{ "conflicts": [], "coverage": { "cells": { "Mb-CO": { "af_prediction": 0, "neutron": 1, "nmr_dynamics": 0, "nmr_shifts": 0, "nmr_structure": 1, "xray": 78 }, "Mb-aquomet": { "af_prediction": 0, "neutron": 1, "nmr_dynamics": 0, "nmr_shifts": 3, "nmr_structure": 0, "xray": 10 }, "Mb-deoxy": { "af_prediction": 0, "neutron": 0, "nmr_dynamics": 0, "nmr_shifts": 0, "nmr_structure": 0, "xray": 10 }, "Mb-oxy": { "af_prediction": 0, "neutron": 0, "nmr_dynamics": 0, "nmr_shifts": 0, "nmr_structure": 0, "xray": 13 } }, "data_levels": { "Mb-CO": { "neutron": "processed", "nmr_structure": "processed", "xray": "processed" }, "Mb-aquomet": { "neutron": "processed", "nmr_shifts": "processed", "xray": "processed" }, "Mb-deoxy": { "xray": "processed" }, "Mb-oxy": { "xray": "processed" } }, "single_method_states": [ "Mb-deoxy", "Mb-oxy" ], "states": [ "Mb-deoxy", "Mb-oxy", "Mb-CO", "Mb-aquomet" ], "techniques": [ "xray", "neutron", "nmr_structure", "nmr_dynamics", "nmr_shifts", "af_prediction" ], "unmapped_evidence": 280 }, "curation": { "as_of": "2026-10-19", "curator": "draft (unreviewed)", "file": "P02185.yaml", "status": "draft" }, "evidence": [ { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "NBN", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 18.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/101M", "evidence_id": "EV-PDB-101M-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.07 }, "provenance": { "deposit_id": "101M", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/101M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPERM WHALE MYOGLOBIN F46V N-BUTYL ISOCYANIDE AT PH 9.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 18.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/102M", "evidence_id": "EV-PDB-102M-1", "mappings": [ { "confidence": "medium", "justification": "Title says aquomet or metmyoglobin.", "rule": "mb-met-title", "state_id": "Mb-aquomet", "who": "rule:mb-met-title" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.84 }, "provenance": { "deposit_id": "102M", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/102M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPERM WHALE MYOGLOBIN H64A AQUOMET AT PH 9.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "NBN", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 18.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/103M", "evidence_id": "EV-PDB-103M-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.07 }, "provenance": { "deposit_id": "103M", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/103M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPERM WHALE MYOGLOBIN H64A N-BUTYL ISOCYANIDE AT PH 9.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "NBN", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 18.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/104M", "evidence_id": "EV-PDB-104M-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.71 }, "provenance": { "deposit_id": "104M", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/104M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPERM WHALE MYOGLOBIN N-BUTYL ISOCYANIDE AT PH 7.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "NBN", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 18.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/105M", "evidence_id": "EV-PDB-105M-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.02 }, "provenance": { "deposit_id": "105M", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/105M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPERM WHALE MYOGLOBIN N-BUTYL ISOCYANIDE AT PH 9.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ENC", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 18.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/106M", "evidence_id": "EV-PDB-106M-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.99 }, "provenance": { "deposit_id": "106M", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/106M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPERM WHALE MYOGLOBIN V68F ETHYL ISOCYANIDE AT PH 9.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "NBN", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 18.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/107M", "evidence_id": "EV-PDB-107M-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.09 }, "provenance": { "deposit_id": "107M", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/107M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPERM WHALE MYOGLOBIN V68F N-BUTYL ISOCYANIDE AT PH 9.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "NBN", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 18.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/108M", "evidence_id": "EV-PDB-108M-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.67 }, "provenance": { "deposit_id": "108M", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/108M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPERM WHALE MYOGLOBIN V68F N-BUTYL ISOCYANIDE AT PH 7.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ENC", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 18.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/109M", "evidence_id": "EV-PDB-109M-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.83 }, "provenance": { "deposit_id": "109M", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/109M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPERM WHALE MYOGLOBIN D122N ETHYL ISOCYANIDE AT PH 9.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "MNC", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 18.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/110M", "evidence_id": "EV-PDB-110M-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.77 }, "provenance": { "deposit_id": "110M", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/110M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPERM WHALE MYOGLOBIN D122N METHYL ISOCYANIDE AT PH 9.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "NBN", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 18.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/111M", "evidence_id": "EV-PDB-111M-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.88 }, "provenance": { "deposit_id": "111M", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/111M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPERM WHALE MYOGLOBIN D122N N-BUTYL ISOCYANIDE AT PH 9.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "NPN", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 18.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/112M", "evidence_id": "EV-PDB-112M-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.34 }, "provenance": { "deposit_id": "112M", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/112M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPERM WHALE MYOGLOBIN D122N N-PROPYL ISOCYANIDE AT PH 9.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1A6G", "evidence_id": "EV-PDB-1A6G-1", "mappings": [ { "confidence": "high", "justification": "Title: carbonmonoxy-myoglobin; CMO ligand present.", "rule": "curator_assignment", "state_id": "Mb-CO", "who": "curator:draft (unreviewed)" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.15 }, "provenance": { "deposit_id": "1A6G", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1A6G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CARBONMONOXY-MYOGLOBIN, ATOMIC RESOLUTION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -183.15 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1A6K", "evidence_id": "EV-PDB-1A6K-1", "mappings": [ { "confidence": "high", "justification": "Title: aquomet-myoglobin.", "rule": "curator_assignment", "state_id": "Mb-aquomet", "who": "curator:draft (unreviewed)" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "1A6K", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1A6K" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "AQUOMET-MYOGLOBIN, ATOMIC RESOLUTION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "OXY", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1A6M", "evidence_id": "EV-PDB-1A6M-1", "mappings": [ { "confidence": "high", "justification": "Title: oxy-myoglobin; OXY ligand present.", "rule": "curator_assignment", "state_id": "Mb-oxy", "who": "curator:draft (unreviewed)" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.0 }, "provenance": { "deposit_id": "1A6M", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1A6M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "OXY-MYOGLOBIN, ATOMIC RESOLUTION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1A6N", "evidence_id": "EV-PDB-1A6N-1", "mappings": [ { "confidence": "high", "justification": "Title: deoxy-myoglobin, atomic resolution.", "rule": "curator_assignment", "state_id": "Mb-deoxy", "who": "curator:draft (unreviewed)" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.15 }, "provenance": { "deposit_id": "1A6N", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1A6N" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DEOXY-MYOGLOBIN, ATOMIC RESOLUTION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": -253.15 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1ABS", "evidence_id": "EV-PDB-1ABS-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "1ABS", "doi": "10.1038/371808a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1ABS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PHOTOLYSED CARBONMONOXY-MYOGLOBIN AT 20 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -233.15 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1AJG", "evidence_id": "EV-PDB-1AJG-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.69 }, "provenance": { "deposit_id": "1AJG", "doi": "10.1038/nsb1094-701", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1AJG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CARBONMONOXY MYOGLOBIN AT 40 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -233.15 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1AJH", "evidence_id": "EV-PDB-1AJH-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.69 }, "provenance": { "deposit_id": "1AJH", "doi": "10.1038/nsb1094-701", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1AJH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PHOTOPRODUCT OF CARBONMONOXY MYOGLOBIN AT 40 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BLA", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "APOMYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1BVC", "evidence_id": "EV-PDB-1BVC-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "1BVC", "doi": "10.1006/jmbi.1994.0142", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1BVC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURE OF A BILIVERDIN APOMYOGLOBIN COMPLEX (FORM D) AT 118 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BLA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "APOMYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1BVD", "evidence_id": "EV-PDB-1BVD-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "1BVD", "doi": "10.1006/jmbi.1994.0142", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1BVD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURE OF A BILIVERDIN APOMYOGLOBIN COMPLEX (FORM B) AT 98 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": 13.85 }, "construct": { "description": "PROTEIN (MYOGLOBIN) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1BZ6", "evidence_id": "EV-PDB-1BZ6-1", "mappings": [ { "confidence": "medium", "justification": "Title says aquomet or metmyoglobin.", "rule": "mb-met-title", "state_id": "Mb-aquomet", "who": "rule:mb-met-title" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "1BZ6", "doi": "10.1126/science.284.5413.473", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1BZ6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ATOMIC RESOLUTION CRYSTAL STRUCTURE AQUOMET-MYOGLOBIN FROM SPERM WHALE AT ROOM TEMPERATURE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.9, "salt_mM": null, "temperature_c": 13.85 }, "construct": { "description": "PROTEIN (MYOGLOBIN) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1BZP", "evidence_id": "EV-PDB-1BZP-1", "mappings": [ { "confidence": "medium", "justification": "Title says deoxy and no CO, O2 or NO ligand is present.", "rule": "mb-deoxy-title", "state_id": "Mb-deoxy", "who": "rule:mb-deoxy-title" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.15 }, "provenance": { "deposit_id": "1BZP", "doi": "10.1126/science.284.5413.473", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1BZP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ATOMIC RESOLUTION CRYSTAL STRUCTURE ANALYSIS OF NATIVE DEOXY AND CO MYOGLOBIN FROM SPERM WHALE AT ROOM TEMPERATURE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.9, "salt_mM": null, "temperature_c": 13.85 }, "construct": { "description": "PROTEIN (MYOGLOBIN) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1BZR", "evidence_id": "EV-PDB-1BZR-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.15 }, "provenance": { "deposit_id": "1BZR", "doi": "10.1126/science.284.5413.473", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1BZR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ATOMIC RESOLUTION CRYSTAL STRUCTURE ANALYSIS OF NATIVE DEOXY AND CO MYOGLOBIN FROM SPERM WHALE AT ROOM TEMPERATURE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "PROTEIN (MYOGLOBIN) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CH1", "evidence_id": "EV-PDB-1CH1-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1CH1", "doi": "10.1074/jbc.M008593200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CH1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Recombinant sperm whale myoglobin L89G mutatnt (MET)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "PROTEIN (MYOGLOBIN) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CH2", "evidence_id": "EV-PDB-1CH2-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1CH2", "doi": "10.1074/jbc.M008593200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CH2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "RECOMBINANT SPERM WHALE MYOGLOBIN L89F MUTANT (MET)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "PROTEIN (MYOGLOBIN) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CH7", "evidence_id": "EV-PDB-1CH7-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1CH7", "doi": "10.1074/jbc.M008593200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CH7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "RECOMBINANT SPERM WHALE MYOGLOBIN H97F MUTANT (MET)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "PROTEIN (MYOGLOBIN) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CH9", "evidence_id": "EV-PDB-1CH9-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1CH9", "doi": "10.1074/jbc.M008593200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CH9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "RECOMBINANT SPERM WHALE MYOGLOBIN H97Q MUTANT (MET)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "PROTEIN (MYOGLOBIN) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CIK", "evidence_id": "EV-PDB-1CIK-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1CIK", "doi": "10.1074/jbc.M008593200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CIK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "RECOMBINANT SPERM WHALE MYOGLOBIN I99A MUTANT (MET)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "PROTEIN (MYOGLOBIN) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CIO", "evidence_id": "EV-PDB-1CIO-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "1CIO", "doi": "10.1074/jbc.M008593200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CIO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "RECOMBINANT SPERM WHALE MYOGLOBIN I99V MUTANT (MET)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "PROTEIN (MYOGLOBIN) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CO8", "evidence_id": "EV-PDB-1CO8-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1CO8", "doi": "10.1074/jbc.M008593200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CO8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "RECOMBINANT SPERM WHALE MYOGLOBIN L104A MUTANT (MET)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "PROTEIN (MYOGLOBIN) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CO9", "evidence_id": "EV-PDB-1CO9-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "1CO9", "doi": "10.1074/jbc.M008593200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CO9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "RECOMBINANT SPERM WHALE MYOGLOBIN L104V MUTANT (MET)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "PROTEIN (MYOGLOBIN) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CP0", "evidence_id": "EV-PDB-1CP0-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1CP0", "doi": "10.1074/jbc.M008593200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CP0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "RECOMBINANT SPERM WHALE MYOGLOBIN L104N MUTANT (MET)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "PROTEIN (MYOGLOBIN) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CP5", "evidence_id": "EV-PDB-1CP5-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1CP5", "doi": "10.1074/jbc.M008593200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CP5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "RECOMBINANT SPERM WHALE MYOGLOBIN L104F MUTANT (MET)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "PROTEIN (MYOGLOBIN) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CPW", "evidence_id": "EV-PDB-1CPW-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "1CPW", "doi": "10.1074/jbc.M008593200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CPW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "RECOMBINANT SPERM WHALE MYOGLOBIN L104W MUTANT (MET)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CQ2", "evidence_id": "EV-PDB-1CQ2-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1CQ2", "doi": "10.1073/pnas.060024697", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CQ2" }, "reader": null, "source_kind": "deposit", "technique": "neutron", "title": "NEUTRON STRUCTURE OF FULLY DEUTERATED SPERM WHALE MYOGLOBIN AT 2.0 ANGSTROM" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4", "branched: alpha-D-glucopyranose-(1-1)-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -168.15 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1DO1", "evidence_id": "EV-PDB-1DO1-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "1DO1", "doi": "10.1038/35004622", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1DO1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CARBONMONOXY-MYOGLOBIN MUTANT L29W AT 105K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4", "branched: alpha-D-glucopyranose-(1-1)-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -168.15 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1DO3", "evidence_id": "EV-PDB-1DO3-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "1DO3", "doi": "10.1038/35004622", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1DO3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CARBONMONOXY-MYOGLOBIN (MUTANT L29W) AFTER PHOTOLYSIS AT T>180K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4", "branched: alpha-D-glucopyranose-(1-1)-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -168.15 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1DO4", "evidence_id": "EV-PDB-1DO4-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1DO4", "doi": "10.1038/35004622", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1DO4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CARBONMONOXY-MYOGLOBIN (MUTANT L29W) AFTER PHOTOLYSIS AT T<180K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "PROTEIN (MYOGLOBIN) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1DTI", "evidence_id": "EV-PDB-1DTI-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1DTI", "doi": "10.1074/jbc.M008593200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1DTI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Recombinant sperm whale myoglobin h97d, d122n mutant (met)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "4MZ", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "RECOMBINANT SPERM WHALE MYOGLOBIN VARIANT H93G (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1DTM", "evidence_id": "EV-PDB-1DTM-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.13 }, "provenance": { "deposit_id": "1DTM", "doi": "10.1002/(SICI)1097-0134(20000601)39:4<278::AID-PROT20>3.0.CO;2-T", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1DTM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF THE SPERM-WHALE MYOGLOBIN MUTANT H93G COMPLEXED WITH 4-METHYLIMIDAZOLE, METAQUO FORM" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "WILD-TYPE RECOMBINANT SPERM WHALE METAQUOMYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1DUK", "evidence_id": "EV-PDB-1DUK-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.13 }, "provenance": { "deposit_id": "1DUK", "doi": "10.1002/(SICI)1097-0134(20000601)39:4<278::AID-PROT20>3.0.CO;2-T", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1DUK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "WILD-TYPE RECOMBINANT SPERM WHALE METAQUOMYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1MZ", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "SPERM WHALE METAQUOMYOGLOBIN VARIANT H93G (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1DUO", "evidence_id": "EV-PDB-1DUO-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1DUO", "doi": "10.1002/(SICI)1097-0134(20000601)39:4<278::AID-PROT20>3.0.CO;2-T", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1DUO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPERM WHALE METAQUOMYOGLOBIN PROXIMAL HISTIDINE MUTANT H93G WITH 1-METHYLIMIDAZOLE AS PROXIMAL LIGAND." