{ "conflicts": [], "coverage": { "cells": { "GB1-native": { "af_prediction": 0, "cryoem": 0, "force_spectroscopy": 0, "integrative": 0, "md": 0, "nmr_shifts": 4, "nmr_structure": 12, "saxs_sans": 0, "xray": 14 } }, "data_levels": { "GB1-native": { "nmr_shifts": "processed", "nmr_structure": "processed", "xray": "processed" } }, "single_method_states": [], "states": [ "GB1-native" ], "techniques": [ "xray", "cryoem", "nmr_structure", "nmr_shifts", "saxs_sans", "force_spectroscopy", "integrative", "af_prediction", "md" ], "unmapped_evidence": 56 }, "curation": { "as_of": "2026-10-19", "curator": "draft (unreviewed)", "file": "P06654.yaml", "status": "draft" }, "evidence": [ { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "PROTEIN G (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1GB1", "evidence_id": "EV-PDB-1GB1-1", "mappings": [], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "1GB1", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1GB1" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "A NOVEL, HIGHLY STABLE FOLD OF THE IMMUNOGLOBULIN BINDING DOMAIN OF STREPTOCOCCAL PROTEIN G" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "PROTEIN G (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1IGD", "evidence_id": "EV-PDB-1IGD-1", "mappings": [], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "1IGD", "doi": "10.1006/jmbi.1994.1691", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1IGD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE THIRD IGG-BINDING DOMAIN FROM STREPTOCOCCAL PROTEIN G: AN ANALYSIS BY X-RAY CRYSTALLOGRAPHY OF THE STRUCTURE ALONE AND IN A COMPLEX WITH FAB" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.45, "salt_mM": null, "temperature_c": 39.85 }, "construct": { "description": "Immunoglobulin G binding protein G (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MPE", "evidence_id": "EV-PDB-1MPE-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as the B1 domain; the UniProt entry covers all protein G domains, so other domains are excluded by title.", "rule": "gb1-structures-native", "state_id": "GB1-native", "who": "rule:gb1-structures-native" } ], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "1MPE", "doi": "10.1038/nsb854", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MPE" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Ensemble of 20 structures of the tetrameric mutant of the B1 domain of streptococcal protein G" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "PROTEIN G (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1PGA", "evidence_id": "EV-PDB-1PGA-1", "mappings": [ { "confidence": "high", "justification": "Native B1 domain at 2.07 Å; representative for the native fold.", "rule": "curator_assignment", "state_id": "GB1-native", "who": "curator:draft (unreviewed)" } ], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.07 }, "provenance": { "deposit_id": "1PGA", "doi": "10.1021/bi00181a032", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1PGA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "TWO CRYSTAL STRUCTURES OF THE B1 IMMUNOGLOBULIN-BINDING DOMAIN OF STREPTOCOCCAL PROTEIN G AND COMPARISON WITH NMR" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "PROTEIN G (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1PGX", "evidence_id": "EV-PDB-1PGX-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as the B1 domain; the UniProt entry covers all protein G domains, so other domains are excluded by title.", "rule": "gb1-structures-native", "state_id": "GB1-native", "who": "rule:gb1-structures-native" } ], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.66 }, "provenance": { "deposit_id": "1PGX", "doi": "10.1021/bi00158a006", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1PGX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE 1.66 ANGSTROMS X-RAY STRUCTURE OF THE B2 IMMUNOGLOBULIN-BINDING DOMAIN OF STREPTOCOCCAL PROTEIN G AND COMPARISON TO THE NMR STRUCTURE OF THE B1 DOMAIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "NACHT-, LRR- and PYD-containing protein 2 (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1PN5", "evidence_id": "EV-PDB-1PN5-1", "mappings": [], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "1PN5", "doi": "10.1016/j.str.2003.08.009", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1PN5" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "NMR structure of the NALP1 Pyrin domain (PYD)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "PROTEIN G (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2IGD", "evidence_id": "EV-PDB-2IGD-1", "mappings": [], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "2IGD", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2IGD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ANISOTROPIC STRUCTURE OF PROTEIN G IGG-BINDING DOMAIN III AT 1.1 ANGSTROM RESOLUTION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "PROTEIN G (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2IGH", "evidence_id": "EV-PDB-2IGH-1", "mappings": [], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2IGH", "doi": "10.1016/0022-2836(92)90328-H", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2IGH" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "DETERMINATION OF THE SOLUTION STRUCTURES OF DOMAINS II AND III OF PROTEIN G FROM STREPTOCOCCUS BY 1H NMR" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.4, "salt_mM": null, "temperature_c": 13.85 }, "construct": { "description": "IMMUNOGLOBULIN G-BINDING PROTEIN G (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2J52", "evidence_id": "EV-PDB-2J52-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as the B1 domain; the UniProt entry covers all protein G domains, so other domains are excluded by title.", "rule": "gb1-structures-native", "state_id": "GB1-native", "who": "rule:gb1-structures-native" } ], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2J52", "doi": "10.1002/PROT.21832", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2J52" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution Structure of GB1 domain Protein G and low and high pressure." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.4, "salt_mM": null, "temperature_c": 13.85 }, "construct": { "description": "IMMUNOGLOBULIN G-BINDING PROTEIN G (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2J53", "evidence_id": "EV-PDB-2J53-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as the B1 domain; the UniProt entry covers all protein G domains, so other domains are excluded by title.", "rule": "gb1-structures-native", "state_id": "GB1-native", "who": "rule:gb1-structures-native" } ], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2J53", "doi": "10.1002/PROT.21832", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2J53" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution Structure of GB1 domain Protein G and low and high pressure." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "Immunoglobulin G-binding protein G (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2LGI", "evidence_id": "EV-PDB-2LGI-1", "mappings": [], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2LGI", "doi": "10.1073/pnas.1103728108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2LGI" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Atomic Resolution Protein Structures using NMR Chemical Shift Tensors" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Immunoglobulin G-binding protein G/DNA polymerase iota fusion protein (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2MBB", "evidence_id": "EV-PDB-2MBB-1", "mappings": [], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2MBB", "doi": "10.1007/s10858-014-9834-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2MBB" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution Structure of the human Polymerase iota UBM1-Ubiquitin Complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Immunoglobulin G-binding protein G precursor (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2NMQ", "evidence_id": "EV-PDB-2NMQ-1", "mappings": [], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2NMQ", "doi": "10.1021/ja066704b", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2NMQ" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Simultaneous determination of protein structure and dynamics using rdcs" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Immunoglobulin G-binding protein G (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2PLP", "evidence_id": "EV-PDB-2PLP-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as the B1 domain; the UniProt entry covers all protein G domains, so other domains are excluded by title.", "rule": "gb1-structures-native", "state_id": "GB1-native", "who": "rule:gb1-structures-native" } ], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2PLP", "doi": "10.1002/anie.200603627", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2PLP" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Ultra high resolution backbone conformation of protein GB1 from residual dipolar couplings alone" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "LA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Immunoglobulin G-binding protein G (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2RPV", "evidence_id": "EV-PDB-2RPV-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as the B1 domain; the UniProt entry covers all protein G domains, so other domains are excluded by title.", "rule": "gb1-structures-native", "state_id": "GB1-native", "who": "rule:gb1-structures-native" } ], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2RPV", "doi": "10.1007/s10858-009-9325-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2RPV" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution Structure of GB1 with LBT probe" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "PROTEIN (B1 DOMAIN OF STREPTOCOCCAL PROTEIN G) (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3GB1", "evidence_id": "EV-PDB-3GB1-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as the B1 domain; the UniProt entry covers all protein G domains, so other domains are excluded by title.", "rule": "gb1-structures-native", "state_id": "GB1-native", "who": "rule:gb1-structures-native" } ], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "3GB1", "doi": "10.1021/ja9843730", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3GB1" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "STRUCTURES OF B1 DOMAIN OF STREPTOCOCCAL PROTEIN G" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Immunoglobulin G-binding protein G (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3MP9", "evidence_id": "EV-PDB-3MP9-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as the B1 domain; the UniProt entry covers all protein G domains, so other domains are excluded by title.", "rule": "gb1-structures-native", "state_id": "GB1-native", "who": "rule:gb1-structures-native" } ], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "3MP9", "doi": "10.1002/prot.22825", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3MP9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Streptococcal protein G B1 domain at pH 3.