{ "conflicts": [], "coverage": { "cells": {}, "data_levels": {}, "single_method_states": [], "states": [], "techniques": [ "xray", "cryoem", "microed", "nmr_structure", "nmr_shifts", "saxs_sans", "force_spectroscopy", "af_prediction", "md" ], "unmapped_evidence": 52 }, "curation": { "as_of": "", "curator": "none", "file": "", "status": "uncurated" }, "evidence": [ { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "MAJOR PRION PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1AG2", "evidence_id": "EV-PDB-1AG2-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "1AG2", "doi": "10.1038/382180a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1AG2" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "PRION PROTEIN DOMAIN PRP(121-231) FROM MOUSE, NMR, 2 MINIMIZED AVERAGE STRUCTURE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Major prion protein (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1XYX", "evidence_id": "EV-PDB-1XYX-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "1XYX", "doi": "10.1073/pnas.0409008102", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1XYX" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "mouse prion protein fragment 121-231" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Major prion protein (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1Y15", "evidence_id": "EV-PDB-1Y15-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "1Y15", "doi": "10.1073/pnas.0409008102", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1Y15" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Mouse Prion Protein with mutation N174T" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.95 }, "construct": { "description": "Major prion protein (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2KFM", "evidence_id": "EV-PDB-2KFM-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2KFM", "doi": "10.1016/j.jmb.2009.04.040", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2KFM" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Mouse Prion Protein (121-231) with Mutations Y225A and Y226A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.95 }, "construct": { "description": "Major prion protein (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2KFO", "evidence_id": "EV-PDB-2KFO-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2KFO", "doi": "10.1016/j.jmb.2009.04.040", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2KFO" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Mouse Prion Protein (121-231) with Mutation V166A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 10.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Major prion protein (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2KU5", "evidence_id": "EV-PDB-2KU5-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2KU5", "doi": "10.1016/j.jmb.2010.04.066", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2KU5" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Mouse Prion Protein (121-231) with mutation D167S" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 10.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Major prion protein (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2KU6", "evidence_id": "EV-PDB-2KU6-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2KU6", "doi": "10.1016/j.jmb.2010.04.066", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2KU6" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Mouse Prion Protein (121-231) with mutations D167S and N173K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 20.05 }, "construct": { "description": "Major prion protein (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2L1D", "evidence_id": "EV-PDB-2L1D-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2L1D", "doi": "10.1073/pnas.1106325108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2L1D" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Mouse prion protein (121-231) containing the substitution Y169G" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 20.05 }, "construct": { "description": "Major prion protein (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2L1E", "evidence_id": "EV-PDB-2L1E-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2L1E", "doi": "10.1016/j.jmb.2012.08.011", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2L1E" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Mouse prion protein (121-231) containing the substitution F175A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 20.05 }, "construct": { "description": "Major prion protein (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2L1H", "evidence_id": "EV-PDB-2L1H-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2L1H", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2L1H" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Mouse prion protein fragment 121-231 at 20 C" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 20.05 }, "construct": { "description": "Major prion protein (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2L1K", "evidence_id": "EV-PDB-2L1K-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2L1K", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2L1K" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Mouse prion protein (121-231) containing the substitutions Y169A, Y225A, and Y226A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 37.05 }, "construct": { "description": "Major prion protein (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2L39", "evidence_id": "EV-PDB-2L39-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2L39", "doi": "10.1073/pnas.1106325108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2L39" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Mouse prion protein fragment 121-231 AT 37 C" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 20.05 }, "construct": { "description": "Major prion protein (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2L40", "evidence_id": "EV-PDB-2L40-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2L40", "doi": "10.1073/pnas.1106325108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2L40" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Mouse prion protein (121-231) containing the substitution Y169A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "TFA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Major prion protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3NVH", "evidence_id": "EV-PDB-3NVH-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.61 }, "provenance": { "deposit_id": "3NVH", "doi": "10.1021/bi101803k", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3NVH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "MIHFGND segment 137-143 from mouse prion" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Major