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1DXC", "evidence_id": "EV-PDB-1DXC-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "1DXC", "doi": "10.1073/PNAS.040459697", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1DXC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CO complex of Myoglobin Mb-YQR at 100K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CYN", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "PROTEIN (MYOGLOBIN) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1EBC", "evidence_id": "EV-PDB-1EBC-1", "mappings": [ { "confidence": "medium", "justification": "Title says aquomet or metmyoglobin.", "rule": "mb-met-title", "state_id": "Mb-aquomet", "who": "rule:mb-met-title" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1EBC", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1EBC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPERM WHALE MET-MYOGLOBIN:CYANIDE COMPLEX" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.7, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1F63", "evidence_id": "EV-PDB-1F63-1", "mappings": [ { "confidence": "medium", "justification": "Title says deoxy and no CO, O2 or NO ligand is present.", "rule": "mb-deoxy-title", "state_id": "Mb-deoxy", "who": "rule:mb-deoxy-title" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1F63", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1F63" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF DEOXY SPERM WHALE MYOGLOBIN MUTANT Y(B10)Q(E7)R(E10)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": -253.15 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1DXD", "evidence_id": "EV-PDB-1DXD-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "1DXD", "doi": "10.1073/PNAS.040459697", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1DXD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Photolyzed CO complex of Myoglobin Mb-YQR at 20K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4", "branched: alpha-D-glucopyranose-(1-1)-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -168.15 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1DO7", "evidence_id": "EV-PDB-1DO7-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1DO7", "doi": "10.1038/35004622", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1DO7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CARBONMONOXY-MYOGLOBIN (MUTANT L29W) REBINDING STRUCTURE AFTER PHOTOLYSIS AT T< 180K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "PROTEIN (MYOGLOBIN) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CH5", "evidence_id": "EV-PDB-1CH5-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1CH5", "doi": "10.1074/jbc.M008593200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CH5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "RECOMBINANT SPERM WHALE MYOGLOBIN H97V MUTANT (MET)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "PROTEIN (MYOGLOBIN) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CH3", "evidence_id": "EV-PDB-1CH3-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1CH3", "doi": "10.1074/jbc.M008593200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CH3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "RECOMBINANT SPERM WHALE MYOGLOBIN L89W MUTANT (MET)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "OXY", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.6, "salt_mM": null, "temperature_c": -153.15 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1F65", "evidence_id": "EV-PDB-1F65-1", "mappings": [ { "confidence": "high", "justification": "O2 (ligand OXY) bound to the heme.", "rule": "mb-o2-ligand", "state_id": "Mb-oxy", "who": "rule:mb-o2-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1F65", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1F65" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF OXY SPERM WHALE MYOGLOBIN MUTANT Y(B10)Q(E7)R(E10)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CYN", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1H1X", "evidence_id": "EV-PDB-1H1X-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "1H1X", "doi": "10.1042/BJ20030863", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1H1X" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Sperm whale Myoglobin mutant T67R S92D" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "NO", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1HJT", "evidence_id": "EV-PDB-1HJT-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1HJT", "doi": "10.1002/(SICI)1097-0134(19980301)30:4<352::AID-PROT2>3.3.CO;2-G", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1HJT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPERM WHALE MYOGLOBIN (FERROUS, NITRIC OXIDE BOUND)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CYN", "HE6", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 23.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1IOP", "evidence_id": "EV-PDB-1IOP-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1IOP", "doi": "10.1021/bi972632c", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1IOP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "INCORPORATION OF A HEMIN WITH THE SHORTEST ACID SIDE-CHAINS INTO MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "IMD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (METAQUO) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1IRC", "evidence_id": "EV-PDB-1IRC-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.17 }, "provenance": { "deposit_id": "1IRC", "doi": "10.1021/bi00187a023", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1IRC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CYSTEINE RICH INTESTINAL PROTEIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CR", "CZM", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1J3F", "evidence_id": "EV-PDB-1J3F-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "1J3F", "doi": "10.1021/ja045995q", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1J3F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of an Artificial Metalloprotein:Cr(III)(3,3'-Me2-salophen)/apo-A71G Myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4", "XE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1J52", "evidence_id": "EV-PDB-1J52-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1J52", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1J52" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Recombinant sperm whale myoglobin in the presence of 7atm xenon" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "NO", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JDO", "evidence_id": "EV-PDB-1JDO-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1JDO", "doi": "10.1002/(SICI)1097-0134(19980301)30:4<352::AID-PROT2>3.3.CO;2-G", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JDO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPERM WHALE MYOGLOBIN (FERROUS, NITRIC OXIDE BOUND)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JP6", "evidence_id": "EV-PDB-1JP6-1", "mappings": [ { "confidence": "medium", "justification": "Title says aquomet or metmyoglobin.", "rule": "mb-met-title", "state_id": "Mb-aquomet", "who": "rule:mb-met-title" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "1JP6", "doi": "10.1016/S0969-2126(01)00699-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JP6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Sperm Whale met-Myoglobin (room temperature; room pressure)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -178.15 }, "construct": { "description": "myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JP9", "evidence_id": "EV-PDB-1JP9-1", "mappings": [ { "confidence": "medium", "justification": "Title says aquomet or metmyoglobin.", "rule": "mb-met-title", "state_id": "Mb-aquomet", "who": "rule:mb-met-title" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1JP9", "doi": "10.1016/S0969-2126(01)00699-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JP9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Sperm Whale met-Myoglobin (low temperature; high pressure)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -178.15 }, "construct": { "description": "myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JPB", "evidence_id": "EV-PDB-1JPB-1", "mappings": [ { "confidence": "medium", "justification": "Title says aquomet or metmyoglobin.", "rule": "mb-met-title", "state_id": "Mb-aquomet", "who": "rule:mb-met-title" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1JPB", "doi": "10.1016/S0969-2126(01)00699-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JPB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Sperm Whale met-Myoglobin (low temperature; high pressure)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JW8", "evidence_id": "EV-PDB-1JW8-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "1JW8", "doi": "10.1002/prot.21499", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JW8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "1.3 ANGSTROM RESOLUTION CRYSTAL STRUCTURE OF P6 FORM OF MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "OXY", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LTW", "evidence_id": "EV-PDB-1LTW-1", "mappings": [ { "confidence": "high", "justification": "O2 (ligand OXY) bound to the heme.", "rule": "mb-o2-ligand", "state_id": "Mb-oxy", "who": "rule:mb-o2-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1LTW", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LTW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "RECOMBINANT SPERM WHALE MYOGLOBIN 29W MUTANT (OXY)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LUE", "evidence_id": "EV-PDB-1LUE-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1LUE", "doi": "10.1021/bi034605u", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LUE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "RECOMBINANT SPERM WHALE MYOGLOBIN H64D/V68A/D122N MUTANT (MET)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MBC", "evidence_id": "EV-PDB-1MBC-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "1MBC", "doi": "10.1016/0022-2836(86)90470-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MBC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-RAY STRUCTURE AND REFINEMENT OF CARBON-MONOXY (FE II)-MYOGLOBIN AT 1.5 ANGSTROMS RESOLUTION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MBD", "evidence_id": "EV-PDB-1MBD-1", "mappings": [ { "confidence": "medium", "justification": "Title says deoxy and no CO, O2 or NO ligand is present.", "rule": "mb-deoxy-title", "state_id": "Mb-deoxy", "who": "rule:mb-deoxy-title" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "1MBD", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MBD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of sperm whale deoxymoglobin refined at 1.4A resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "OH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MBN", "evidence_id": "EV-PDB-1MBN-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1MBN", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MBN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The stereochemistry of the protein myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (CARBONMONOXY) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MCY", "evidence_id": "EV-PDB-1MCY-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1MCY", "doi": "10.1074/jbc.270.35.20781", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MCY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPERM WHALE MYOGLOBIN (MUTANT WITH INITIATOR MET AND WITH HIS 64 REPLACED BY GLN, LEU 29 REPLACED BY PHE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "METMYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MGN", "evidence_id": "EV-PDB-1MGN-1", "mappings": [ { "confidence": "medium", "justification": "Title says aquomet or metmyoglobin.", "rule": "mb-met-title", "state_id": "Mb-aquomet", "who": "rule:mb-met-title" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1MGN", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MGN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HIS64(E7)-> TYR APOMYOGLOBIN AS A REAGENT FOR MEASURING RATES OF HEMIN DISSOCIATION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MLG", "evidence_id": "EV-PDB-1MLG-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1MLG", "doi": "10.1006/jmbi.1994.0034", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MLG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL AND FUNCTIONAL EFFECTS OF APOLAR MUTATIONS OF VAL68(E11) IN MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MLH", "evidence_id": "EV-PDB-1MLH-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1MLH", "doi": "10.1006/jmbi.1994.0034", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MLH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL AND FUNCTIONAL EFFECTS OF APOLAR MUTATIONS OF VAL68(E11) IN MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MLJ", "evidence_id": "EV-PDB-1MLJ-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1MLJ", "doi": "10.1006/jmbi.1994.0034", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MLJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL AND FUNCTIONAL EFFECTS OF APOLAR MUTATIONS OF VAL68(E11) IN MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MLK", "evidence_id": "EV-PDB-1MLK-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1MLK", "doi": "10.1006/jmbi.1994.0034", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MLK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL AND FUNCTIONAL EFFECTS OF APOLAR MUTATIONS OF VAL68(E11) IN MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MLL", "evidence_id": "EV-PDB-1MLL-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1MLL", "doi": "10.1006/jmbi.1994.0034", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MLL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL AND FUNCTIONAL EFFECTS OF APOLAR MUTATIONS OF VAL68(E11) IN MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MLM", "evidence_id": "EV-PDB-1MLM-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1MLM", "doi": "10.1006/jmbi.1994.0034", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MLM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL AND FUNCTIONAL EFFECTS OF APOLAR MUTATIONS OF VAL68(E11) IN MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MLN", "evidence_id": "EV-PDB-1MLN-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1MLN", "doi": "10.1006/jmbi.1994.0034", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MLN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL AND FUNCTIONAL EFFECTS OF APOLAR MUTATIONS OF VAL68(E11) IN MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MLO", "evidence_id": "EV-PDB-1MLO-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1MLO", "doi": "10.1006/jmbi.1994.0034", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MLO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL AND FUNCTIONAL EFFECTS OF APOLAR MUTATIONS OF VAL68(E11) IN MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MLQ", "evidence_id": "EV-PDB-1MLQ-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1MLQ", "doi": "10.1006/jmbi.1994.0034", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MLQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL AND FUNCTIONAL EFFECTS OF APOLAR MUTATIONS OF VAL68(E11) IN MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MLR", "evidence_id": "EV-PDB-1MLR-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1MLR", "doi": "10.1006/jmbi.1994.0034", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MLR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL AND FUNCTIONAL EFFECTS OF APOLAR MUTATIONS OF VAL68(E11) IN MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MLS", "evidence_id": "EV-PDB-1MLS-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1MLS", "doi": "10.1006/jmbi.1994.0034", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MLS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structural and functional effects of apolar mutations of val68(e11) in myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MLU", "evidence_id": "EV-PDB-1MLU-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1MLU", "doi": "10.1021/bi00201a005", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MLU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "NITRIC OXIDE RECOMBINATION TO DOUBLE MUTANTS OF MYOGLOBIN: THE ROLE OF LIGAND DIFFUSION IN A FLUCTUATING HEME POCKET" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MOA", "evidence_id": "EV-PDB-1MOA-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1MOA", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MOA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "A NOVEL SITE-DIRECTED MUTANT OF MYOGLOBIN WITH AN UNUSUALLY HIGH O2 AFFINITY AND LOW AUTOOXIDATION RATE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MOB", "evidence_id": "EV-PDB-1MOB-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "1MOB", "doi": "10.1006/jmbi.1993.1569", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MOB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HIGH-RESOLUTION CRYSTAL STRUCTURES OF DISTAL HISTIDINE MUTANTS OF SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MOC", "evidence_id": "EV-PDB-1MOC-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1MOC", "doi": "10.1006/jmbi.1993.1569", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MOC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HIGH-RESOLUTION CRYSTAL STRUCTURES OF DISTAL HISTIDINE MUTANTS OF SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MOD", "evidence_id": "EV-PDB-1MOD-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1MOD", "doi": "10.1006/jmbi.1993.1569", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MOD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HIGH-RESOLUTION CRYSTAL STRUCTURES OF DISTAL HISTIDINE MUTANTS OF SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MTK", "evidence_id": "EV-PDB-1MTK-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1MTK", "doi": "10.1002/prot.340220404", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MTK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PHE46(CD4) ORIENTS THE DISTAL HISTIDINE FOR HYDROGEN BONDING TO BOUND LIGANDS IN SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MYM", "evidence_id": "EV-PDB-1MYM-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1MYM", "doi": "10.1021/bi00172a021", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MYM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL DETERMINANTS OF CO STRETCHING VIBRATION FREQUENCIES IN MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.7, "salt_mM": null, "temperature_c": 9.85 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MYZ", "evidence_id": "EV-PDB-1MYZ-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "1MYZ", "doi": "10.1073/pnas.1430900100", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MYZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CO COMPLEX OF MYOGLOBIN MB-YQR AT RT SOLVED FROM LAUE DATA." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.7, "salt_mM": null, "temperature_c": 9.85 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MZ0", "evidence_id": "EV-PDB-1MZ0-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "1MZ0", "doi": "10.1073/pnas.1430900100", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MZ0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURE OF MYOGLOBIN MB-YQR 316 ns AFTER PHOTOLYSIS OF CARBON MONOXIDE SOLVED FROM LAUE DATA AT RT." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "OH", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1N9F", "evidence_id": "EV-PDB-1N9F-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1N9F", "doi": "10.1107/S0907444903005924", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1N9F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of earth-grown oxidized Myoglobin mutant YQR (ISS6A)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MYF", "evidence_id": "EV-PDB-1MYF-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "1MYF", "doi": "10.1006/jmbi.1994.1718", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MYF" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "SOLUTION STRUCTURE OF CARBONMONOXY MYOGLOBIN DETERMINED FROM NMR DISTANCE AND CHEMICAL SHIFT CONSTRAINTS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MTJ", "evidence_id": "EV-PDB-1MTJ-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1MTJ", "doi": "10.1002/prot.340220404", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MTJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PHE46(CD4) ORIENTS THE DISTAL HISTIDINE FOR HYDROGEN BONDING TO BOUND LIGANDS IN SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MTI", "evidence_id": "EV-PDB-1MTI-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1MTI", "doi": "10.1002/prot.340220404", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MTI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PHE46(CD4) ORIENTS THE DISTAL HISTIDINE FOR HYDROGEN BONDING TO BOUND LIGANDS IN SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MLF", "evidence_id": "EV-PDB-1MLF-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1MLF", "doi": "10.1006/jmbi.1994.0034", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MLF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL AND FUNCTIONAL EFFECTS OF APOLAR MUTATIONS OF VAL68(E11) IN MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "OXY", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MBO", "evidence_id": "EV-PDB-1MBO-1", "mappings": [ { "confidence": "high", "justification": "O2 (ligand OXY) bound to the heme.", "rule": "mb-o2-ligand", "state_id": "Mb-oxy", "who": "rule:mb-o2-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "1MBO", "doi": "10.1016/0022-2836(80)90262-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MBO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure and refinement of oxymyoglobin at 1.6 angstroms resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "IMD", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MBI", "evidence_id": "EV-PDB-1MBI-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1MBI", "doi": "10.1016/0022-2836(91)90744-Q", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MBI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-RAY CRYSTAL STRUCTURE OF THE FERRIC SPERM WHALE MYOGLOBIN: IMIDAZOLE COMPLEX AT 2.0 ANGSTROMS RESOLUTION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "ND4", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L2K", "evidence_id": "EV-PDB-1L2K-1", "mappings": [ { "confidence": "medium", "justification": "Title says aquomet or metmyoglobin.", "rule": "mb-met-title", "state_id": "Mb-aquomet", "who": "rule:mb-met-title" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "1L2K", "doi": "10.1016/S0301-4622(01)00255-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L2K" }, "reader": null, "source_kind": "deposit", "technique": "neutron", "title": "Neutron Structure Determination of Sperm Whale Met-Myoglobin at 1.5A Resolution." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JP8", "evidence_id": "EV-PDB-1JP8-1", "mappings": [ { "confidence": "medium", "justification": "Title says aquomet or metmyoglobin.", "rule": "mb-met-title", "state_id": "Mb-aquomet", "who": "rule:mb-met-title" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "1JP8", "doi": "10.1016/S0969-2126(01)00699-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JP8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Sperm Whale met-Myoglobin (room temperature; high pressure)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1FCS", "evidence_id": "EV-PDB-1FCS-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "1FCS", "doi": "10.1016/0014-5793(93)81647-I", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1FCS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF A DISTAL SITE DOUBLE MUTANT OF SPERM WHALE MYOGLOBIN AT 1.6 ANGSTROMS RESOLUTION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "OH", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1N9H", "evidence_id": "EV-PDB-1N9H-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1N9H", "doi": "10.1107/S0907444903005924", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1N9H" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "structure of microgravity-grown oxidized myoglobin mutant YQR (ISS6A)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "OH", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1N9I", "evidence_id": "EV-PDB-1N9I-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "1N9I", "doi": "10.1107/S0907444903005924", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1N9I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "structure of earth-grown oxidized myoglobin mutant YQR (ISS8A)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "OH", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1N9X", "evidence_id": "EV-PDB-1N9X-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "1N9X", "doi": "10.1107/S0907444903005924", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1N9X" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "structure of microgravity-grown oxidized myoglobin mutant YQR (ISS8A)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "OH", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1NAZ", "evidence_id": "EV-PDB-1NAZ-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.04 }, "provenance": { "deposit_id": "1NAZ", "doi": "10.1107/S0907444903005924", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1NAZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "structure of microgravity-grown oxidized myoglobin mutant YQR (ISS8A)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1O16", "evidence_id": "EV-PDB-1O16-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "1O16", "doi": "10.1021/bi034605u", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1O16" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "RECOMBINANT SPERM WHALE MYOGLOBIN H64D/V68S/D122N MUTANT (MET)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1OBM", "evidence_id": "EV-PDB-1OBM-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1OBM", "doi": "10.1074/jbc.273.16.9517", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1OBM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "RECOMBINANT SPERM WHALE MYOGLOBIN 29F/64Q/68F/122N MUTANT (MET)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1OFJ", "evidence_id": "EV-PDB-1OFJ-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1OFJ", "doi": "10.1074/jbc.274.5.2838", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1OFJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "RECOMBINANT SPERM WHALE MYOGLOBIN L29H/H64L/D122N MUTANT (WITH INITIATOR MET)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1OFK", "evidence_id": "EV-PDB-1OFK-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1OFK", "doi": "10.1074/jbc.274.5.2838", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1OFK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "RECOMBINANT SPERM WHALE MYOGLOBIN F43H, H64L MUTANT (MET)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1SPE", "evidence_id": "EV-PDB-1SPE-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1SPE", "doi": "10.1006/jmbi.1996.0123", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1SPE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPERM WHALE NATIVE CO MYOGLOBIN AT PH 4.0, TEMP 4C" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AZI", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1SWM", "evidence_id": "EV-PDB-1SWM-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1SWM", "doi": "10.1016/0022-2836(91)90744-Q", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1SWM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-RAY CRYSTAL STRUCTURE OF THE FERRIC SPERM WHALE MYOGLOBIN: IMIDAZOLE COMPLEX AT 2.0 ANGSTROMS RESOLUTION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ETN", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1TES", "evidence_id": "EV-PDB-1TES-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1TES", "doi": "10.1021/bi960442g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1TES" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "OXYGEN BINDING MUSCLE PROTEIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "IMD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1U7R", "evidence_id": "EV-PDB-1U7R-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.15 }, "provenance": { "deposit_id": "1U7R", "doi": "10.1002/prot.21499", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1U7R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Native Sperm Whale myoglobin from low ionic strength enviroment (Form2 )" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1U7S", "evidence_id": "EV-PDB-1U7S-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "1U7S", "doi": "10.1002/prot.21499", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1U7S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Native Sperm Whale myoglobin from low ionic strength enviroment (Form 1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CZM", "FE", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1UFJ", "evidence_id": "EV-PDB-1UFJ-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "1UFJ", "doi": "10.1021/ic0498539", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1UFJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of an Artificial Metalloprotein:Fe(III)(3,3'-Me2-salophen)/apo-A71G Myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1UFP", "evidence_id": "EV-PDB-1UFP-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1UFP", "doi": "10.1021/ic0498539", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1UFP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of an Artificial Metalloprotein:Fe(III)(3,3'-Me2-salophen)/apo-wild type Myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CZM", "MN3", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1V9Q", "evidence_id": "EV-PDB-1V9Q-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "1V9Q", "doi": "10.1021/ja045995q", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1V9Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of an Artificial Metalloprotein:Mn(III)(3,3'-Me2-salophen)/apo-A71G Myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1VXA", "evidence_id": "EV-PDB-1VXA-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1VXA", "doi": "10.1006/jmbi.1996.0123", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1VXA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "NATIVE SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1VXB", "evidence_id": "EV-PDB-1VXB-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1VXB", "doi": "10.1006/jmbi.1996.0123", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1VXB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "NATIVE SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1VXC", "evidence_id": "EV-PDB-1VXC-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1VXC", "doi": "10.1006/jmbi.1996.0123", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1VXC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "NATIVE SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1VXD", "evidence_id": "EV-PDB-1VXD-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1VXD", "doi": "10.1006/jmbi.1996.0123", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1VXD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "NATIVE SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1VXF", "evidence_id": "EV-PDB-1VXF-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1VXF", "doi": "10.1006/jmbi.1996.0123", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1VXF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "NATIVE SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1VXG", "evidence_id": "EV-PDB-1VXG-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1VXG", "doi": "10.1006/jmbi.1996.0123", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1VXG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "NATIVE SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1VXH", "evidence_id": "EV-PDB-1VXH-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1VXH", "doi": "10.1006/jmbi.1996.0123", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1VXH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "NATIVE SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -183.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1WVP", "evidence_id": "EV-PDB-1WVP-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.53 }, "provenance": { "deposit_id": "1WVP", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1WVP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of chemically modified myoglobin with distal N-tetrazolyl-histidine E7(64)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "COH", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1YOG", "evidence_id": "EV-PDB-1YOG-1", "mappings": [ { "confidence": "medium", "justification": "Title says deoxy and no CO, O2 or NO ligand is present.", "rule": "mb-deoxy-title", "state_id": "Mb-deoxy", "who": "rule:mb-deoxy-title" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "1YOG", "doi": "10.1074/jbc.271.41.25419", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1YOG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "COBALT MYOGLOBIN (DEOXY)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "COH", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1YOH", "evidence_id": "EV-PDB-1YOH-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "1YOH", "doi": "10.1074/jbc.271.41.25419", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1YOH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "COBALT MYOGLOBIN (MET)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "COH", "OXY", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1YOI", "evidence_id": "EV-PDB-1YOI-1", "mappings": [ { "confidence": "high", "justification": "O2 (ligand OXY) bound to the heme.", "rule": "mb-o2-ligand", "state_id": "Mb-oxy", "who": "rule:mb-o2-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "1YOI", "doi": "10.1074/jbc.271.41.25419", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1YOI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "COBALT MYOGLOBIN (OXY)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.8, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2BLH", "evidence_id": "EV-PDB-2BLH-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.77 }, "provenance": { "deposit_id": "2BLH", "doi": "10.1021/BI047513T", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2BLH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ligand Migration and Protein Fluctuations in Myoglobin Mutant L29W" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.8, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2BLI", "evidence_id": "EV-PDB-2BLI-1", "mappings": [ { "confidence": "medium", "justification": "Title says deoxy and no CO, O2 or NO ligand is present.", "rule": "mb-deoxy-title", "state_id": "Mb-deoxy", "who": "rule:mb-deoxy-title" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "2BLI", "doi": "10.1021/BI047513T", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2BLI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "L29W Mb deoxy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.8, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "MYOGLOBIN (chains M)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2BLJ", "evidence_id": "EV-PDB-2BLJ-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2BLJ", "doi": "10.1021/BI047513T", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2BLJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of L29W MbCO" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.8, "salt_mM": null, "temperature_c": 14.85 }, "construct": { "description": "MYOGLOBIN (chains M)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2BW9", "evidence_id": "EV-PDB-2BW9-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.68 }, "provenance": { "deposit_id": "2BW9", "doi": "10.1073/PNAS.0504932102", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2BW9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Laue Structure of L29W MbCO" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.8, "salt_mM": null, "temperature_c": 14.85 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2BWH", "evidence_id": "EV-PDB-2BWH-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "2BWH", "doi": "10.1073/pnas.0504932102", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2BWH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Laue Structure of a Short Lived State of L29W Myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CYN", "POR" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2CMM", "evidence_id": "EV-PDB-2CMM-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2CMM", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2CMM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL ANALYSIS OF THE MYOGLOBIN RECONSTITUTED WITH IRON PORPHINE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HME", "IMD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -183.15 }, "construct": { "description": "Myoglobin (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2D6C", "evidence_id": "EV-PDB-2D6C-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.26 }, "provenance": { "deposit_id": "2D6C", "doi": "10.1021/ic061130x", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2D6C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of myoglobin reconstituted with iron porphycene" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2E2Y", "evidence_id": "EV-PDB-2E2Y-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "2E2Y", "doi": "10.1021/ar600046a", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2E2Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of F43W/H64D/V68I Myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CUP", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2EB8", "evidence_id": "EV-PDB-2EB8-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "2EB8", "doi": "10.1021/ic070289m", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2EB8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Cu(II)(Sal-Phe)/apo-Myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CUS", "GOL", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2EB9", "evidence_id": "EV-PDB-2EB9-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2EB9", "doi": "10.1021/ic070289m", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2EB9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Cu(II)(Sal-Leu)/apo-Myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PO4", "RHX" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2EF2", "evidence_id": "EV-PDB-2EF2-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2EF2", "doi": "10.1021/om700471a", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2EF2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of an Artificial Metalloprotein:Rh(Phebox-Ph)/apo-A71G Myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "6HE", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2EKT", "evidence_id": "EV-PDB-2EKT-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "2EKT", "doi": "10.1021/bi7007068", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2EKT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of myoglobin reconstituted with 6-methyl-6-depropionatehemin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "7HE", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2EKU", "evidence_id": "EV-PDB-2EKU-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "2EKU", "doi": "10.1021/bi7007068", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2EKU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of myoglobin reconstituted with 7-methyl-7-depropionatehemin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACY", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2EVK", "evidence_id": "EV-PDB-2EVK-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "2EVK", "doi": "10.1021/bi052171s", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2EVK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The Structures of Thiolate- and Carboxylate-Ligated Ferric H93G Myoglobin: Models for Cytochrome P450 and for Oxyanion-Bound Heme Proteins" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2EVP", "evidence_id": "EV-PDB-2EVP-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "2EVP", "doi": "10.1021/bi052171s", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2EVP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The Structures of Thiolate- and Carboxylate-Ligated Ferric H93G Myoglobin: Models for Cytochrome P450 and for Oxyanion-Bound Heme Proteins" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 9.85 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2G0R", "evidence_id": "EV-PDB-2G0R-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "2G0R", "doi": "10.1107/S0907444906017318", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2G0R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Unphotolyzed CO-bound L29F Myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 9.85 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2G0S", "evidence_id": "EV-PDB-2G0S-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "2G0S", "doi": "10.1107/S0907444906017318", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2G0S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Unphotolyzed CO-bound L29F Myoglobin, crystal 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 9.85 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2G0V", "evidence_id": "EV-PDB-2G0V-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "2G0V", "doi": "10.1107/S0907444906017318", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2G0V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Photolyzed CO L29F Myoglobin: 100ps" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 9.85 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2G0X", "evidence_id": "EV-PDB-2G0X-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "2G0X", "doi": "10.1107/S0907444906017318", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2G0X" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Photolyzed CO L29F Myoglobin: 316ps" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 9.85 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2G0Z", "evidence_id": "EV-PDB-2G0Z-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "2G0Z", "doi": "10.1107/S0907444906017318", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2G0Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Photolyzed CO L29F Myoglobin: 1ns" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 9.85 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2G10", "evidence_id": "EV-PDB-2G10-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "2G10", "doi": "10.1107/S0907444906017318", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2G10" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Photolyzed CO L29F Myoglobin: 3.16ns" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 9.85 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2G11", "evidence_id": "EV-PDB-2G11-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "2G11", "doi": "10.1107/S0907444906017318", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2G11" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Photolyzed CO L29F Myoglobin: 31.6ns" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1VXE", "evidence_id": "EV-PDB-1VXE-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1VXE", "doi": "10.1006/jmbi.1996.0123", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1VXE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "NATIVE SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 9.85 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2G12", "evidence_id": "EV-PDB-2G12-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "2G12", "doi": "10.1107/S0907444906017318", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2G12" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Photolyzed CO L29F Myoglobin: 316ns" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 9.85 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2G14", "evidence_id": "EV-PDB-2G14-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "2G14", "doi": "10.1107/S0907444906017318", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2G14" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Photolyzed CO L29F Myoglobin: 3.16us" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CYN", "HEM", "SO4", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2JHO", "evidence_id": "EV-PDB-2JHO-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "2JHO", "doi": "10.1073/pnas.0608411104", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2JHO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Cyanomet Sperm Whale Myoglobin at 1.4A resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "ND4", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2MB5", "evidence_id": "EV-PDB-2MB5-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2MB5", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2MB5" }, "reader": null, "source_kind": "deposit", "technique": "neutron", "title": "HYDRATION IN PROTEIN CRYSTALS. A NEUTRON DIFFRACTION ANALYSIS OF CARBONMONOXYMYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2MBW", "evidence_id": "EV-PDB-2MBW-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "2MBW", "doi": "10.1074/jbc.271.41.25419", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2MBW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "RECOMBINANT SPERM WHALE MYOGLOBIN (MET)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2MGA", "evidence_id": "EV-PDB-2MGA-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "2MGA", "doi": "10.1006/jmbi.1993.1569", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2MGA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HIGH RESOLUTION CRYSTAL STRUCTURES OF FIVE DISTAL HISTIDINE MUTANTS OF SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2MGB", "evidence_id": "EV-PDB-2MGB-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2MGB", "doi": "10.1006/jmbi.1993.1569", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2MGB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HIGH RESOLUTION CRYSTAL STRUCTURES OF FIVE DISTAL HISTIDINE MUTANTS OF SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2MGC", "evidence_id": "EV-PDB-2MGC-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "2MGC", "doi": "10.1006/jmbi.1993.1569", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2MGC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HIGH RESOLUTION CRYSTAL STRUCTURES OF FIVE DISTAL HISTIDINE MUTANTS OF SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2MGD", "evidence_id": "EV-PDB-2MGD-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2MGD", "doi": "10.1006/jmbi.1993.1569", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2MGD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HIGH RESOLUTION CRYSTAL STRUCTURES OF FIVE DISTAL HISTIDINE MUTANTS OF SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2MGE", "evidence_id": "EV-PDB-2MGE-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "2MGE", "doi": "10.1006/jmbi.1993.1569", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2MGE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HIGH RESOLUTION CRYSTAL STRUCTURES OF FIVE DISTAL HISTIDINE MUTANTS OF SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2MGF", "evidence_id": "EV-PDB-2MGF-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2MGF", "doi": "10.1006/jmbi.1993.1569", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2MGF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HIGH RESOLUTION CRYSTAL STRUCTURES OF FIVE DISTAL HISTIDINE MUTANTS OF SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2MGG", "evidence_id": "EV-PDB-2MGG-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2MGG", "doi": "10.1006/jmbi.1993.1569", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2MGG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HIGH RESOLUTION CRYSTAL STRUCTURES OF FIVE DISTAL HISTIDINE MUTANTS OF SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2MGH", "evidence_id": "EV-PDB-2MGH-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2MGH", "doi": "10.1006/jmbi.1993.1569", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2MGH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HIGH RESOLUTION CRYSTAL STRUCTURES OF FIVE DISTAL HISTIDINE MUTANTS OF SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2MGI", "evidence_id": "EV-PDB-2MGI-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2MGI", "doi": "10.1006/jmbi.1993.1569", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2MGI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HIGH RESOLUTION CRYSTAL STRUCTURES OF FIVE DISTAL HISTIDINE MUTANTS OF SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2MGJ", "evidence_id": "EV-PDB-2MGJ-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2MGJ", "doi": "10.1006/jmbi.1993.1569", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2MGJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HIGH RESOLUTION CRYSTAL STRUCTURES OF FIVE DISTAL HISTIDINE MUTANTS OF SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2MGK", "evidence_id": "EV-PDB-2MGK-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2MGK", "doi": "10.1006/jmbi.1993.1569", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2MGK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HIGH RESOLUTION CRYSTAL STRUCTURES OF FIVE DISTAL HISTIDINE MUTANTS OF SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2MGL", "evidence_id": "EV-PDB-2MGL-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2MGL", "doi": "10.1006/jmbi.1993.1569", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2MGL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HIGH RESOLUTION CRYSTAL STRUCTURES OF FIVE DISTAL HISTIDINE MUTANTS OF SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "OXY", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2MGM", "evidence_id": "EV-PDB-2MGM-1", "mappings": [ { "confidence": "high", "justification": "O2 (ligand OXY) bound to the heme.", "rule": "mb-o2-ligand", "state_id": "Mb-oxy", "who": "rule:mb-o2-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "2MGM", "doi": "10.1006/jmbi.1993.1569", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2MGM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HIGH RESOLUTION CRYSTAL STRUCTURES OF FIVE DISTAL HISTIDINE MUTANTS OF SPERM WHALE MYOGLOBIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ENC", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (ETHYL ISOCYANIDE) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2MYA", "evidence_id": "EV-PDB-2MYA-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2MYA", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2MYA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HIGH RESOLUTION X-RAY STRUCTURES OF MYOGLOBIN-AND HEMOGLOBIN-ALKYL ISOCYANIDE COMPLEXES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "MNC", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (METHYL ISOCYANIDE) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2MYB", "evidence_id": "EV-PDB-2MYB-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "2MYB", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2MYB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HIGH RESOLUTION X-RAY STRUCTURES OF MYOGLOBIN-AND HEMOGLOBIN-ALKYL ISOCYANIDE COMPLEXES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "NBN", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (N-BUTYL ISOCYANIDE) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2MYC", "evidence_id": "EV-PDB-2MYC-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2MYC", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2MYC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HIGH RESOLUTION X-RAY STRUCTURES OF MYOGLOBIN-AND HEMOGLOBIN-ALKYL ISOCYANIDE COMPLEXES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "NPN", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (N-PROPYL ISOCYANIDE) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2MYD", "evidence_id": "EV-PDB-2MYD-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2MYD", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2MYD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HIGH RESOLUTION X-RAY STRUCTURES OF MYOGLOBIN-AND HEMOGLOBIN-ALKYL ISOCYANIDE COMPLEXES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ENC", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (ETHYL ISOCYANIDE) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2MYE", "evidence_id": "EV-PDB-2MYE-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.68 }, "provenance": { "deposit_id": "2MYE", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2MYE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HIGH RESOLUTION X-RAY STRUCTURES OF MYOGLOBIN-AND HEMOGLOBIN-ALKYL ISOCYANIDE COMPLEXES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2OH8", "evidence_id": "EV-PDB-2OH8-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2OH8", "doi": "10.1080/15216540701230495", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2OH8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Myoglobin cavity mutant I28W" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2OH9", "evidence_id": "EV-PDB-2OH9-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2OH9", "doi": "10.1080/15216540701230495", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2OH9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Myoglobin cavity mutant V68W" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2OHA", "evidence_id": "EV-PDB-2OHA-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2OHA", "doi": "10.1080/15216540701230495", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2OHA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Myoglobin cavity mutant F138W" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2OHB", "evidence_id": "EV-PDB-2OHB-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2OHB", "doi": "10.1080/15216540701230495", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2OHB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Myoglobin cavity mutant I107W" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2SPL", "evidence_id": "EV-PDB-2SPL-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "2SPL", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2SPL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "A NOVEL SITE-DIRECTED MUTANT OF MYOGLOBIN WITH AN UNUSUALLY HIGH O2 AFFINITY AND LOW AUTOOXIDATION RATE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2SPM", "evidence_id": "EV-PDB-2SPM-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "2SPM", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2SPM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "A NOVEL SITE-DIRECTED MUTANT OF MYOGLOBIN WITH AN UNUSUALLY HIGH O2 AFFINITY AND LOW AUTOOXIDATION RATE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "OXY", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2SPN", "evidence_id": "EV-PDB-2SPN-1", "mappings": [ { "confidence": "high", "justification": "O2 (ligand OXY) bound to the heme.", "rule": "mb-o2-ligand", "state_id": "Mb-oxy", "who": "rule:mb-o2-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "2SPN", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2SPN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "A NOVEL SITE-DIRECTED MUTANT OF MYOGLOBIN WITH AN UNUSUALLY HIGH O2 AFFINITY AND LOW AUTOOXIDATION RATE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2SPO", "evidence_id": "EV-PDB-2SPO-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "2SPO", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2SPO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "A NOVEL SITE-DIRECTED MUTANT OF MYOGLOBIN WITH AN UNUSUALLY HIGH O2 AFFINITY AND LOW AUTOOXIDATION RATE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "HEM", "SO4", "XE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2W6W", "evidence_id": "EV-PDB-2W6W-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.99 }, "provenance": { "deposit_id": "2W6W", "doi": "10.1002/BIP.21201", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2W6W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of recombinant Sperm Whale Myoglobin under 1atm of Xenon" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4", "XE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2W6X", "evidence_id": "EV-PDB-2W6X-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.73 }, "provenance": { "deposit_id": "2W6X", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2W6X" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Sperm Whale Myoglobin mutant YQRF in complex with Xenon" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4", "XE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2W6Y", "evidence_id": "EV-PDB-2W6Y-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "2W6Y", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2W6Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Sperm Whale Myoglobin mutant YQR in complex with Xenon" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "OXY", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2Z6S", "evidence_id": "EV-PDB-2Z6S-1", "mappings": [ { "confidence": "high", "justification": "O2 (ligand OXY) bound to the heme.", "rule": "mb-o2-ligand", "state_id": "Mb-oxy", "who": "rule:mb-o2-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "2Z6S", "doi": "10.1021/ja076108x", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2Z6S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the oxy myoglobin free from X-ray-induced photoreduction" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "PER", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2Z6T", "evidence_id": "EV-PDB-2Z6T-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "2Z6T", "doi": "10.1021/ja076108x", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2Z6T" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the ferric peroxo myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2ZSN", "evidence_id": "EV-PDB-2ZSN-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "2ZSN", "doi": "10.1073/pnas.0807774106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2ZSN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carbonmonoxy Sperm Whale Myoglobin at 100 K: Laser on [300 min]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2ZSO", "evidence_id": "EV-PDB-2ZSO-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "2ZSO", "doi": "10.1073/pnas.0807774106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2ZSO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carbonmonoxy Sperm Whale Myoglobin at 100 K: Laser on [450 min]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -153.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2ZSP", "evidence_id": "EV-PDB-2ZSP-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "2ZSP", "doi": "10.1073/pnas.0807774106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2ZSP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carbonmonoxy Sperm Whale Myoglobin at 120 K: Laser on [300 min]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -133.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2ZSQ", "evidence_id": "EV-PDB-2ZSQ-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "2ZSQ", "doi": "10.1073/pnas.0807774106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2ZSQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carbonmonoxy Sperm Whale Myoglobin at 140 K: Laser on [150 min]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -153.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2ZSR", "evidence_id": "EV-PDB-2ZSR-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "2ZSR", "doi": "10.1073/pnas.0807774106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2ZSR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carbonmonoxy Sperm Whale Myoglobin at 120 K: Laser on [450 min]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -133.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2ZSS", "evidence_id": "EV-PDB-2ZSS-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "2ZSS", "doi": "10.1073/pnas.0807774106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2ZSS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carbonmonoxy Sperm Whale Myoglobin at 140 K: Laser on [300 min]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -133.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2ZST", "evidence_id": "EV-PDB-2ZST-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "2ZST", "doi": "10.1073/pnas.0807774106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2ZST" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carbonmonoxy Sperm Whale Myoglobin at 140 K: Laser on [450 min]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -133.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2ZSX", "evidence_id": "EV-PDB-2ZSX-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "2ZSX", "doi": "10.1073/pnas.0807774106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2ZSX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carbonmonoxy Sperm Whale Myoglobin at 140 K: Laser on [600 min]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -133.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2ZSY", "evidence_id": "EV-PDB-2ZSY-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "2ZSY", "doi": "10.1073/pnas.0807774106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2ZSY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carbonmonoxy Sperm Whale Myoglobin at 140 K: Laser on [750 min]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2ZSZ", "evidence_id": "EV-PDB-2ZSZ-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "2ZSZ", "doi": "10.1073/pnas.0807774106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2ZSZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carbonmonoxy Sperm Whale Myoglobin at 100 K: Laser on [600 min]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2ZT0", "evidence_id": "EV-PDB-2ZT0-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "2ZT0", "doi": "10.1073/pnas.0807774106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2ZT0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carbonmonoxy Sperm Whale Myoglobin at 100 K: Laser on [750 min]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2ZT1", "evidence_id": "EV-PDB-2ZT1-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "2ZT1", "doi": "10.1073/pnas.0807774106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2ZT1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carbonmonoxy Sperm Whale Myoglobin at 100 K: Laser on [810 min]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -153.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2ZT2", "evidence_id": "EV-PDB-2ZT2-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "2ZT2", "doi": "10.1073/pnas.0807774106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2ZT2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carbonmonoxy Sperm Whale Myoglobin at 120 K: Laser on [600 min]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -153.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2ZT3", "evidence_id": "EV-PDB-2ZT3-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "2ZT3", "doi": "10.1073/pnas.0807774106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2ZT3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carbonmonoxy Sperm Whale Myoglobin at 120 K: Laser on [750 min]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -233.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3ECL", "evidence_id": "EV-PDB-3ECL-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "3ECL", "doi": "10.1073/pnas.0807774106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3ECL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carbonmonoxy Sperm Whale Myoglobin at 40 K: Laser on" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4OF9", "evidence_id": "EV-PDB-4OF9-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.241 }, "provenance": { "deposit_id": "4OF9", "doi": "10.1107/S1399004714017787", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4OF9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of K42N variant of sperm whale myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "OXY" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5HAV", "evidence_id": "EV-PDB-5HAV-1", "mappings": [ { "confidence": "high", "justification": "O2 (ligand OXY) bound to the heme.", "rule": "mb-o2-ligand", "state_id": "Mb-oxy", "who": "rule:mb-o2-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.268 }, "provenance": { "deposit_id": "5HAV", "doi": "10.1021/jacs.5b12004", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5HAV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Sperm whale myoglobin mutant L29H F33Y F43H (F33Y CuBMb) with oxygen bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5C6Y", "evidence_id": "EV-PDB-5C6Y-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.793 }, "provenance": { "deposit_id": "5C6Y", "doi": "10.1039/c5dt03040d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5C6Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "A sperm whale myoglobin double mutant L29H/F43Y Mb with a Tyr-heme cross-link" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -196.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5B85", "evidence_id": "EV-PDB-5B85-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "5B85", "doi": "10.1039/c6mb00537c", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5B85" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of ferric F138Y sperm whale myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -196.