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Streptococcal Protein GB1 Backbone Modified Variant: beta-3-Ala24, beta-3-Lys28, beta-3-Lys31, beta-3-Asn35 (chains A,B,C,D,E,F,G,H)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4KGR", "evidence_id": "EV-PDB-4KGR-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as the B1 domain; the UniProt entry covers all protein G domains, so other domains are excluded by title.", "rule": "gb1-structures-native", "state_id": "GB1-native", "who": "rule:gb1-structures-native" } ], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "4KGR", "doi": "10.1021/ja405422v", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4KGR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Backbone Modifications in the Protein GB1 Helix: beta-3-Ala24, beta-3-Lys28, beta-3-Lys31, beta-3-Asn35" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Streptococcal Protein GB1 Backbone Modified Variant: beta-3-Val21, beta-3-Asp40 (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4KGS", "evidence_id": "EV-PDB-4KGS-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as the B1 domain; the UniProt entry covers all protein G domains, so other domains are excluded by title.", "rule": "gb1-structures-native", "state_id": "GB1-native", "who": "rule:gb1-structures-native" } ], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "4KGS", "doi": "10.1021/ja405422v", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4KGS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Backbone Modifications in the Protein GB1 Loops: beta-3-Val21, beta-3-Asp40" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Streptococcal Protein GB1 Backbone Modified Variant: Aib10, D-Pro47 (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4KGT", "evidence_id": "EV-PDB-4KGT-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as the B1 domain; the UniProt entry covers all protein G domains, so other domains are excluded by title.", "rule": "gb1-structures-native", "state_id": "GB1-native", "who": "rule:gb1-structures-native" } ], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "4KGT", "doi": "10.1021/ja405422v", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4KGT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Backbone Modifications in the Protein GB1 Turns: Aib10, D-Pro47" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": 9.85 }, "construct": { "description": "Immunoglobulin G-binding protein G (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5JXV", "evidence_id": "EV-PDB-5JXV-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as the B1 domain; the UniProt entry covers all protein G domains, so other domains are excluded by title.", "rule": "gb1-structures-native", "state_id": "GB1-native", "who": "rule:gb1-structures-native" } ], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "5JXV", "doi": "10.1073/pnas.1602248113", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5JXV" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solid-state MAS NMR structure of immunoglobulin beta 1 binding domain of protein G (GB1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MPD", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Immunoglobulin G-binding protein G (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6CNE", "evidence_id": "EV-PDB-6CNE-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as the B1 domain; the UniProt entry covers all protein G domains, so other domains are excluded by title.", "rule": "gb1-structures-native", "state_id": "GB1-native", "who": "rule:gb1-structures-native" } ], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "6CNE", "doi": "10.1021/acs.jpcb.9b07466", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6CNE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Selenomethionine variant (V29SeM) of protein GB1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": 9.85 }, "construct": { "description": "Immunoglobulin G-binding protein G (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7QTR", "evidence_id": "EV-PDB-7QTR-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as the B1 domain; the UniProt entry covers all protein G domains, so other domains are excluded by title.", "rule": "gb1-structures-native", "state_id": "GB1-native", "who": "rule:gb1-structures-native" } ], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "7QTR", "doi": "10.1038/s42003-022-04251-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7QTR" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "GB1 in mammalian cells, 50 uM" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": 9.85 }, "construct": { "description": "Immunoglobulin G-binding protein G (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7QTS", "evidence_id": "EV-PDB-7QTS-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as the B1 domain; the UniProt entry covers all protein G domains, so other domains are excluded by title.", "rule": "gb1-structures-native", "state_id": "GB1-native", "who": "rule:gb1-structures-native" } ], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "7QTS", "doi": "10.1038/s42003-022-04251-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7QTS" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "GB1 in mammalian cells, 10 uM" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "branched: alpha-D-glucopyranose-(1-4)-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Maltodextrin-binding protein,Immunoglobulin G-binding protein A,Immunoglobulin G-binding protein G (chains B)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7RXD", "evidence_id": "EV-PDB-7RXD-1", "mappings": [], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.6 }, "provenance": { "deposit_id": "7RXD", "doi": "10.1073/pnas.2115001118", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7RXD" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "CryoEM structure of RBD domain of COVID-19 in complex with Legobody" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "7LD", "branched: alpha-D-glucopyranose-(1-4)-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Maltose/maltodextrin-binding periplasmic