prion protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4H88", "evidence_id": "EV-PDB-4H88-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "4H88", "doi": "10.1038/nature12402", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4H88" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of POM1 FAB fragment complexed with mouse PrPc Fragment 120-230" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Major prion protein (chains I,J)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4J8R", "evidence_id": "EV-PDB-4J8R-3", "mappings": [], "molecule_id": "P04925", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.303 }, "provenance": { "deposit_id": "4J8R", "doi": "10.1002/pro.2270", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4J8R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of an octapeptide repeat of the prion protein bound to the POM2 Fab antibody fragment" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "P2Z" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Major prion protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4MA7", "evidence_id": "EV-PDB-4MA7-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.97 }, "provenance": { "deposit_id": "4MA7", "doi": "10.1016/j.str.2013.11.009", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4MA7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of mouse prion protein complexed with Promazine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "Z80" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Major prion protein (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4MA8", "evidence_id": "EV-PDB-4MA8-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "4MA8", "doi": "10.1016/j.str.2013.11.009", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4MA8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of mouse prion protein complexed with Chlorpromazine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "TCE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Major prion protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6AQ7", "evidence_id": "EV-PDB-6AQ7-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.83 }, "provenance": { "deposit_id": "6AQ7", "doi": "10.1111/febs.14438", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6AQ7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of POM6 FAB fragment complexed with mouse PrPc" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Major prion protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6HER", "evidence_id": "EV-PDB-6HER-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.199 }, "provenance": { "deposit_id": "6HER", "doi": "10.1371/journal.ppat.1008139", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6HER" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mouse prion protein in complex with Nanobody 484" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Major prion protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6HHD", "evidence_id": "EV-PDB-6HHD-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.102 }, "provenance": { "deposit_id": "6HHD", "doi": "10.1371/journal.ppat.1008139", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6HHD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mouse Prion Protein in complex with Nanobody 484" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Major prion protein (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6HHD", "evidence_id": "EV-PDB-6HHD-3", "mappings": [], "molecule_id": "P04925", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.102 }, "provenance": { "deposit_id": "6HHD", "doi": "10.1371/journal.ppat.1008139", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6HHD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mouse Prion Protein in complex with Nanobody 484" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Major prion protein (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7QIG", "evidence_id": "EV-PDB-7QIG-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "7QIG", "doi": "10.1038/s41467-022-30457-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7QIG" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Infectious mouse-adapted RML scrapie prion fibril purified from terminally-infected mouse brains" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Major prion protein (chains 1,A,B,C,D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7TD6", "evidence_id": "EV-PDB-7TD6-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "7TD6", "doi": "10.1038/s41467-022-30458-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7TD6" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "aRML prion fibril" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Major prion protein (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8A00", "evidence_id": "EV-PDB-8A00-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "8A00", "doi": "10.1038/s41589-022-01229-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8A00" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Infectious mouse-adapted ME7 scrapie prion fibril purified from terminally-infected mouse brains" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Major prion protein (chains A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8DJA", "evidence_id": "EV-PDB-8DJA-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.92 }, "provenance": { "deposit_id": "8DJA", "doi": "10.1038/s41594-022-00833-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8DJA" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of mouse PrP23-144 amyloid fibrils (polymorph 1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Major prion protein (chains A,B,C,D,E)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8EFU", "evidence_id": "EV-PDB-8EFU-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "8EFU", "doi": "10.1371/journal.ppat.1010947", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8EFU" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "a22L prion fibril" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Major prion protein (chains A)", "labels": [] }, "data_format": "mmCIF", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7RVD", "evidence_id": "EV-PDB-7RVD-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.003 }, "provenance": { "deposit_id": "7RVD", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7RVD" }, "reader": null, "source_kind": "deposit", "technique": "microed", "title": "Segment from the mouse/cow prion protein 168-176 QYSNQNNFV" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Major prion protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3NVG", "evidence_id": "EV-PDB-3NVG-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.48 }, "provenance": { "deposit_id": "3NVG", "doi": "10.1021/bi101803k", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3NVG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "MIHFGN segment 137-142 from mouse prion" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 25.05 }, "construct": { "description": "Major prion protein (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2K5O", "evidence_id": "EV-PDB-2K5O-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2K5O", "doi": "10.1016/j.jmb.2008.08.045", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2K5O" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Mouse Prion Protein (121-231) with Mutation S170N" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Major prion protein (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1Y16", "evidence_id": "EV-PDB-1Y16-1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "1Y16", "doi": "10.1073/pnas.0409008102", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1Y16" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "mouse prion protein with mutations S170N and N174T" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 5.0, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=15053", "evidence_id": "EV-BMRB-15053", "mappings": [], "molecule_id": "P04925", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr15053", "doi": "10.13018/BMR15053", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=15053" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "HPRP-173-195 SOLUTION STRUCTURE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 5.0, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=15054", "evidence_id": "EV-BMRB-15054", "mappings": [], "molecule_id": "P04925", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr15054", "doi": "10.13018/BMR15054", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=15054" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "HPRP180-195 STRUCTURE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.5, "salt_mM": null, "temperature_c": 25.05 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=15845", "evidence_id": "EV-BMRB-15845", "mappings": [], "molecule_id": "P04925", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr15845", "doi": "10.13018/BMR15845", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=15845" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Mouse Prion Protein (121-231) with Mutation S170N" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.95 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=16184", "evidence_id": "EV-BMRB-16184", "mappings": [], "molecule_id": "P04925", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr16184", "doi": "10.13018/BMR16184", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=16184" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Mouse Prion Protein (121-231) with Mutations Y225A and Y226A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.95 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=16185", "evidence_id": "EV-BMRB-16185", "mappings": [], "molecule_id": "P04925", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr16185", "doi": "10.13018/BMR16185", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=16185" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Mouse Prion Protein (121-231) with Mutation V166A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=16722", "evidence_id": "EV-BMRB-16722", "mappings": [], "molecule_id": "P04925", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr16722", "doi": "10.13018/BMR16722", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=16722" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "mPrP_D167S" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=16723", "evidence_id": "EV-BMRB-16723", "mappings": [], "molecule_id": "P04925", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr16723", "doi": "10.13018/BMR16723", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=16723" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "mPrP_D1567D_N173K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.5, "salt_mM": null, "temperature_c": 20.05 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=17081", "evidence_id": "EV-BMRB-17081", "mappings": [], "molecule_id": "P04925", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr17081", "doi": "10.13018/BMR17081", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=17081" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Mouse Prion Protein (121-231) with mutation Y169G" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.5, "salt_mM": null, "temperature_c": 20.05 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=17082", "evidence_id": "EV-BMRB-17082", "mappings": [], "molecule_id": "P04925", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr17082", "doi": "10.13018/BMR17082", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=17082" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Mouse Prion Protein (121-231) with mutation F175A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.5, "salt_mM": null, "temperature_c": 20.05 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=17084", "evidence_id": "EV-BMRB-17084", "mappings": [], "molecule_id": "P04925", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr17084", "doi": "10.13018/BMR17084", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=17084" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "NMR structure of mouse PrP fragment 121-231 at 20 C." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.5, "salt_mM": null, "temperature_c": 37.05 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=17174", "evidence_id": "EV-BMRB-17174", "mappings": [], "molecule_id": "P04925", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr17174", "doi": "10.13018/BMR17174", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=17174" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "MOUSE PRION PROTEIN FRAGMENT 121-231 AT 37 C" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.5, "salt_mM": null, "temperature_c": 20.05 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=17213", "evidence_id": "EV-BMRB-17213", "mappings": [], "molecule_id": "P04925", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr17213", "doi": "10.13018/BMR17213", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=17213" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Mouse prion protein (121-231) with the mutation Y169A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 2.