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5B84", "evidence_id": "EV-PDB-5B84-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.61 }, "provenance": { "deposit_id": "5B84", "doi": "10.1039/c6mb00537c", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5B84" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray crystal structure of met I107Y sperm whale myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4TYX", "evidence_id": "EV-PDB-4TYX-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.64 }, "provenance": { "deposit_id": "4TYX", "doi": "10.1021/ja5054863", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4TYX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of aquoferric sperm whale myoglobin L29H/F33Y/F43H/S92A mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4QAU", "evidence_id": "EV-PDB-4QAU-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.597 }, "provenance": { "deposit_id": "4QAU", "doi": "10.1002/cbic.201402504", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4QAU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of F43Y mutant of sperm whale myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4PQC", "evidence_id": "EV-PDB-4PQC-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.503 }, "provenance": { "deposit_id": "4PQC", "doi": "10.1002/open.201402108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4PQC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "A sperm whale myoglobin single mutant F43H Mb with native His93 coordination" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4PQB", "evidence_id": "EV-PDB-4PQB-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.942 }, "provenance": { "deposit_id": "4PQB", "doi": "10.1002/open.201402108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4PQB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "A sperm whale myoglobin double mutant L29E/F43H Mb with a non-native bis-His (His64/His93) coordination" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4PQ6", "evidence_id": "EV-PDB-4PQ6-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "4PQ6", "doi": "10.1002/open.201402108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4PQ6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "A sperm whale myoglobin single mutant L29E Mb with native His93 coordination" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4PNJ", "evidence_id": "EV-PDB-4PNJ-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.36 }, "provenance": { "deposit_id": "4PNJ", "doi": "10.1073/pnas.1418733111", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4PNJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Recombinant Sperm Whale P6 Myoglobin Solved with Single Pulse Free Electron Laser Data" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4OOD", "evidence_id": "EV-PDB-4OOD-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.24 }, "provenance": { "deposit_id": "4OOD", "doi": "10.1107/S1399004714017787", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4OOD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of K42Y mutant of sperm whale myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "N2O", "SO4", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NXC", "evidence_id": "EV-PDB-4NXC-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "4NXC", "doi": "10.1097/ALN.0000000000000435", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NXC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPERM WHALE MYOGLOBIN UNDER 30 BAR NITROUS Oxide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4", "XE", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NXA", "evidence_id": "EV-PDB-4NXA-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "4NXA", "doi": "10.1097/ALN.0000000000000435", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NXA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPERM WHALE MYOGLOBIN UNDER XENON PRESSURE 30 Bar" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZNH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.77, "salt_mM": null, "temperature_c": -196.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4MXL", "evidence_id": "EV-PDB-4MXL-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "4MXL", "doi": "10.1002/anie.201308431", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4MXL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of ZnPFeBMb1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FE2", "ZNH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.77, "salt_mM": null, "temperature_c": -196.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4MXK", "evidence_id": "EV-PDB-4MXK-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.52 }, "provenance": { "deposit_id": "4MXK", "doi": "10.1002/anie.201308431", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4MXK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of Fe(II)-ZnPIXFeBMb1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4MBN", "evidence_id": "EV-PDB-4MBN-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "4MBN", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4MBN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "REFINEMENT OF MYOGLOBIN AND CYTOCHROME C" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LPI", "evidence_id": "EV-PDB-4LPI-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.36 }, "provenance": { "deposit_id": "4LPI", "doi": "10.1039/c5dt03040d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LPI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "A sperm whale myoglobin double mutant L29H/F43Y Mb with a distal hydrogen-bonding network" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4IT8", "evidence_id": "EV-PDB-4IT8-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "4IT8", "doi": "10.1039/C3RA40839F", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4IT8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "A sperm whale myoglobin mutant L29H Mb with two distal histidines" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DMS", "EDO", "HEM", "OXY", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4H0B", "evidence_id": "EV-PDB-4H0B-1", "mappings": [ { "confidence": "high", "justification": "O2 (ligand OXY) bound to the heme.", "rule": "mb-o2-ligand", "state_id": "Mb-oxy", "who": "rule:mb-o2-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.26 }, "provenance": { "deposit_id": "4H0B", "doi": "10.1107/S1744309112045514", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4H0B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Complex of G65T Myoglobin with DMSO in its Distal Cavity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "HEM", "IPH", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4H07", "evidence_id": "EV-PDB-4H07-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.14 }, "provenance": { "deposit_id": "4H07", "doi": "10.1107/S1744309112045514", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4H07" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Complex of G65T Myoglobin with Phenol in its Proximal Cavity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -196.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4FWZ", "evidence_id": "EV-PDB-4FWZ-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "4FWZ", "doi": "10.1002/anie.201201981", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4FWZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Aquoferric CuB myoglobin (L29H F43H sperm whale myoglobin)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CU", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -196.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4FWY", "evidence_id": "EV-PDB-4FWY-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "4FWY", "doi": "10.1002/anie.201201981", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4FWY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "F33Y CuB myoglobin (F33Y L29H F43H sperm whale myoglobin) with copper bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -196.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4FWX", "evidence_id": "EV-PDB-4FWX-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "4FWX", "doi": "10.1002/anie.201201981", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4FWX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Aquoferric F33Y CuB myoglobin (F33Y L29H F43H sperm whale myoglobin)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "IPH", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3U3E", "evidence_id": "EV-PDB-3U3E-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "3U3E", "doi": "10.1107/S1744309112045514", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3U3E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Complex of Wild Type Myoglobin with Phenol in its Proximal Cavity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "EDO", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SDN", "evidence_id": "EV-PDB-3SDN-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "3SDN", "doi": "10.1021/bi2009129", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SDN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of G65I sperm whale myoglobin mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3OGB", "evidence_id": "EV-PDB-3OGB-1", "mappings": [ { "confidence": "medium", "justification": "Title says deoxy and no CO, O2 or NO ligand is present.", "rule": "mb-deoxy-title", "state_id": "Mb-deoxy", "who": "rule:mb-deoxy-title" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "3OGB", "doi": "10.1074/jbc.M110.176271", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3OGB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Sperm whale myoglobin mutant H64W deoxy-form" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3O89", "evidence_id": "EV-PDB-3O89-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "3O89", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3O89" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Sperm Whale Myoglobin G65T" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3NML", "evidence_id": "EV-PDB-3NML-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.68 }, "provenance": { "deposit_id": "3NML", "doi": "10.1074/jbc.M110.176271", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3NML" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Sperm whale myoglobin mutant H64W carbonmonoxy-form" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CU", "CYN", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3MN0", "evidence_id": "EV-PDB-3MN0-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "3MN0", "doi": "10.1021/ja103516n", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3MN0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Introducing a 2-His-1-Glu Non-Heme Iron Center into Myoglobin confers Nitric Oxide Reductase activity: Cu(II)-CN-FeBMb(-His) form" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3M3B", "evidence_id": "EV-PDB-3M3B-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "3M3B", "doi": "10.1073/pnas.1000526107", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3M3B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The roles of glutamates and metal ions in a rationally designed nitric oxide reductase based on myoglobin: Zn(II)-I107E FeBMb (Zn(II) binding to FeB site)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CU", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3M3A", "evidence_id": "EV-PDB-3M3A-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.37 }, "provenance": { "deposit_id": "3M3A", "doi": "10.1073/pnas.1000526107", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3M3A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The roles of glutamates and metal ions in a rationally designed nitric oxide reductase based on myoglobin: Cu(II)-I107E FeBMb (Cu(II) binding to FeB site)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FE2", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3M39", "evidence_id": "EV-PDB-3M39-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "3M39", "doi": "10.1073/pnas.1000526107", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3M39" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The roles of glutamates and metal ions in a rationally designed nitric oxide reductase based on myoglobin: Fe(II)-I107E FeBMb (Fe(II) binding to FeB site)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3M38", "evidence_id": "EV-PDB-3M38-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.42 }, "provenance": { "deposit_id": "3M38", "doi": "10.1073/pnas.1000526107", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3M38" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The roles of Glutamates and Metal ions in a rationally designed nitric oxide reductase based on myoglobin: I107E FeBMb (No metal ion binding to FeB site)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FE2", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3K9Z", "evidence_id": "EV-PDB-3K9Z-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.72 }, "provenance": { "deposit_id": "3K9Z", "doi": "10.1038/nature08620", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3K9Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Rational Design of a Structural and Functional Nitric Oxide Reductase" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3H58", "evidence_id": "EV-PDB-3H58-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "3H58", "doi": "10.1021/ja903409j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3H58" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Myoglobin Cavity Mutant H64LV68N Met form" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3H57", "evidence_id": "EV-PDB-3H57-1", "mappings": [ { "confidence": "medium", "justification": "Title says deoxy and no CO, O2 or NO ligand is present.", "rule": "mb-deoxy-title", "state_id": "Mb-deoxy", "who": "rule:mb-deoxy-title" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "3H57", "doi": "10.1021/ja903409j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3H57" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Myoglobin Cavity Mutant H64LV68N Deoxy form" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -153.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3EDB", "evidence_id": "EV-PDB-3EDB-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "3EDB", "doi": "10.1073/pnas.0807774106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3EDB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carbonmonoxy Sperm Whale Myoglobin at 120 K: Laser on [150 min]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3EDA", "evidence_id": "EV-PDB-3EDA-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "3EDA", "doi": "10.1073/pnas.0807774106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3EDA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carbonmonoxy Sperm Whale Myoglobin at 100 K: Laser on [150 min]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -133.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3ED9", "evidence_id": "EV-PDB-3ED9-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "3ED9", "doi": "10.1073/pnas.0807774106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3ED9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carbonmonoxy Sperm Whale Myoglobin at 140 K: Laser on [30 min]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -153.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3ECZ", "evidence_id": "EV-PDB-3ECZ-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "3ECZ", "doi": "10.1073/pnas.0807774106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3ECZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carbonmonoxy Sperm Whale Myoglobin at 120 K: Laser on [30 min]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3ECX", "evidence_id": "EV-PDB-3ECX-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "3ECX", "doi": "10.1073/pnas.0807774106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3ECX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carbonmonoxy Sperm Whale Myoglobin at 100 K: Laser on [30 min]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -133.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3E5O", "evidence_id": "EV-PDB-3E5O-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "3E5O", "doi": "10.1073/pnas.0807774106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3E5O" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carbonmonoxy Sperm Whale Myoglobin at 140 K: Laser off" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -153.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3E5I", "evidence_id": "EV-PDB-3E5I-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.22 }, "provenance": { "deposit_id": "3E5I", "doi": "10.1073/pnas.0807774106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3E5I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carbonmonoxy Sperm Whale Myoglobin at 120 K: Laser off" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3E55", "evidence_id": "EV-PDB-3E55-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "3E55", "doi": "10.1073/pnas.0807774106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3E55" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carbonmonoxy Sperm Whale Myoglobin at 100 K: Laser off" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -233.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3E4N", "evidence_id": "EV-PDB-3E4N-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "3E4N", "doi": "10.1073/pnas.0807774106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3E4N" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carbonmonoxy Sperm Whale Myoglobin at 40 K: Laser off" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "RUO", "SO4", "ZNH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3ASE", "evidence_id": "EV-PDB-3ASE-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "3ASE", "doi": "10.1002/anie.201008004", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3ASE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Zinc myoglobin soaked with Ru3O cluster" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "HEM", "LCY", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3A2G", "evidence_id": "EV-PDB-3A2G-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "3A2G", "doi": "10.1021/bc9003052", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3A2G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of K102C-Myoglobin conjugated with Fluorescein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -153.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2ZT4", "evidence_id": "EV-PDB-2ZT4-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "2ZT4", "doi": "10.1073/pnas.0807774106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2ZT4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carbonmonoxy Sperm Whale Myoglobin at 120 K: Laser on [810 min]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -196.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5HLQ", "evidence_id": "EV-PDB-5HLQ-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "5HLQ", "doi": "10.1016/j.niox.2016.04.007", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5HLQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray crystal structure of met F43H/H64A sperm whale myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "NO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -196.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5HLU", "evidence_id": "EV-PDB-5HLU-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "5HLU", "doi": "10.1016/j.niox.2016.04.007", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5HLU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray crystal structure of met F43H/H64A sperm whale myoglobin in complex with nitric oxide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "NO2" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -196.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5HLX", "evidence_id": "EV-PDB-5HLX-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "5HLX", "doi": "10.1016/j.niox.2016.04.007", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5HLX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray crystal structure of met F43H/H64A sperm whale myoglobin in complex with nitrite" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "6CO", "GOL", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5IKS", "evidence_id": "EV-PDB-5IKS-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.87 }, "provenance": { "deposit_id": "5IKS", "doi": "10.1016/j.jinorgbio.2016.06.028", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5IKS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Wild-type sperm whale myoglobin with a Fe-phenyl moiety" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "6CQ", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5ILE", "evidence_id": "EV-PDB-5ILE-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.77 }, "provenance": { "deposit_id": "5ILE", "doi": "10.1016/j.jinorgbio.2016.06.028", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5ILE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H64A sperm whale myoglobin with a Fe-tolyl moiety" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "4HE", "GOL", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5ILM", "evidence_id": "EV-PDB-5ILM-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5ILM", "doi": "10.1016/j.jinorgbio.2016.06.028", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5ILM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H64A sperm whale myoglobin with a Fe-chlorophenyl moiety" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "4HE", "GOL", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5ILR", "evidence_id": "EV-PDB-5ILR-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.87 }, "provenance": { "deposit_id": "5ILR", "doi": "10.1016/j.jinorgbio.2016.06.028", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5ILR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H64Q sperm whale myoglobin with a Fe-chlorophenyl moiety" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5JOM", "evidence_id": "EV-PDB-5JOM-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "5JOM", "doi": "10.1107/S2059798316010834", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5JOM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of CO-bound sperm whale myoglobin using a fixed target crystallography chip" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "3QM", "GOL", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KD1", "evidence_id": "EV-PDB-5KD1-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5KD1", "doi": "10.1016/j.niox.2017.04.012", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KD1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Sperm whale myoglobin H64A with nitrosoamphetamine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KKK", "evidence_id": "EV-PDB-5KKK-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5KKK", "doi": "10.1021/acs.cgd.6b00950", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KKK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "1.7-Angstrom In situ Mylar structure of sperm whale myoglobin (SWMb-CO) at 100 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 20.85 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5M3S", "evidence_id": "EV-PDB-5M3S-1", "mappings": [ { "confidence": "medium", "justification": "Title says aquomet or metmyoglobin.", "rule": "mb-met-title", "state_id": "Mb-aquomet", "who": "rule:mb-met-title" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "5M3S", "doi": "10.1107/S2059798317002996", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5M3S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Low-dose fixed target serial synchrotron crystallography structure of Metmyoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "MYOGLOBIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5MBN", "evidence_id": "EV-PDB-5MBN-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "5MBN", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5MBN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "REFINEMENT OF MYOGLOBIN AND CYTOCHROME C" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5O41", "evidence_id": "EV-PDB-5O41-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "5O41", "doi": "10.1107/S2059798317002996", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5O41" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Low-dose