protein,Immunoglobulin G-binding protein A,Immunoglobulin G-binding protein G (chains C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JXR", "evidence_id": "EV-PDB-8JXR-3", "mappings": [], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.57 }, "provenance": { "deposit_id": "8JXR", "doi": "10.1016/j.neuron.2024.07.003", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JXR" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of nanobody-bound DRD1_LSD complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "V6X" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Maltose/maltodextrin-binding periplasmic protein,Immunoglobulin G-binding protein A,Immunoglobulin G-binding protein G (chains C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JXS", "evidence_id": "EV-PDB-8JXS-3", "mappings": [], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "8JXS", "doi": "10.1016/j.neuron.2024.07.003", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JXS" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of nanobody-bound DRD1_PF-6142 complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "NAG", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Maltodextrin-binding protein,Immunoglobulin G-binding protein A,Immunoglobulin G-binding protein G (chains B)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9BDT", "evidence_id": "EV-PDB-9BDT-4", "mappings": [], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 5.4 }, "provenance": { "deposit_id": "9BDT", "doi": "10.1038/s41586-024-08223-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9BDT" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Apolipoprotein B 100 bound to LDL receptor and legobody" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "NAG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Maltodextrin-binding protein,Immunoglobulin G-binding protein A,Immunoglobulin G-binding protein G (chains B)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9COO", "evidence_id": "EV-PDB-9COO-2", "mappings": [], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.73 }, "provenance": { "deposit_id": "9COO", "doi": "10.1038/s41586-024-08223-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9COO" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Nanobody 4 bound to Apolipoprotein B 100" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Immunoglobulin G-binding protein G (chains A)", "labels": [] }, "data_format": "mmCIF/IHM", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9A1D", "evidence_id": "EV-PDB-9A1D-1", "mappings": [], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "9A1D", "doi": "10.1038/s41467-023-36065-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9A1D" }, "reader": null, "source_kind": "deposit", "technique": "integrative", "title": "CS-Rosetta structure of engineered IgG-binding domain of protein G (GB) - model B4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Immunoglobulin G-binding protein G (chains A)", "labels": [] }, "data_format": "mmCIF/IHM", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9A1C", "evidence_id": "EV-PDB-9A1C-1", "mappings": [], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "9A1C", "doi": "10.1038/s41467-023-36065-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9A1C" }, "reader": null, "source_kind": "deposit", "technique": "integrative", "title": "CS-Rosetta structure of engineered IgG-binding domain of protein G (GB) - model B1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.3, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Immunoglobulin G-binding protein G (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8T0G", "evidence_id": "EV-PDB-8T0G-1", "mappings": [], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "8T0G", "doi": "10.1039/d3ob00963g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8T0G" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Backbone Dialkylation in Peptide Hairpins: Natural Backbone Prototype" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "POV", "branched: alpha-D-glucopyranose-(1-4)-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Maltodextrin-binding protein,Immunoglobulin G-binding protein A,Immunoglobulin G-binding protein G (chains B)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7RXC", "evidence_id": "EV-PDB-7RXC-4", "mappings": [], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "7RXC", "doi": "10.1073/pnas.2115001118", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7RXC" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "CryoEM structure of KDELR with Legobody" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Immunoglobulin G-binding protein G,Cullin-5 (chains C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6V9I", "evidence_id": "EV-PDB-6V9I-1", "mappings": [], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 5.2 }, "provenance": { "deposit_id": "6V9I", "doi": "10.1038/s41467-020-16499-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6V9I" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "cryo-EM structure of Cullin5 bound to RING-box protein 2 (Cul5-Rbx2)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Immunoglobulin G-binding protein G (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6LJI", "evidence_id": "EV-PDB-6LJI-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as the B1 domain; the UniProt entry covers all protein G domains, so other domains are excluded by title.", "rule": "gb1-structures-native", "state_id": "GB1-native", "who": "rule:gb1-structures-native" } ], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.843 }, "provenance": { "deposit_id": "6LJI", "doi": "10.1039/d0sc03060k", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6LJI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of synthetic GB1 