposit_id": "AF-P08191-F1",
        "doi": null,
        "licence": "CC BY 4.0",
        "retrieved": "2026-10-19",
        "source": "AlphaFold DB",
        "url": "https://alphafold.ebi.ac.uk/entry/P08191"
      },
      "reader": null,
      "source_kind": "computed",
      "technique": "af_prediction",
      "title": "AlphaFold DB prediction AF-P08191-F1"
    }
  ],
  "models": [],
  "molecule": {
    "components": [],
    "domains": [],
    "gene": "fimH",
    "identifiers": {
      "genbank": null,
      "isoform": null,
      "nakb": null,
      "pdb": [],
      "rfam": null,
      "rnacentral": null,
      "uniprot": "P08191"
    },
    "ligands": [],
    "modifications": [],
    "molecule_id": "P08191",
    "molecule_type": "protein",
    "name": "Type 1 fimbrin D-mannose specific adhesin",
    "organism": {
      "name": "Escherichia coli (strain K12)",
      "taxon_id": 83333
    },
    "provenance": {
      "deposit_id": "P08191",
      "doi": null,
      "licence": "CC BY 4.0 (UniProt)",
      "retrieved": "2026-10-19",
      "source": "UniProtKB",
      "url": "https://www.uniprot.org/uniprotkb/P08191/entry"
    },
    "sequence": "MKRVITLFAVLLMGWSVNAWSFACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ",
    "sequence_length": 300
  },
  "molecule_id": "P08191",
  "states": [],
  "transitions": []
}