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=17758", "evidence_id": "EV-BMRB-17758", "mappings": [], "molecule_id": "P04925", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr17758", "doi": "10.13018/BMR17758", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=17758" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Backbone 1H and 13C Chemical Shift Assignments of murine prion protein (residues 121-232) in its oxidized state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "BMRB data: 1H chemical shifts, 13C chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=5197", "evidence_id": "EV-BMRB-5197", "mappings": [], "molecule_id": "P04925", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr5197", "doi": "10.13018/BMR5197", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=5197" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H and 13CA chemical shift assignments of the polypeptide mPrP(143-158)" }, { "conditions": { "applied_force_pn": null, "buffer": "sodium acetate buffer (20 mM sodium acetate, pH 5.1; 150 mM NaCl)", "environment": "in_vitro", "ions": [], "ligands": [ "partner: P-Clone Fab, Chimera" ], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 14.5 nm.", "ph": 5.1, "salt_mM": null, "temperature_c": 9.8 }, "construct": { "description": "Major prion protein with P-Clone Fab, Chimera", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDCJ2/", "evidence_id": "EV-SASBDB-SASDCJ2", "mappings": [], "molecule_id": "P04925", "observable": { "type": "radius_of_gyration", "uncertainty": 0.02, "unit": "nm", "value": 3.92 }, "provenance": { "deposit_id": "SASDCJ2", "doi": "10.1016/j.bpj.2015.06.065", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDCJ2/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Prion Protein-Antibody Complexes Characterized by Chromatography-Coupled Small-Angle X-Ray Scattering." }, { "conditions": { "applied_force_pn": null, "buffer": "10mM HEPES, 150 mM NaCl", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 9.85 nm.", "ph": 7.5, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "Major prion protein", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDHV9/", "evidence_id": "EV-SASBDB-SASDHV9", "mappings": [], "molecule_id": "P04925", "observable": { "type": "radius_of_gyration", "uncertainty": 0.04, "unit": "nm", "value": 2.78 }, "provenance": { "deposit_id": "SASDHV9", "doi": null, "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDHV9/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Characterization of murine prion protein" }, { "conditions": { "applied_force_pn": null, "buffer": "phosphate buffered saline", "environment": "in_vitro", "ions": [], "ligands": [ "partner: Anti-prion protein monoclonal IgG2a 6D11" ], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 24.82 nm.", "ph": 7.4, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "Major prion protein with Anti-prion protein monoclonal IgG2a 6D11", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDLU2/", "evidence_id": "EV-SASBDB-SASDLU2", "mappings": [], "molecule_id": "P04925", "observable": { "type": "radius_of_gyration", "uncertainty": 0.2, "unit": "nm", "value": 8.13 }, "provenance": { "deposit_id": "SASDLU2", "doi": "10.1126/sciadv.abj1826", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDLU2/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Ligands binding to the prion protein induce its proteolytic release with therapeutic potential in neurodegenerative proteinopathies." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "DisProt annotations do not record sample conditions.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "residues 23-120; evidence: nuclear magnetic resonance spectroscopy evidence used in manual assertion", "labels": [] }, "data_format": null, "data_level": "reported", "data_link": "https://europepmc.org/article/MED/9280298", "evidence_id": "EV-DISPROT-DP00265r005", "mappings": [], "molecule_id": "P04925", "observable": { "type": "disorder_region", "uncertainty": null, "unit": "residues", "value": 98 }, "provenance": { "deposit_id": "DP00265r005", "doi": null, "licence": "CC BY 4.0", "retrieved": "2026-10-19", "source": "DisProt", "url": "https://disprot.org/DP00265" }, "reader": null, "source_kind": "literature", "technique": "nmr_shifts", "title": "DisProt DP00265: disorder, residues 23-120" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_silico", "ions": [], "ligands": [], "notes": "Computed prediction; no experimental conditions.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "AlphaFold Monomer v2.0 pipeline, residues 1-254", "labels": [] }, "data_format": "mmCIF, PAE JSON", "data_level": "processed", "data_link": "https://alphafold.ebi.ac.uk/entry/P04925", "evidence_id": "EV-AFDB-AF-P04925-F1", "mappings": [], "molecule_id": "P04925", "observable": { "type": "plddt", "uncertainty": null, "unit": "pLDDT", "value": 64.62 }, "provenance": { "deposit_id": "AF-P04925-F1", "doi": null, "licence": "CC BY 4.0", "retrieved": "2026-10-19", "source": "AlphaFold DB", "url": "https://alphafold.ebi.ac.uk/entry/P04925" }, "reader": null, "source_kind": "computed", "technique": "af_prediction", "title": "AlphaFold DB prediction AF-P04925-F1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_silico", "ions": [], "ligands": [], "notes": "Simulation; temperature is the thermostat setting.", "ph": null, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "start 1AG2; Amber Parm99", "labels": [] }, "data_format": "trajectory", "data_level": "processed", "data_link": "https://mmb.mddbr.eu/#/id/A003P/overview", "evidence_id": "EV-MDDB-A003P", "mappings": [], "molecule_id": "P04925", "observable": { "type": "trajectory", "uncertainty": null, "unit": "ns", "value": 10.0 }, "provenance": { "deposit_id": "A003P", "doi": "10.1016/j.str.2010.07.013", "licence": "This trajectory dataset is released under a Creative Commons Attribution 4.0 International Public License", "retrieved": "2026-10-19", "source": "MDDB", "url": "https://mmb.mddbr.eu/#/id/A003P/overview" }, "reader": null, "source_kind": "computed", "technique": "md", "title": "MoDEL 1AG2" } ], "models": [], "molecule": { "components": [], "domains": [], "gene": "Prnp", "identifiers": { "genbank": null, "isoform": null, "nakb": null, "pdb": [], "rfam": null, "rnacentral": null, "uniprot": "P04925" }, "ligands": [ "Cu(2+)" ], "modifications": [ { "kind": "ptm", "name": "Hydroxyproline", "position": 44, "source": "UniProtKB" } ], "molecule_id": "P04925", "molecule_type": "protein", "name": "Major prion protein", "organism": { "name": "Mus musculus", "taxon_id": 10090 }, "provenance": { "deposit_id": "P04925", "doi": null, "licence": "CC BY 4.0 (UniProt)", "retrieved": "2026-10-19", "source": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P04925/entry" }, "sequence": "MANLGYWLLALFVTMWTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGTWGQPHGGGWGQPHGGSWGQPHGGSWGQPHGGGWGQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRSSSTVLFSSPPVILLISFLIFLIVG", "sequence_length": 254 }, "molecule_id": "P04925", "states": [], "transitions": [] }