{ "conflicts": [], "coverage": { "cells": { "Ras-GDP": { "af_prediction": 0, "md": 0, "neutron": 0, "nmr_dynamics": 0, "nmr_shifts": 0, "nmr_structure": 4, "xray": 42 }, "Ras-GTP": { "af_prediction": 0, "md": 0, "neutron": 1, "nmr_dynamics": 0, "nmr_shifts": 0, "nmr_structure": 3, "xray": 204 } }, "data_levels": { "Ras-GDP": { "nmr_structure": "processed", "xray": "processed" }, "Ras-GTP": { "neutron": "processed", "nmr_structure": "processed", "xray": "processed" } }, "single_method_states": [], "states": [ "Ras-GDP", "Ras-GTP" ], "techniques": [ "xray", "neutron", "nmr_structure", "nmr_dynamics", "nmr_shifts", "af_prediction", "md" ], "unmapped_evidence": 41 }, "curation": { "as_of": "2026-10-19", "curator": "draft (unreviewed)", "file": "P01112.yaml", "status": "draft" }, "evidence": [ { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/10DC", "evidence_id": "EV-PDB-10DC-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.08 }, "provenance": { "deposit_id": "10DC", "doi": "10.1016/j.jbc.2026.111260", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/10DC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras GTPase R68A bound to GppNHp" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GCP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "H-RAS P21 PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/121P", "evidence_id": "EV-PDB-121P-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.54 }, "provenance": { "deposit_id": "121P", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/121P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUKTUR UND GUANOSINTRIPHOSPHAT-HYDROLYSEMECHANISMUS DES C-TERMINAL VERKUERZTEN MENSCHLICHEN KREBSPROTEINS P21-H-RAS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "H-RAS (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1BKD", "evidence_id": "EV-PDB-1BKD-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "1BKD", "doi": "10.1038/28548", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1BKD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "COMPLEX OF HUMAN H-RAS WITH HUMAN SOS-1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "C-H-RAS P21 PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CRP", "evidence_id": "EV-PDB-1CRP-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "1CRP", "doi": "10.1021/bi00178a008", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CRP" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "THE SOLUTION STRUCTURE AND DYNAMICS OF RAS P21. GDP DETERMINED BY HETERONUCLEAR THREE AND FOUR DIMENSIONAL NMR SPECTROSCOPY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "C-H-RAS P21 PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CRQ", "evidence_id": "EV-PDB-1CRQ-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "1CRQ", "doi": "10.1021/bi00178a008", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CRQ" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "THE SOLUTION STRUCTURE AND DYNAMICS OF RAS P21. GDP DETERMINED BY HETERONUCLEAR THREE AND FOUR DIMENSIONAL NMR SPECTROSCOPY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "C-H-RAS P21 PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CRR", "evidence_id": "EV-PDB-1CRR-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "1CRR", "doi": "10.1021/bi00178a008", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CRR" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "THE SOLUTION STRUCTURE AND DYNAMICS OF RAS P21. GDP DETERMINED BY HETERONUCLEAR THREE AND FOUR DIMENSIONAL NMR SPECTROSCOPY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "PROTEIN (TRANSFORMING PROTEIN P21/H-RAS-1) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CTQ", "evidence_id": "EV-PDB-1CTQ-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.26 }, "provenance": { "deposit_id": "1CTQ", "doi": "10.1016/S0969-2126(00)80021-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CTQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURE OF P21RAS IN COMPLEX WITH GPPNHP AT 100 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CAG", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "C-H-RAS P21 PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1GNQ", "evidence_id": "EV-PDB-1GNQ-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "1GNQ", "doi": "10.1006/jmbi.1995.0541", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1GNQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-RAY CRYSTAL STRUCTURE ANALYSIS OF THE CATALYTIC DOMAIN OF THE ONCOGENE PRODUCT P21H-RAS COMPLEXED WITH CAGED GTP AND MANT DGPPNHP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CAG", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "C-H-RAS P21 PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1GNR", "evidence_id": "EV-PDB-1GNR-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1GNR", "doi": "10.1006/jmbi.1995.0541", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1GNR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-RAY CRYSTAL STRUCTURE ANALYSIS OF THE CATALYTIC DOMAIN OF THE ONCOGENE PRODUCT P21H-RAS COMPLEXED WITH CAGED GTP AND MANT DGPPNHP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.3, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "TRANSFORMING PROTEIN P21/H-RAS-1 (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1HE8", "evidence_id": "EV-PDB-1HE8-2", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "1HE8", "doi": "10.1016/S0092-8674(00)00196-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1HE8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras G12V - PI 3-kinase gamma complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "TRANSFORMING PROTEIN P21/H-RAS-1 (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1IAQ", "evidence_id": "EV-PDB-1IAQ-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.9 }, "provenance": { "deposit_id": "1IAQ", "doi": "10.1073/pnas.081441398", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1IAQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "C-H-RAS P21 PROTEIN MUTANT WITH THR 35 REPLACED BY SER (T35S) COMPLEXED WITH GUANOSINE-5'-[B,G-IMIDO] TRIPHOSPHATE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": null }, "construct": { "description": "TRANSFORMING PROTEIN P21/H-RAS-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1IOZ", "evidence_id": "EV-PDB-1IOZ-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1IOZ", "doi": "10.1023/A:1013203532303", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1IOZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of the C-HA-RAS Protein Prepared by the Cell-Free Synthesis" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GCP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "C-HA-RAS (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JAH", "evidence_id": "EV-PDB-1JAH-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1JAH", "doi": "10.1006/jmbi.1996.0814", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JAH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-RAS P21 PROTEIN MUTANT G12P, COMPLEXED WITH GUANOSINE-5'-[BETA,GAMMA-METHYLENE] TRIPHOSPHATE AND MAGNESIUM" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GCP", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "C-HA-RAS (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JAI", "evidence_id": "EV-PDB-1JAI-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1JAI", "doi": "10.1006/jmbi.1996.0814", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JAI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-RAS P21 PROTEIN MUTANT G12P, COMPLEXED WITH