fixed target serial synchrotron crystallography structure of sperm whale myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5OJ9", "evidence_id": "EV-PDB-5OJ9-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.483 }, "provenance": { "deposit_id": "5OJ9", "doi": "10.1021/jacs.7b12621", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5OJ9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Mb NMH" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "IMD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5OJA", "evidence_id": "EV-PDB-5OJA-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.347 }, "provenance": { "deposit_id": "5OJA", "doi": "10.1021/jacs.7b12621", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5OJA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of MbQ" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "IMD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5OJB", "evidence_id": "EV-PDB-5OJB-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.543 }, "provenance": { "deposit_id": "5OJB", "doi": "10.1021/jacs.7b12621", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5OJB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of MbQ NMH" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "HEM", "NO2", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5UT7", "evidence_id": "EV-PDB-5UT7-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "5UT7", "doi": "10.1021/acs.biochem.8b00542", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5UT7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Wild-type sperm whale myoglobin with nitrite" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5UT8", "evidence_id": "EV-PDB-5UT8-1", "mappings": [ { "confidence": "medium", "justification": "Title says deoxy and no CO, O2 or NO ligand is present.", "rule": "mb-deoxy-title", "state_id": "Mb-deoxy", "who": "rule:mb-deoxy-title" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.78 }, "provenance": { "deposit_id": "5UT8", "doi": "10.1021/acs.biochem.8b00542", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5UT8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Deoxy form of sperm whale myoglobin H64A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "HEM", "NO2", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5UT9", "evidence_id": "EV-PDB-5UT9-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "5UT9", "doi": "10.1021/acs.biochem.8b00542", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5UT9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Sperm whale myoglobin H64A with nitrite" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "HEM", "NO2", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5UTA", "evidence_id": "EV-PDB-5UTA-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.81 }, "provenance": { "deposit_id": "5UTA", "doi": "10.1021/acs.biochem.8b00542", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5UTA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Sperm whale myoglobin H64Q with nitrite" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5UTB", "evidence_id": "EV-PDB-5UTB-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.78 }, "provenance": { "deposit_id": "5UTB", "doi": "10.1021/acs.biochem.8b00542", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5UTB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Met form of sperm whale myoglobin V68A/I107Y" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5UTC", "evidence_id": "EV-PDB-5UTC-1", "mappings": [ { "confidence": "medium", "justification": "Title says deoxy and no CO, O2 or NO ligand is present.", "rule": "mb-deoxy-title", "state_id": "Mb-deoxy", "who": "rule:mb-deoxy-title" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "5UTC", "doi": "10.1021/acs.biochem.8b00542", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5UTC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Deoxy form of sperm whale myoglobin V68A/I107Y" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "NO2", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5UTD", "evidence_id": "EV-PDB-5UTD-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.78 }, "provenance": { "deposit_id": "5UTD", "doi": "10.1021/acs.biochem.8b00542", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5UTD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Sperm whale myoglobin V68A/I107Y with nitrite" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5VNU", "evidence_id": "EV-PDB-5VNU-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.584 }, "provenance": { "deposit_id": "5VNU", "doi": "10.1021/jacs.7b05800", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5VNU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Nonheme Iron Replacement in a Biosynthetic Nitric Oxide Reductase Model Performing O2 Reduction to Water: Mn-bound FeBMb" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CO", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5VRT", "evidence_id": "EV-PDB-5VRT-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.995 }, "provenance": { "deposit_id": "5VRT", "doi": "10.1021/jacs.7b05800", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5VRT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Nonheme Iron Replacement in a Biosynthetic Nitric Oxide Reductase Model Performing O2 Reduction to Water: Co-bound FeBMb" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "HEM", "NO", "NO2", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5VZN", "evidence_id": "EV-PDB-5VZN-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5VZN", "doi": "10.1021/acs.biochem.8b00542", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5VZN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Wild-type sperm whale myoglobin with nitric oxide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "HEM", "NO", "NO2", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5VZO", "evidence_id": "EV-PDB-5VZO-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.78 }, "provenance": { "deposit_id": "5VZO", "doi": "10.1021/acs.biochem.8b00542", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5VZO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Sperm whale myoglobin H64A with nitric oxide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "HEM", "NO", "NO2", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5VZP", "evidence_id": "EV-PDB-5VZP-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.78 }, "provenance": { "deposit_id": "5VZP", "doi": "10.1021/acs.biochem.8b00542", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5VZP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Sperm whale myoglobin H64Q with nitric oxide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "NO", "NO2", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5VZQ", "evidence_id": "EV-PDB-5VZQ-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.79 }, "provenance": { "deposit_id": "5VZQ", "doi": "10.1021/acs.biochem.8b00542", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5VZQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Sperm whale myoglobin V68A/I107Y with nitric oxide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5WJK", "evidence_id": "EV-PDB-5WJK-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "5WJK", "doi": "10.1038/nprot.2017.135", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5WJK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "2.0-Angstrom In situ Mylar structure of sperm whale myoglobin (SWMb) at 293 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -183.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5XKV", "evidence_id": "EV-PDB-5XKV-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "5XKV", "doi": "10.1039/c7dt02302b", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5XKV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "structure of sperm whale myoglobin F138W" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "89R", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.3, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5XL0", "evidence_id": "EV-PDB-5XL0-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "5XL0", "doi": "10.1021/acs.biochem.7b00457", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5XL0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "met-aquo form of sperm whale myoglobin reconstituted with 7-PF, a heme possesseing CF3 group as side chain" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5YCE", "evidence_id": "EV-PDB-5YCE-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.77 }, "provenance": { "deposit_id": "5YCE", "doi": "10.1038/s41598-018-34984-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5YCE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Sperm whale myoglobin swMb" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Ancestral myoglobin aMbWb of Basilosaurus relative (monophyly) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5YCH", "evidence_id": "EV-PDB-5YCH-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.354 }, "provenance": { "deposit_id": "5YCH", "doi": "10.1038/s41598-018-34984-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5YCH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ancestral myoglobin aMbWb of Basilosaurus relative (monophyly)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5ZEO", "evidence_id": "EV-PDB-5ZEO-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.77 }, "provenance": { "deposit_id": "5ZEO", "doi": "10.1039/c8cc01646a", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5ZEO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of sperm whale V21C/V66C/F46S myoglobin mutant with an intramolecular disulfide bond" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5ZZF", "evidence_id": "EV-PDB-5ZZF-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "5ZZF", "doi": "10.1021/acscatal.8b02979", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5ZZF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of F43Y/H64D sperm whale myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "T6C" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5ZZG", "evidence_id": "EV-PDB-5ZZG-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "5ZZG", "doi": "10.1021/acscatal.8b02979", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5ZZG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of F43Y/H64D sperm whale myoglobin in complex with TCP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "HEM", "NO2", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6CF0", "evidence_id": "EV-PDB-6CF0-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.64 }, "provenance": { "deposit_id": "6CF0", "doi": "10.1021/acs.biochem.8b00542", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6CF0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Sperm Whale Myoglobin H64V Mutant with Nitrite" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.57, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D45", "evidence_id": "EV-PDB-6D45-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.779 }, "provenance": { "deposit_id": "6D45", "doi": "10.1073/pnas.1720298115", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D45" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "L89S Mutant of FeBMb Sperm Whale Myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HEM", "NOE", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6E03", "evidence_id": "EV-PDB-6E03-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.76 }, "provenance": { "deposit_id": "6E03", "doi": "10.1021/acs.biochem.2c00725", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6E03" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "sperm whale myoglobin nitrosoethane adduct" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "NA", "SO4", "XEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6E04", "evidence_id": "EV-PDB-6E04-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "6E04", "doi": "10.1021/acs.biochem.2c00725", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6E04" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "sperm whale myoglobin 1-nitrosopropane" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6F17", "evidence_id": "EV-PDB-6F17-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "6F17", "doi": "10.1038/s41929-018-0105-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6F17" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Mb NMH H64V, V68A mutant resting state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EEE", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6F18", "evidence_id": "EV-PDB-6F18-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "6F18", "doi": "10.1038/s41929-018-0105-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6F18" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Mb NMH H64V, V68A mutant complex with EDA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EEE", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6F19", "evidence_id": "EV-PDB-6F19-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.895 }, "provenance": { "deposit_id": "6F19", "doi": "10.1038/s41929-018-0105-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6F19" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Mb NMH H64V, V68A mutant complex with EDA incubated at room temperature for 5 min" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EEE", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6F1A", "evidence_id": "EV-PDB-6F1A-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.399 }, "provenance": { "deposit_id": "6F1A", "doi": "10.1038/s41929-018-0105-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6F1A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Mb NMH H64V, V68A mutant complex with EDA incubated at room temperature for 20 min" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "NSM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6E02", "evidence_id": "EV-PDB-6E02-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.76 }, "provenance": { "deposit_id": "6E02", "doi": "10.1021/acs.biochem.2c00725", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6E02" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "WT swMb-MeNO" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "sperm whale myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5YZF", "evidence_id": "EV-PDB-5YZF-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.77 }, "provenance": { "deposit_id": "5YZF", "doi": "10.1016/j.jinorgbio.2018.02.011", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5YZF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray crystal structure of met K42C sperm whale myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -183.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5XKW", "evidence_id": "EV-PDB-5XKW-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5XKW", "doi": "10.1039/c7dt02302b", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5XKW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "myoglobin mutant F43Y/F46Y" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "IMD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5OJC", "evidence_id": "EV-PDB-5OJC-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "5OJC", "doi": "10.1021/jacs.7b12621", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5OJC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of MbQ2.1 NMH" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "6CQ", "GOL", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5ILP", "evidence_id": "EV-PDB-5ILP-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.88 }, "provenance": { "deposit_id": "5ILP", "doi": "10.1016/j.jinorgbio.2016.06.028", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5ILP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H64Q sperm whale myoglobin with a Fe-tolyl moiety" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EEE", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6G5B", "evidence_id": "EV-PDB-6G5B-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "6G5B", "doi": "10.1038/s41929-018-0105-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6G5B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Heme-carbene complex in myoglobin H64V/V68A containing an N-methylhistidine as the proximal ligand, 1.6 angstrom resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6G5T", "evidence_id": "EV-PDB-6G5T-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "6G5T", "doi": "10.1038/s41929-018-0105-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6G5T" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Myoglobin H64V/V68A in the resting state, 1.5 Angstrom resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6JP1", "evidence_id": "EV-PDB-6JP1-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.99 }, "provenance": { "deposit_id": "6JP1", "doi": "10.1039/c9cc02714a", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6JP1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "An X-ray structure of met sperm whale F43Y/T67R myoglobin with Tyr-heme double cross-links" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4", "branched: beta-D-fructofuranose-(2-1)-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6M8F", "evidence_id": "EV-PDB-6M8F-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "6M8F", "doi": "10.1021/acscatal.8b04073", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6M8F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Engineered sperm whale myoglobin-based carbene transferase" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6Z4R", "evidence_id": "EV-PDB-6Z4R-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.96 }, "provenance": { "deposit_id": "6Z4R", "doi": "10.1002/anie.202103437", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6Z4R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "sperm whale myoglobin mutant (H64V V64A) bearing the non-canonical amino acid 3-thienylalanine as axial heme ligand" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7A44", "evidence_id": "EV-PDB-7A44-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "7A44", "doi": "10.1126/sciadv.abf1380", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7A44" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CO-bound sperm whale myoglobin measured by serial synchrotron crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7A45", "evidence_id": "EV-PDB-7A45-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "7A45", "doi": "10.1126/sciadv.abf1380", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7A45" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CO-bound sperm whale myoglobin measured by serial femtosecond crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7CEN", "evidence_id": "EV-PDB-7CEN-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.35 }, "provenance": { "deposit_id": "7CEN", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7CEN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "an x-ray structure of ferric L29E Mb in complex with Mg(II)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7CEZ", "evidence_id": "EV-PDB-7CEZ-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.57 }, "provenance": { "deposit_id": "7CEZ", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7CEZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "An x-ray structure of G5K/Q8K/A19K/V21K Mb mutant with a positive charge" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7EHX", "evidence_id": "EV-PDB-7EHX-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "7EHX", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7EHX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray crystal strcture of F46C/L49C sperm whale myoglobin with an intramolecular disulfide bond" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "HEM", "NA", "PG4", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.6, "salt_mM": null, "temperature_c": -193.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7KYR", "evidence_id": "EV-PDB-7KYR-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.71 }, "provenance": { "deposit_id": "7KYR", "doi": "10.1021/acs.biochem.0c00852", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7KYR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of I107E CuB myoglobin (I107E L29H F43H sperm whale myoglobin)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.6, "salt_mM": null, "temperature_c": -193.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7L3U", "evidence_id": "EV-PDB-7L3U-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.47 }, "provenance": { "deposit_id": "7L3U", "doi": "10.1021/acs.biochem.0c00852", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7L3U" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of I107E F33Y CuB myoglobin (I107E F33Y L29H F43H sperm whale myoglobin)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HEM", "PER" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7L3Y", "evidence_id": "EV-PDB-7L3Y-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.18 }, "provenance": { "deposit_id": "7L3Y", "doi": "10.1021/acs.biochem.0c00852", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7L3Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of oxy-I107E CuB myoglobin (I107E L29H F43H sperm whale myoglobin; partial occupancy)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7SLH", "evidence_id": "EV-PDB-7SLH-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.15 }, "provenance": { "deposit_id": "7SLH", "doi": "10.1038/s41557-023-01435-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7SLH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Engineered sperm whale myoglobin-based carbene transferase MbBTIC-C3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7SLI", "evidence_id": "EV-PDB-7SLI-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "7SLI", "doi": "10.1038/s41557-023-01435-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7SLI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Engineered sperm whale myoglobin-based carbene transferase MbBTIC-C2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7SPE", "evidence_id": "EV-PDB-7SPE-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "7SPE", "doi": "10.1021/acs.biochem.2c00033", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7SPE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of sperm whale myoglobin variant sMb5(O2beY)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "NO3", "OXY", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7SPF", "evidence_id": "EV-PDB-7SPF-1", "mappings": [ { "confidence": "high", "justification": "O2 (ligand OXY) bound to the heme.", "rule": "mb-o2-ligand", "state_id": "Mb-oxy", "who": "rule:mb-o2-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.17 }, "provenance": { "deposit_id": "7SPF", "doi": "10.1021/acs.biochem.2c00033", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7SPF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of sperm whale myoglobin variant sMb5(pCaaF)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "OXY", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7SPH", "evidence_id": "EV-PDB-7SPH-1", "mappings": [ { "confidence": "high", "justification": "O2 (ligand OXY) bound to the heme.", "rule": "mb-o2-ligand", "state_id": "Mb-oxy", "who": "rule:mb-o2-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "7SPH", "doi": "10.1021/acs.biochem.2c00033", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7SPH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of sperm whale myoglobin variant sMb13(pCaaF) in space group P21" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7VDN", "evidence_id": "EV-PDB-7VDN-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.93 }, "provenance": { "deposit_id": "7VDN", "doi": "10.1016/j.bbrc.2022.10.003", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7VDN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High resolution crystal structure of Sperm Whale Myoglobin in the carbonmonoxy form" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "IMD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -153.