domain with mutations K10(DVA), T11V" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Immunoglobulin G-binding protein G (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6L9D", "evidence_id": "EV-PDB-6L9D-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as the B1 domain; the UniProt entry covers all protein G domains, so other domains are excluded by title.", "rule": "gb1-structures-native", "state_id": "GB1-native", "who": "rule:gb1-structures-native" } ], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.73 }, "provenance": { "deposit_id": "6L9D", "doi": "10.1039/d0sc03060k", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6L9D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of synthetic GB1 domain with mutations K10(DVA), T11S" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Immunoglobulin G-binding protein G (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6L9B", "evidence_id": "EV-PDB-6L9B-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as the B1 domain; the UniProt entry covers all protein G domains, so other domains are excluded by title.", "rule": "gb1-structures-native", "state_id": "GB1-native", "who": "rule:gb1-structures-native" } ], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "6L9B", "doi": "10.1039/d0sc03060k", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6L9B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of synthetic GB1 domain with mutations K10(DVA), T11A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Immunoglobulin G-binding protein G (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6L91", "evidence_id": "EV-PDB-6L91-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as the B1 domain; the UniProt entry covers all protein G domains, so other domains are excluded by title.", "rule": "gb1-structures-native", "state_id": "GB1-native", "who": "rule:gb1-structures-native" } ], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.842 }, "provenance": { "deposit_id": "6L91", "doi": "10.1039/d0sc03060k", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6L91" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of synthetic GB1 domain with the mutation K10(DVA)." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Immunoglobulin G-binding protein G (chains A,B)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2RMM", "evidence_id": "EV-PDB-2RMM-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as the B1 domain; the UniProt entry covers all protein G domains, so other domains are excluded by title.", "rule": "gb1-structures-native", "state_id": "GB1-native", "who": "rule:gb1-structures-native" } ], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2RMM", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2RMM" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution structure of GB1 A34F mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Immunoglobulin G-binding protein G (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2N7J", "evidence_id": "EV-PDB-2N7J-1", "mappings": [], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2N7J", "doi": "10.1021/jacs.5b10072", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2N7J" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Sidechain chi1 distribution in B3 domain of protein G from extensive sets of residual dipolar couplings" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "IMMUNOGLOBULIN G-BINDING PROTEIN G (chains A,B)", "labels": [] }, "data_format": "mmCIF", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2KLK", "evidence_id": "EV-PDB-2KLK-1", "mappings": [], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2KLK", "doi": "10.1021/ja902528f", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2KLK" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Solution structure of GB1 A34F mutant with RDC and SAXS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Proto-oncogene vav,Immunoglobulin G-binding protein G (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2KBT", "evidence_id": "EV-PDB-2KBT-1", "mappings": [], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2KBT", "doi": "10.1007/s10858-008-9296-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2KBT" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Attachment of an NMR-invisible solubility enhancement tag (INSET) using a sortase-mediated protein ligation method" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 4.85 }, "construct": { "description": "Immunoglobulin G-binding protein G (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2K0P", "evidence_id": "EV-PDB-2K0P-1", "mappings": [], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2K0P", "doi": "10.1016/j.str.2008.10.016", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2K0P" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Determination of a Protein Structure in the Solid State from NMR Chemical Shifts" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "PROTEIN G (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2GB1", "evidence_id": "EV-PDB-2GB1-1", "mappings": [], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2GB1", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2GB1" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "A NOVEL, HIGHLY STABLE FOLD OF THE IMMUNOGLOBULIN BINDING DOMAIN OF STREPTOCOCCAL PROTEIN G" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Immunoglobulin G binding protein G (chains A,B)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1Q10", "evidence_id": "EV-PDB-1Q10-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as the B1 domain; the UniProt entry covers all protein G domains, so other domains are excluded by