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7VUC", "evidence_id": "EV-PDB-7VUC-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "7VUC", "doi": "10.1038/s41586-022-05278-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7VUC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Myoglobin mutant L29I/H64G/V68A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7XC9", "evidence_id": "EV-PDB-7XC9-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "7XC9", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7XC9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray crystal structure of sperm whale myoglobin F46C mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7XCF", "evidence_id": "EV-PDB-7XCF-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "7XCF", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7XCF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray crystal structure of sperm whale myoglobin T67C mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8EKO", "evidence_id": "EV-PDB-8EKO-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.34 }, "provenance": { "deposit_id": "8EKO", "doi": "10.1021/acs.biochem.2c00300", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8EKO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Sperm whale myoglobin mutant L29H F33W F43H (F33W CuBMb)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4", "WRK" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8ESS", "evidence_id": "EV-PDB-8ESS-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "8ESS", "doi": "10.1038/s41467-023-43559-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8ESS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Myoglobin variant Mb-cIII complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "IMD", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8ESU", "evidence_id": "EV-PDB-8ESU-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.04 }, "provenance": { "deposit_id": "8ESU", "doi": "10.1038/s41467-023-43559-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8ESU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Myoglobin variant Mb-imi complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "NSM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8F9H", "evidence_id": "EV-PDB-8F9H-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "8F9H", "doi": "10.1021/acs.biochem.2c00725", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8F9H" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H64A swMb-MeNO adduct" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "NOE", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -73.15 }, "construct": { "description": "Myoglobin (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8F9I", "evidence_id": "EV-PDB-8F9I-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "8F9I", "doi": "10.1021/acs.biochem.2c00725", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8F9I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H64A swMb-EtNO adduct" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4", "XEP" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -73.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8F9N", "evidence_id": "EV-PDB-8F9N-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "8F9N", "doi": "10.1021/acs.biochem.2c00725", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8F9N" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H64A swMb-iPrNO adduct" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACM", "GOL", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FB0", "evidence_id": "EV-PDB-8FB0-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.76 }, "provenance": { "deposit_id": "8FB0", "doi": "10.1142/s1088424623500700", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FB0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H64Q Myoglobin in complex with acetamide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "NBE", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FDJ", "evidence_id": "EV-PDB-8FDJ-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "8FDJ", "doi": "10.1016/j.jinorgbio.2023.112304", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FDJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Wild-Type Sperm Whale Myoglobin in Complex with Nitrosobenzene" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EBJ", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8J4L", "evidence_id": "EV-PDB-8J4L-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "8J4L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8J4L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray crystal structure of F46C myoglobin with a covalently linked triazole group" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HNN", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8KFH", "evidence_id": "EV-PDB-8KFH-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.27 }, "provenance": { "deposit_id": "8KFH", "doi": "10.1093/chemle/upad042", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8KFH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of sperm whale myoglobin reconstituted with manganese porphycene" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HNN", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8KFI", "evidence_id": "EV-PDB-8KFI-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.37 }, "provenance": { "deposit_id": "8KFI", "doi": "10.1093/chemle/upad042", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8KFI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of sperm whale myoglobin (F43A/H64I mutant) reconstituted with manganese porphycene" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "GEE", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8QBC", "evidence_id": "EV-PDB-8QBC-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.23 }, "provenance": { "deposit_id": "8QBC", "doi": "10.1021/jacs.3c09279", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8QBC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Reactive amide intermediate in sperm whale myoglobin mutant H64V V68A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "NI", "Y6C" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8XBJ", "evidence_id": "EV-PDB-8XBJ-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "8XBJ", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8XBJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The X-ray structure of F46C myoglobin with a covalently linked Ni-complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "GEE", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8QBA", "evidence_id": "EV-PDB-8QBA-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.39 }, "provenance": { "deposit_id": "8QBA", "doi": "10.1021/jacs.3c09279", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8QBA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Sperm whale myoblogin mutant H64V V68A in complex with glycine ethyl ester" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HNN", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8KFJ", "evidence_id": "EV-PDB-8KFJ-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "8KFJ", "doi": "10.1093/chemle/upad042", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8KFJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of sperm whale myoglobin (F46L/H64A mutant) reconstituted with manganese porphycene" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "9UU", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8J4K", "evidence_id": "EV-PDB-8J4K-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.46 }, "provenance": { "deposit_id": "8J4K", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8J4K" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray crystal structure of F46C myoglobin with a covalently linked phenol group" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4", "XEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -73.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8F9J", "evidence_id": "EV-PDB-8F9J-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "8F9J", "doi": "10.1021/acs.biochem.2c00725", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8F9J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H64A swMb-PrNO adduct" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "IRQ", "KKC", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7YLK", "evidence_id": "EV-PDB-7YLK-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.63 }, "provenance": { "deposit_id": "7YLK", "doi": "10.1021/jacs.2c12226", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7YLK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Myoglobin containing Ir complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7XCQ", "evidence_id": "EV-PDB-7XCQ-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7XCQ", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7XCQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray crystal structure of sperm whale myoglobin H64D mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7VW4", "evidence_id": "EV-PDB-7VW4-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "7VW4", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7VW4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The X-ray structure of sperm whale F46C/L61C myoglobin double mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7SPG", "evidence_id": "EV-PDB-7SPG-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "7SPG", "doi": "10.1021/acs.biochem.2c00033", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7SPG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of sperm whale myoglobin variant sMb13(pCaaF) in space group P212121" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "OXY" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6Z4T", "evidence_id": "EV-PDB-6Z4T-1", "mappings": [ { "confidence": "high", "justification": "O2 (ligand OXY) bound to the heme.", "rule": "mb-o2-ligand", "state_id": "Mb-oxy", "who": "rule:mb-o2-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.23 }, "provenance": { "deposit_id": "6Z4T", "doi": "10.1002/anie.202103437", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6Z4T" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "sperm whale myoglobin mutant (H64V V64A) bearing the non-canonical amino acid 2-Amino-3-(thiazol-5-yl)propanoic acid as axial heme ligand" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Myoglobin, CO-bound (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6N03", "evidence_id": "EV-PDB-6N03-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "6N03", "doi": "10.1107/S2052252519001453", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6N03" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CO-bound Sperm Whale Myoglobin, room temperature structure, last 2 degrees of 5 degree total oscillation and 160 kGy dose" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Myoglobin, CO-bound (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6N02", "evidence_id": "EV-PDB-6N02-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "6N02", "doi": "10.1107/S2052252519001453", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6N02" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CO-bound Sperm Whale Myoglobin, room temperature structure, first 2 degrees of 5 degree total oscillation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CMO", "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6MV0", "evidence_id": "EV-PDB-6MV0-1", "mappings": [ { "confidence": "high", "justification": "CO (ligand CMO) bound to the heme.", "rule": "mb-co-ligand", "state_id": "Mb-CO", "who": "rule:mb-co-ligand" } ], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.97 }, "provenance": { "deposit_id": "6MV0", "doi": "10.1107/S2052252519001453", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6MV0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CO-bound Sperm Whale Myoglobin, room temperature structure solved by serial 5degree oscillation crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "JZ3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6KRF", "evidence_id": "EV-PDB-6KRF-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.86 }, "provenance": { "deposit_id": "6KRF", "doi": "10.1021/acscatal.9b05080", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6KRF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "An X-ray structure of ferric F43Y/F46S sperm whale myoglobin in complex with guaiacol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6KRC", "evidence_id": "EV-PDB-6KRC-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.39 }, "provenance": { "deposit_id": "6KRC", "doi": "10.1021/acscatal.9b05080", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6KRC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "An X-ray structure of ferric F43Y/F46S sperm whale myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EEE", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6G5A", "evidence_id": "EV-PDB-6G5A-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.483 }, "provenance": { "deposit_id": "6G5A", "doi": "10.1038/s41929-018-0105-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6G5A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Heme-carbene complex in myoglobin H64V/V68A containing an N-methylhistidine as the proximal ligand, 1.48 angstrom resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "NI", "Y6C" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8XC2", "evidence_id": "EV-PDB-8XC2-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8XC2", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8XC2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The X-ray structure of F46C myoglobin with a covalently linked Ni-complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "O" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9DTH", "evidence_id": "EV-PDB-9DTH-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "9DTH", "doi": "10.1021/jacs.5c12710", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9DTH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Tyr-His linked F33Y CuBMb" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HEM", "PEG", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9DTI", "evidence_id": "EV-PDB-9DTI-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.681 }, "provenance": { "deposit_id": "9DTI", "doi": "10.1021/jacs.5c12710", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9DTI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "F33Y CuBMb" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1D9G", "CU", "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9IJO", "evidence_id": "EV-PDB-9IJO-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.53 }, "provenance": { "deposit_id": "9IJO", "doi": "10.1021/acs.inorgchem.4c03093", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9IJO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray crystal structure of F46C myoglobin with a covalently linked 4-methyl-2,2'-bipyridine group in complex with Cu2+" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9LMB", "evidence_id": "EV-PDB-9LMB-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.64 }, "provenance": { "deposit_id": "9LMB", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9LMB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "crystal structure of the F46H/L49D myoglobin mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P1E", "evidence_id": "EV-PDB-9P1E-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.15 }, "provenance": { "deposit_id": "9P1E", "doi": "10.1038/s41467-026-68327-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P1E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Myoglobin variant RR22" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEM", "IMD", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Myoglobin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P1F", "evidence_id": "EV-PDB-9P1F-1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "9P1F", "doi": "10.1038/s41467-026-68327-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P1F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Myoglobin variant RR22 in complex with imidazole" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 8.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1027", "evidence_id": "EV-BMRB-1027", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1027", "doi": "10.13018/BMR1027", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1027" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H NMR Study of the Role of Individual Heme Propionates in Modulating Structural and Dynamic Properties of the Heme Pocket in Myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 8.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1029", "evidence_id": "EV-BMRB-1029", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1029", "doi": "10.13018/BMR1029", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1029" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H NMR Study of the Role of Individual Heme Propionates in Modulating Structural and Dynamic Properties of the Heme Pocket in Myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.3, "salt_mM": null, "temperature_c": 31.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1200", "evidence_id": "EV-BMRB-1200", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1200", "doi": "10.13018/BMR1200", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1200" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Nuclear-magnetic-resonance investigations of the biliverdin-apomyoglobin complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 8.6, "salt_mM": null, "temperature_c": 34.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1413", "evidence_id": "EV-BMRB-1413", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1413", "doi": "10.13018/BMR1413", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1413" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H NMR Resonance Assignment of the Active Site Residues of Paramagnetic Proteins by 2D Bond Correlation Spectroscopy: Metcyanomyoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 8.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1455", "evidence_id": "EV-BMRB-1455", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1455", "doi": "10.13018/BMR1455", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1455" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H-NMR study of the mechanism of assembly and equilibrium heme orientation of sperm whale myoglobin reconstituted with protohemin type-isomers" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 8.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1457", "evidence_id": "EV-BMRB-1457", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1457", "doi": "10.13018/BMR1457", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1457" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H-NMR study of the mechanism of assembly and equilibrium heme orientation of sperm whale myoglobin reconstituted with protohemin type-isomers" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 8.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1459", "evidence_id": "EV-BMRB-1459", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1459", "doi": "10.13018/BMR1459", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1459" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H-NMR study of the mechanism of assembly and equilibrium heme orientation of sperm whale myoglobin reconstituted with protohemin type-isomers" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 8.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1461", "evidence_id": "EV-BMRB-1461", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1461", "doi": "10.13018/BMR1461", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1461" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H-NMR study of the mechanism of assembly and equilibrium heme orientation of sperm whale myoglobin reconstituted with protohemin type-isomers" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 8.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1463", "evidence_id": "EV-BMRB-1463", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1463", "doi": "10.13018/BMR1463", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1463" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H-NMR study of the mechanism of assembly and equilibrium heme orientation of sperm whale myoglobin reconstituted with protohemin type-isomers" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 8.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1465", "evidence_id": "EV-BMRB-1465", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1465", "doi": "10.13018/BMR1465", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1465" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H-NMR study of the mechanism of assembly and equilibrium heme orientation of sperm whale myoglobin reconstituted with protohemin type-isomers" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 8.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1467", "evidence_id": "EV-BMRB-1467", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1467", "doi": "10.13018/BMR1467", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1467" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H-NMR study of the mechanism of assembly and equilibrium heme orientation of sperm whale myoglobin reconstituted with protohemin type-isomers" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 8.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1469", "evidence_id": "EV-BMRB-1469", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1469", "doi": "10.13018/BMR1469", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1469" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H-NMR study of the mechanism of assembly and equilibrium heme orientation of sperm whale myoglobin reconstituted with protohemin type-isomers" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 8.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1471", "evidence_id": "EV-BMRB-1471", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1471", "doi": "10.13018/BMR1471", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1471" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H-NMR study of the mechanism of assembly and equilibrium heme orientation of sperm whale myoglobin reconstituted with protohemin type-isomers" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 5.8, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=15589", "evidence_id": "EV-BMRB-15589", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr15589", "doi": "10.13018/BMR15589", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=15589" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Backbone H, N and CA Chemical Shift Assignments for ApoMb(1-77) in Complex with DnaK Binding Domain" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.0, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts, T1 relaxation values, T2 relaxation values", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=16217", "evidence_id": "EV-BMRB-16217", "mappings": [], "molecule_id": "P02185", "observable": { "type": "relaxation_rate", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr16217", "doi": "10.13018/BMR16217", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=16217" }, "reader": null, "source_kind": "deposit", "technique": "nmr_dynamics", "title": "Backbone 1H, 13CA, and 15N Chemical Shifts Assignments and 15N T1 and T2 Relaxation Parameters for the N-terminal (1-119) Fragment of sperm whale apomyoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.0, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts, heteronuclear NOE values, T1 relaxation values, T2 relaxation values", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=16218", "evidence_id": "EV-BMRB-16218", "mappings": [], "molecule_id": "P02185", "observable": { "type": "relaxation_rate", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr16218", "doi": "10.13018/BMR16218", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=16218" }, "reader": null, "source_kind": "deposit", "technique": "nmr_dynamics", "title": "Backbone 1H, 13CA, and 15N Chemical Shifts Assignments and 15N T1 and T2 Relaxation Parameters for the N-terminal (1-119) Fragment of sperm whale apomyoglobin in the presence of DnaK-beta" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 2.4, "salt_mM": null, "temperature_c": 25.0 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=16499", "evidence_id": "EV-BMRB-16499", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr16499", "doi": "10.13018/BMR16499", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=16499" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "(1-77)Apomyoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 2.4, "salt_mM": null, "temperature_c": 25.0 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=16500", "evidence_id": "EV-BMRB-16500", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr16500", "doi": "10.13018/BMR16500", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=16500" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "(1-119)Apomyoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 2.4, "salt_mM": null, "temperature_c": 25.0 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=16501", "evidence_id": "EV-BMRB-16501", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr16501", "doi": "10.13018/BMR16501", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=16501" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "(1-153)Apomyoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.0, "salt_mM": null, "temperature_c": 34.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1752", "evidence_id": "EV-BMRB-1752", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1752", "doi": "10.13018/BMR1752", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1752" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "NMR study of Galeorhinus japonicus myoglobin (1H-NMR study of molecular structure of the heme cavity)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=2345", "evidence_id": "EV-BMRB-2345", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr2345", "doi": "10.13018/BMR2345", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=2345" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Influence of Molecular Correlation Time on the Homonuclear Overhauser Effect in Paramagnetic Proteins" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=2346", "evidence_id": "EV-BMRB-2346", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr2346", "doi": "10.13018/BMR2346", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=2346" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Influence of Molecular Correlation Time on the Homonuclear Overhauser Effect in Paramagnetic Proteins" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=2347", "evidence_id": "EV-BMRB-2347", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr2347", "doi": "10.13018/BMR2347", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=2347" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Influence of Molecular Correlation Time on the Homonuclear Overhauser Effect in Paramagnetic Proteins" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=2348", "evidence_id": "EV-BMRB-2348", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr2348", "doi": "10.13018/BMR2348", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=2348" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Influence of Molecular Correlation Time on the Homonuclear Overhauser Effect in Paramagnetic Proteins" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 9.0, "salt_mM": null, "temperature_c": 34.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=2431", "evidence_id": "EV-BMRB-2431", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr2431", "doi": "10.13018/BMR2431", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=2431" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Influence of Propionate Side Chains on the Equilibrium Heme Orientation in Sperm Whale Myoglobin. Heme Resonance Assignments and Structure Determination by Nuclear Overhauser Effect Measurements" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 9.0, "salt_mM": null, "temperature_c": 34.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=2432", "evidence_id": "EV-BMRB-2432", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr2432", "doi": "10.13018/BMR2432", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=2432" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Influence of Propionate Side Chains on the Equilibrium Heme Orientation in Sperm Whale Myoglobin. Heme Resonance Assignments and Structure Determination by Nuclear Overhauser Effect Measurements" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 9.0, "salt_mM": null, "temperature_c": 34.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=2433", "evidence_id": "EV-BMRB-2433", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr2433", "doi": "10.13018/BMR2433", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=2433" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Influence of Propionate Side Chains on the Equilibrium Heme Orientation in Sperm Whale Myoglobin. Heme Resonance Assignments and Structure Determination by Nuclear Overhauser Effect Measurements" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 9.0, "salt_mM": null, "temperature_c": 34.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=2434", "evidence_id": "EV-BMRB-2434", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr2434", "doi": "10.13018/BMR2434", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=2434" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Influence of Propionate Side Chains on the Equilibrium Heme Orientation in Sperm Whale Myoglobin. Heme Resonance Assignments and Structure Determination by Nuclear Overhauser Effect Measurements" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 8.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=291", "evidence_id": "EV-BMRB-291", "mappings": [ { "confidence": "medium", "justification": "Title says aquomet or metmyoglobin.", "rule": "mb-met-title", "state_id": "Mb-aquomet", "who": "rule:mb-met-title" } ], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr291", "doi": "10.13018/BMR291", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=291" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Solution Structural Characterization of Cyanometmyoglobin: Resonance Assignment of Heme Cavity Residues by Two-Dimensional NMR" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 8.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=292", "evidence_id": "EV-BMRB-292", "mappings": [ { "confidence": "medium", "justification": "Title says aquomet or metmyoglobin.", "rule": "mb-met-title", "state_id": "Mb-aquomet", "who": "rule:mb-met-title" } ], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr292", "doi": "10.13018/BMR292", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=292" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Solution Structural Characterization of Cyanometmyoglobin: Resonance Assignment of Heme Cavity Residues by Two-Dimensional NMR" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 8.6, "salt_mM": null, "temperature_c": 29.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=293", "evidence_id": "EV-BMRB-293", "mappings": [ { "confidence": "medium", "justification": "Title says aquomet or metmyoglobin.", "rule": "mb-met-title", "state_id": "Mb-aquomet", "who": "rule:mb-met-title" } ], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr293", "doi": "10.13018/BMR293", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=293" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Solution Structural Characterization of Cyanometmyoglobin: Resonance Assignment of Heme Cavity Residues by Two-Dimensional NMR" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 5.6, "salt_mM": null, "temperature_c": 35.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=40", "evidence_id": "EV-BMRB-40", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr40", "doi": "10.13018/BMR40", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=40" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Assignment of Resonances in the 1H Nuclear Magnetic Resonance Spectrum of the Carbon Monoxide Complex of the Sperm Whale Myoglobin by Phase-sensitive Two-dimensional Techniques" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 5.6, "salt_mM": null, "temperature_c": 34.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=4061", "evidence_id": "EV-BMRB-4061", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr4061", "doi": "10.13018/BMR4061", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=4061" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Overexpression of Myoglobin and Assignment of Its Amide, C Alpha and C Beta Resonances" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 5.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=426", "evidence_id": "EV-BMRB-426", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr426", "doi": "10.13018/BMR426", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=426" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Proton nuclear Overhauser effect investigation of the heme pocket expansion in trimethyl phosphine sperm whale myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.1, "salt_mM": null, "temperature_c": 49.85 }, "construct": { "description": "BMRB data: 1H chemical shifts, 13C chemical shifts, 15N chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=4568", "evidence_id": "EV-BMRB-4568", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr4568", "doi": "10.13018/BMR4568", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=4568" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Native and non-native secondary structure and dynamics in the pH 4 intermediate of apomyoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 2.3, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts, 13C chemical shifts, 15N chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=4676", "evidence_id": "EV-BMRB-4676", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr4676", "doi": "10.13018/BMR4676", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=4676" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Assignment of 1H, 13C and 15N Resonances in Unfolded Apomyoglobin at pH 2.3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 5.8, "salt_mM": null, "temperature_c": 34.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=4695", "evidence_id": "EV-BMRB-4695", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr4695", "doi": "10.13018/BMR4695", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=4695" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Effect of the single mutation His 64->Phe on the stability and folding of apomyoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.1, "salt_mM": null, "temperature_c": 49.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=5158", "evidence_id": "EV-BMRB-5158", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr5158", "doi": "10.13018/BMR5158", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=5158" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Conformational and Dynamic Characterization of the Molten Globule state of an Apomyoglobin Mutant with an altered Folding Pathway" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.0, "salt_mM": null, "temperature_c": 34.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=823", "evidence_id": "EV-BMRB-823", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr823", "doi": "10.13018/BMR823", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=823" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Assignment of heme and distal amino acid resonances in the 1H-NMR spectra of the carbon monoxide and oxygen complexes of sperm whale myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=824", "evidence_id": "EV-BMRB-824", "mappings": [], "molecule_id": "P02185", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr824", "doi": "10.13018/BMR824", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=824" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Assignment of heme and distal amino acid resonances in the 1H-NMR spectra of the carbon monoxide and oxygen complexes of sperm whale myoglobin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_silico", "ions": [], "ligands": [], "notes": "Computed prediction; no experimental conditions.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "AlphaFold Monomer v2.0 pipeline, residues 1-154", "labels": [] }, "data_format": "mmCIF, PAE JSON", "data_level": "processed", "data_link": "https://alphafold.ebi.ac.uk/entry/P02185", "evidence_id": "EV-AFDB-AF-P02185-F1", "mappings": [], "molecule_id": "P02185", "observable": { "type": "plddt", "uncertainty": null, "unit": "pLDDT", "value": 97.5 }, "provenance": { "deposit_id": "AF-P02185-F1", "doi": null, "licence": "CC BY 4.0", "retrieved": "2026-10-19", "source": "AlphaFold DB", "url": "https://alphafold.ebi.ac.uk/entry/P02185" }, "reader": null, "source_kind": "computed", "technique": "af_prediction", "title": "AlphaFold DB prediction AF-P02185-F1" } ], "models": [ { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-1A6N-1" ], "file": "models/P02185/Mb-deoxy.cif", "format": "mmCIF", "model_id": "Mb-deoxy-cif", "molecule_id": "P02185", "provenance": { "deposit_id": "1A6N", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/1A6N.cif" }, "state_id": "Mb-deoxy" }, { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-1A6N-1" ], "file": "models/P02185/Mb-deoxy.pdb", "format": "PDB", "model_id": "Mb-deoxy-pdb", "molecule_id": "P02185", "provenance": { "deposit_id": "1A6N", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/1A6N.pdb" }, "state_id": "Mb-deoxy" }, { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-1A6M-1" ], "file": "models/P02185/Mb-oxy.cif", "format": "mmCIF", "model_id": "Mb-oxy-cif", "molecule_id": "P02185", "provenance": { "deposit_id": "1A6M", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/1A6M.cif" }, "state_id": "Mb-oxy" }, { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-1A6M-1" ], "file": "models/P02185/Mb-oxy.pdb", "format": "PDB", "model_id": "Mb-oxy-pdb", "molecule_id": "P02185", "provenance": { "deposit_id": "1A6M", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/1A6M.pdb" }, "state_id": "Mb-oxy" }, { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-1A6G-1" ], "file": "models/P02185/Mb-CO.cif", "format": "mmCIF", "model_id": "Mb-CO-cif", "molecule_id": "P02185", "provenance": { "deposit_id": "1A6G", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/1A6G.cif" }, "state_id": "Mb-CO" }, { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-1A6G-1" ], "file": "models/P02185/Mb-CO.pdb", "format": "PDB", "model_id": "Mb-CO-pdb", "molecule_id": "P02185", "provenance": { "deposit_id": "1A6G", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/1A6G.pdb" }, "state_id": "Mb-CO" }, { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-1A6K-1" ], "file": "models/P02185/Mb-aquomet.cif", "format": "mmCIF", "model_id": "Mb-aquomet-cif", "molecule_id": "P02185", "provenance": { "deposit_id": "1A6K", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/1A6K.cif" }, "state_id": "Mb-aquomet" }, { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-1A6K-1" ], "file": "models/P02185/Mb-aquomet.pdb", "format": "PDB", "model_id": "Mb-aquomet-pdb", "molecule_id": "P02185", "provenance": { "deposit_id": "1A6K", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/1A6K.pdb" }, "state_id": "Mb-aquomet" } ], "molecule": { "components": [], "domains": [ { "end": 148, "name": "Globin", "start": 2 } ], "gene": "MB", "identifiers": { "genbank": null, "isoform": null, "nakb": null, "pdb": [], "rfam": null, "rnacentral": null, "uniprot": "P02185" }, "ligands": [ "O2", "heme b", "nitrite" ], "modifications": [ { "kind": "ptm", "name": "Phosphoserine", "position": 4, "source": "UniProtKB" }, { "kind": "ptm", "name": "Phosphothreonine", "position": 68, "source": "UniProtKB" } ], "molecule_id": "P02185", "molecule_type": "protein", "name": "Myoglobin", "organism": { "name": "Physeter macrocephalus", "taxon_id": 9755 }, "provenance": { "deposit_id": "P02185", "doi": null, "licence": "CC BY 4.0 (UniProt)", "retrieved": "2026-10-19", "source": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02185/entry" }, "sequence": "MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG", "sequence_length": 154 }, "molecule_id": "P02185", "states": [ { "assumptions": [], "basis": "observed", "description": "Ferrous heme with no distal ligand, as in 1A6N (1.15 Å).", "family_label": null, "molecule_id": "P02185", "name": "deoxy (ferrous, unliganded)", "parent_state": null, "population": null, "provenance": { "deposit_id": null, "doi": null, "licence": "Project licence (pending decision)", "retrieved": "2026-10-19", "source": "Conformome curation (P02185.yaml)", "url": "https://github.com/matth55/conformome/blob/HEAD/curation/P02185.yaml" }, "representative_model": "Mb-deoxy-cif", "secondary_structure": null, "state_id": "Mb-deoxy", "status": "draft" }, { "assumptions": [], "basis": "observed", "description": "O2 bound to the ferrous heme, as in 1A6M (1.0 Å).", "family_label": null, "molecule_id": "P02185", "name": "oxy (O2-bound)", "parent_state": null, "population": null, "provenance": { "deposit_id": null, "doi": null, "licence": "Project licence (pending decision)", "retrieved": "2026-10-19", "source": "Conformome curation (P02185.yaml)", "url": "https://github.com/matth55/conformome/blob/HEAD/curation/P02185.yaml" }, "representative_model": "Mb-oxy-cif", "secondary_structure": null, "state_id": "Mb-oxy", "status": "draft" }, { "assumptions": [], "basis": "observed", "description": "CO bound to the ferrous heme, as in 1A6G (1.15 Å).", "family_label": null, "molecule_id": "P02185", "name": "carbonmonoxy (CO-bound)", "parent_state": null, "population": null, "provenance": { "deposit_id": null, "doi": null, "licence": "Project licence (pending decision)", "retrieved": "2026-10-19", "source": "Conformome curation (P02185.yaml)", "url": "https://github.com/matth55/conformome/blob/HEAD/curation/P02185.yaml" }, "representative_model": "Mb-CO-cif", "secondary_structure": null, "state_id": "Mb-CO", "status": "draft" }, { "assumptions": [], "basis": "observed", "description": "Ferric heme with a water ligand, as in 1A6K (1.1 Å).", "family_label": null, "molecule_id": "P02185", "name": "aquomet (ferric, water-bound)", "parent_state": null, "population": null, "provenance": { "deposit_id": null, "doi": null, "licence": "Project licence (pending decision)", "retrieved": "2026-10-19", "source": "Conformome curation (P02185.yaml)", "url": "https://github.com/matth55/conformome/blob/HEAD/curation/P02185.yaml" }, "representative_model": "Mb-aquomet-cif", "secondary_structure": null, "state_id": "Mb-aquomet", "status": "draft" } ], "transitions": [] }