title.", "rule": "gb1-structures-native", "state_id": "GB1-native", "who": "rule:gb1-structures-native" } ], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "1Q10", "doi": "10.1016/S0022-2836(03)00928-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1Q10" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Ensemble of 40 Structures of the Dimeric Mutant of the B1 Domain of Streptococcal Protein G" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "PROTEIN G (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1PGB", "evidence_id": "EV-PDB-1PGB-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as the B1 domain; the UniProt entry covers all protein G domains, so other domains are excluded by title.", "rule": "gb1-structures-native", "state_id": "GB1-native", "who": "rule:gb1-structures-native" } ], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.92 }, "provenance": { "deposit_id": "1PGB", "doi": "10.1021/bi00181a032", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1PGB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "TWO CRYSTAL STRUCTURES OF THE B1 IMMUNOGLOBULIN-BINDING DOMAIN OF STREPTOCCOCAL PROTEIN G AND COMPARISON WITH NMR" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": -178.15 }, "construct": { "description": "Immunoglobulin G binding protein G (chains A,B,C,D,E,F,G,H,I,J,K,L)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MVK", "evidence_id": "EV-PDB-1MVK-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as the B1 domain; the UniProt entry covers all protein G domains, so other domains are excluded by title.", "rule": "gb1-structures-native", "state_id": "GB1-native", "who": "rule:gb1-structures-native" } ], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "1MVK", "doi": "10.1038/nsb854", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MVK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the tetrameric mutant of the B1 domain of streptococcal protein G" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": 14.85 }, "construct": { "description": "Tryptophan Zipper 4 (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LE3", "evidence_id": "EV-PDB-1LE3-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as the B1 domain; the UniProt entry covers all protein G domains, so other domains are excluded by title.", "rule": "gb1-structures-native", "state_id": "GB1-native", "who": "rule:gb1-structures-native" } ], "molecule_id": "P06654", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "1LE3", "doi": "10.1073/pnas.091100898", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LE3" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "NMR Structure of Tryptophan Zipper 4: A Stable Beta-Hairpin Peptide Based on the C-terminal Hairpin of the B1 Domain of Protein G" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "STREPTOCOCCAL PROTEIN G (DOMAIN III) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1IGC", "evidence_id": "EV-PDB-1IGC-3", "mappings": [], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "1IGC", "doi": "10.1006/jmbi.1994.1691", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1IGC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "IGG1 FAB FRAGMENT (MOPC21) COMPLEX WITH DOMAIN III OF PROTEIN G FROM STREPTOCOCCUS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "PROTEIN G (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1EM7", "evidence_id": "EV-PDB-1EM7-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as the B1 domain; the UniProt entry covers all protein G domains, so other domains are excluded by title.", "rule": "gb1-structures-native", "state_id": "GB1-native", "who": "rule:gb1-structures-native" } ], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1EM7", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1EM7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HELIX VARIANT OF THE B1 DOMAIN FROM STREPTOCOCCAL PROTEIN G" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Meiotically up-regulated gene 135 protein,SWR1 complex bromodomain subunit bdf1,Immunoglobulin G-binding protein G (chains A,B,C,D,E,F)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9JA5", "evidence_id": "EV-PDB-9JA5-1", "mappings": [], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "9JA5", "doi": "10.1073/pnas.2408347121", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9JA5" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of Tdk1-Bdf1 complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Meiotically up-regulated gene 135 protein,Immunoglobulin G-binding protein G (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9JA6", "evidence_id": "EV-PDB-9JA6-1", "mappings": [], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 4.4 }, "provenance": { "deposit_id": "9JA6", "doi": "10.1073/pnas.2408618121", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9JA6" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of Tdk1 tetramer complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Maltose/maltodextrin-binding periplasmic protein,Immunoglobulin G-binding protein A,Immunoglobulin G-binding protein G (chains C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9W3K", "evidence_id": "EV-PDB-9W3K-1", "mappings": [], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.08 }, "provenance": { "deposit_id": "9W3K", "doi": "10.1073/pnas.2534234123", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9W3K" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "GPR151-Legobody complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Immunoglobulin G-binding protein G,Carboxysome shell carbonic anhydrase (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9G4T", "evidence_id": "EV-PDB-9G4T-1", "mappings": [], "molecule_id": "P06654", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.51 }, "provenance": { "deposit_id": "9G4T", "doi": "10.1073/pnas.2523723122", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9G4T" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Beta carbonic anhydrase CsoSCA from the Halothiobacillus neapolitanus alpha-carboxysome" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=15380", "evidence_id": "EV-BMRB-15380", "mappings": [ { "confidence": "low", "justification": "NMR entry titled as GB1 under native conditions.", "rule": "gb1-nmr-native", "state_id": "GB1-native", "who": "rule:gb1-nmr-native" } ], "molecule_id": "P06654", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr15380", "doi": "10.13018/BMR15380", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=15380" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Crystal Polymorphism of GB1 Examined by Solid-State NMR Spectroscopy and X-ray Diffraction" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=25807", "evidence_id": "EV-BMRB-25807", "mappings": [], "molecule_id": "P06654", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr25807", "doi": "10.13018/BMR25807", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=25807" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Sidechain chi1 distribution in B3 domain of protein G from extensive sets of residual dipolar couplings" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 5.6, "salt_mM": null, "temperature_c": 9.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=30088", "evidence_id": "EV-BMRB-30088", "mappings": [ { "confidence": "low", "justification": "NMR entry titled as GB1 under native conditions.", "rule": "gb1-nmr-native", "state_id": "GB1-native", "who": "rule:gb1-nmr-native" } ], "molecule_id": "P06654", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr30088", "doi": "10.13018/BMR30088", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=30088" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Solid-state MAS NMR structure of beta 1 domain of protein G (GB1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.3, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=31089", "evidence_id": "EV-BMRB-31089", "mappings": [], "molecule_id": "P06654", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr31089", "doi": "10.13018/BMR31089", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=31089" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Backbone Dialkylation in Peptide Hairpins: Natural Backbone Prototype" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.4, "salt_mM": null, "temperature_c": 9.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=34700", "evidence_id": "EV-BMRB-34700", "mappings": [ { "confidence": "low", "justification": "NMR entry titled as GB1 under native conditions.", "rule": "gb1-nmr-native", "state_id": "GB1-native", "who": "rule:gb1-nmr-native" } ], "molecule_id": "P06654", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr34700", "doi": "10.13018/BMR34700", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=34700" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "GB1 in mammalian cells, 50 uM" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.4, "salt_mM": null, "temperature_c": 9.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=34701", "evidence_id": "EV-BMRB-34701", "mappings": [ { "confidence": "low", "justification": "NMR entry titled as GB1 under native conditions.", "rule": "gb1-nmr-native", "state_id": "GB1-native", "who": "rule:gb1-nmr-native" } ], "molecule_id": "P06654", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr34701", "doi": "10.13018/BMR34701", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=34701" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "GB1 in mammalian cells, 10 uM" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_silico", "ions": [], "ligands": [], "notes": "Computed prediction; no experimental conditions.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "AlphaFold Monomer v2.0 pipeline, residues 1-448", "labels": [] }, "data_format": "mmCIF, PAE JSON", "data_level": "processed", "data_link": "https://alphafold.ebi.ac.uk/entry/P06654", "evidence_id": "EV-AFDB-AF-P06654-F1", "mappings": [], "molecule_id": "P06654", "observable": { "type": "plddt", "uncertainty": null, "unit": "pLDDT", "value": 70.81 }, "provenance": { "deposit_id": "AF-P06654-F1", "doi": null, "licence": "CC BY 4.0", "retrieved": "2026-10-19", "source": "AlphaFold DB", "url": "https://alphafold.ebi.ac.uk/entry/P06654" }, "reader": null, "source_kind": "computed", "technique": "af_prediction", "title": "AlphaFold DB prediction AF-P06654-F1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_silico", "ions": [], "ligands": [], "notes": "Simulation; temperature is the thermostat setting.", "ph": null, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "start 1EM7; Amber Parm99", "labels": [] }, "data_format": "trajectory", "data_level": "processed", "data_link": "https://mmb.mddbr.eu/#/id/A00CW/overview", "evidence_id": "EV-MDDB-A00CW", "mappings": [], "molecule_id": "P06654", "observable": { "type": "trajectory", "uncertainty": null, "unit": "ns", "value": 10.0 }, "provenance": { "deposit_id": "A00CW", "doi": "10.1016/j.str.2010.07.013", "licence": "This trajectory dataset is released under a Creative Commons Attribution 4.0 International Public License", "retrieved": "2026-10-19", "source": "MDDB", "url": "https://mmb.mddbr.eu/#/id/A00CW/overview" }, "reader": null, "source_kind": "computed", "technique": "md", "title": "MoDEL 1EM7" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_silico", "ions": [], "ligands": [], "notes": "Simulation; temperature is the thermostat setting.", "ph": null, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "start 2GB1; Amber Parm99", "labels": [] }, "data_format": "trajectory", "data_level": "processed", "data_link": "https://mmb.mddbr.eu/#/id/A00GI/overview", "evidence_id": "EV-MDDB-A00GI", "mappings": [], "molecule_id": "P06654", "observable": { "type": "trajectory", "uncertainty": null, "unit": "ns", "value": 10.0 }, "provenance": { "deposit_id": "A00GI", "doi": "10.1016/j.str.2010.07.013", "licence": "This trajectory dataset is released under a Creative Commons Attribution 4.0 International Public License", "retrieved": "2026-10-19", "source": "MDDB", "url": "https://mmb.mddbr.eu/#/id/A00GI/overview" }, "reader": null, "source_kind": "computed", "technique": "md", "title": "MoDEL 2GB1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_silico", "ions": [], "ligands": [], "notes": "Simulation; temperature is the thermostat setting.", "ph": null, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "start 2IGD; Amber Parm99", "labels": [] }, "data_format": "trajectory", "data_level": "processed", "data_link": "https://mmb.mddbr.eu/#/id/A00KJ/overview", "evidence_id": "EV-MDDB-A00KJ", "mappings": [], "molecule_id": "P06654", "observable": { "type": "trajectory", "uncertainty": null, "unit": "ns", "value": 10.0 }, "provenance": { "deposit_id": "A00KJ", "doi": "10.1016/j.str.2010.07.013", "licence": "This trajectory dataset is released under a Creative Commons Attribution 4.0 International Public License", "retrieved": "2026-10-19", "source": "MDDB", "url": "https://mmb.mddbr.eu/#/id/A00KJ/overview" }, "reader": null, "source_kind": "computed", "technique": "md", "title": "MoDEL 2IGD" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_silico", "ions": [], "ligands": [], "notes": "Simulation; temperature is the thermostat setting.", "ph": null, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "start 1PGX; Amber Parm99", "labels": [] }, "data_format": "trajectory", "data_level": "processed", "data_link": "https://mmb.mddbr.eu/#/id/A00U5/overview", "evidence_id": "EV-MDDB-A00U5", "mappings": [], "molecule_id": "P06654", "observable": { "type": "trajectory", "uncertainty": null, "unit": "ns", "value": 10.0 }, "provenance": { "deposit_id": "A00U5", "doi": "10.1016/j.str.2010.07.013", "licence": "This trajectory dataset is released under a Creative Commons Attribution 4.0 International Public License", "retrieved": "2026-10-19", "source": "MDDB", "url": "https://mmb.mddbr.eu/#/id/A00U5/overview" }, "reader": null, "source_kind": "computed", "technique": "md", "title": "MoDEL 1PGX" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_silico", "ions": [], "ligands": [], "notes": "Simulation; temperature is the thermostat setting.", "ph": null, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "start 1PGB; Amber Parm99", "labels": [] }, "data_format": "trajectory", "data_level": "processed", "data_link": "https://mmb.mddbr.eu/#/id/A00VK/overview", "evidence_id": "EV-MDDB-A00VK", "mappings": [], "molecule_id": "P06654", "observable": { "type": "trajectory", "uncertainty": null, "unit": "ns", "value": 10.0 }, "provenance": { "deposit_id": "A00VK", "doi": "10.1016/j.str.2010.07.013", "licence": "This trajectory dataset is released under a Creative Commons Attribution 4.0 International Public License", "retrieved": "2026-10-19", "source": "MDDB", "url": "https://mmb.mddbr.eu/#/id/A00VK/overview" }, "reader": null, "source_kind": "computed", "technique": "md", "title": "MoDEL 1PGB" } ], "models": [ { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-1PGA-1" ], "file": "models/P06654/GB1-native.cif", "format": "mmCIF", "model_id": "GB1-native-cif", "molecule_id": "P06654", "provenance": { "deposit_id": "1PGA", "doi": "10.1021/bi00181a032", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/1PGA.cif" }, "state_id": "GB1-native" }, { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-1PGA-1" ], "file": "models/P06654/GB1-native.pdb", "format": "PDB", "model_id": "GB1-native-pdb", "molecule_id": "P06654", "provenance": { "deposit_id": "1PGA", "doi": "10.1021/bi00181a032", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/1PGA.pdb" }, "state_id": "GB1-native" } ], "molecule": { "components": [], "domains": [], "gene": "spg", "identifiers": { "genbank": null, "isoform": null, "nakb": null, "pdb": [], "rfam": null, "rnacentral": null, "uniprot": "P06654" }, "ligands": [], "modifications": [ { "kind": "ptm", "name": "Pentaglycyl murein peptidoglycan amidated threonine", "position": 417, "source": "UniProtKB" } ], "molecule_id": "P06654", "molecule_type": "protein", "name": "Immunoglobulin G-binding protein G", "organism": { "name": "Streptococcus sp. group G", "taxon_id": 1320 }, "provenance": { "deposit_id": "P06654", "doi": null, "licence": "CC BY 4.0 (UniProt)", "retrieved": "2026-10-19", "source": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P06654/entry" }, "sequence": "MEKEKKVKYFLRKSAFGLASVSAAFLVGSTVFAVDSPIEDTPIIRNGGELTNLLGNSETTLALRNEESATADLTAAAVADTVAAAAAENAGAAAWEAAAAADALAKAKADALKEFNKYGVSDYYKNLINNAKTVEGIKDLQAQVVESAKKARISEATDGLSDFLKSQTPAEDTVKSIELAEAKVLANRELDKYGVSDYHKNLINNAKTVEGVKELIDEILAALPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTEMVTEVPGDAPTEPEKPEASIPLVPLTPATPIAKDDAKKDDTKKEDAKKPEAKKDDAKKAETLPTTGEGSNPFFTAAALAVMAGAGALAVASKRKED", "sequence_length": 448 }, "molecule_id": "P06654", "states": [ { "assumptions": [], "basis": "observed", "description": "Native fold of the B1 domain, as in 1PGA. Force and ensemble data are not yet ingested.", "family_label": null, "molecule_id": "P06654", "name": "native fold", "parent_state": null, "population": null, "provenance": { "deposit_id": null, "doi": null, "licence": "Project licence (pending decision)", "retrieved": "2026-10-19", "source": "Conformome curation (P06654.yaml)", "url": "https://github.com/matth55/conformome/blob/HEAD/curation/P06654.yaml" }, "representative_model": "GB1-native-cif", "secondary_structure": null, "state_id": "GB1-native", "status": "draft" } ], "transitions": [] }