GUANOSINE-5'-[BETA,GAMMA-METHYLENE] TRIPHOSPHATE AND MANGANESE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": 16.85 }, "construct": { "description": "Transforming protein P21/H-RAS-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1K8R", "evidence_id": "EV-PDB-1K8R-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "1K8R", "doi": "10.1016/S0969-2126(01)00674-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1K8R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Ras-Bry2RBD complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Transforming protein P21/H-RAS-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LF0", "evidence_id": "EV-PDB-1LF0-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1LF0", "doi": "10.1073/pnas.192453199", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LF0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of RasA59G in the GTP-bound form" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Transforming protein P21/H-RAS-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LF5", "evidence_id": "EV-PDB-1LF5-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1LF5", "doi": "10.1073/pnas.192453199", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LF5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of RasA59G in the GDP-bound Form" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -181.15 }, "construct": { "description": "RAS (chains B,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LFD", "evidence_id": "EV-PDB-1LFD-2", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1LFD", "doi": "10.1038/nsb0698-422", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LFD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF THE ACTIVE RAS PROTEIN COMPLEXED WITH THE RAS-INTERACTING DOMAIN OF RALGDS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Transforming protein p21/H-RAS-1 (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1NVV", "evidence_id": "EV-PDB-1NVV-2", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.18 }, "provenance": { "deposit_id": "1NVV", "doi": "10.1016/S0092-8674(03)00149-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1NVV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structural evidence for feedback activation by RasGTP of the Ras-specific nucleotide exchange factor SOS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Transforming protein p21/H-RAS-1 (chains Q)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1NVV", "evidence_id": "EV-PDB-1NVV-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.18 }, "provenance": { "deposit_id": "1NVV", "doi": "10.1016/S0092-8674(03)00149-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1NVV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structural evidence for feedback activation by RasGTP of the Ras-specific nucleotide exchange factor SOS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Transforming protein p21/H-RAS-1 (chains Q,R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1NVW", "evidence_id": "EV-PDB-1NVW-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "1NVW", "doi": "10.1016/S0092-8674(03)00149-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1NVW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structural evidence for feedback activation by RasGTP of the Ras-specific nucleotide exchange factor SOS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GTP", "MG", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Transforming protein p21/H-RAS-1 (chains Q,R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1NVX", "evidence_id": "EV-PDB-1NVX-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "1NVX", "doi": "10.1016/S0092-8674(03)00149-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1NVX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structural evidence for feedback activation by RasGTP of the Ras-specific nucleotide exchange factor SOS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Transforming protein p21/H-RAS-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1P2T", "evidence_id": "EV-PDB-1P2T-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1P2T", "doi": "10.1016/S0969-2126(03)00128-X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1P2T" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras 166 in Aqueous mother liqour, RT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "IPA", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Transforming protein p21/H-RAS-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1P2U", "evidence_id": "EV-PDB-1P2U-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1P2U", "doi": "10.1016/S0969-2126(03)00128-X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1P2U" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras in 50% isopropanol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "C-H-RAS P21 PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1PLL", "evidence_id": "EV-PDB-1PLL-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "1PLL", "doi": "10.1107/S090744499301443X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1PLL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTALLOGRAPHIC STUDIES ON P21H-RAS USING SYNCHROTRON LAUE METHOD: IMPROVEMENT OF CRYSTAL QUALITY AND MONITORING OF THE GTPASE REACTION AT DIFFERENT TIME POINTS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "C-H-RAS P21 PROTEIN CATALYTIC DOMAIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1Q21", "evidence_id": "EV-PDB-1Q21-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "1Q21", "doi": "10.1016/0022-2836(91)90753-S", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1Q21" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURES AT 2.2 ANGSTROMS RESOLUTION OF THE CATALYTIC DOMAINS OF NORMAL RAS PROTEIN AND AN ONCOGENIC MUTANT COMPLEXED WITH GSP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DBG", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "TRANSFORMING PROTEIN P21/H-RAS-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1RVD", "evidence_id": "EV-PDB-1RVD-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1RVD", "doi": "10.1073/pnas.96.12.7065", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1RVD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-RAS COMPLEXED WITH DIAMINOBENZOPHENONE-BETA,GAMMA-IMIDO-GTP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AF3", "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "H-RAS (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1WQ1", "evidence_id": "EV-PDB-1WQ1-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "1WQ1", "doi": "10.1126/science.277.5324.333", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1WQ1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "RAS-RASGAP COMPLEX" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Transforming protein p21/H-Ras-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1XD2", "evidence_id": "EV-PDB-1XD2-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "1XD2", "doi": "10.1016/j.cell.2004.10.005", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1XD2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of a ternary Ras:SOS:Ras*GDP complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Transforming protein p21/H-Ras-1 (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1XD2", "evidence_id": "EV-PDB-1XD2-2", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "1XD2", "doi": "10.1016/j.cell.2004.10.005", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1XD2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of a ternary Ras:SOS:Ras*GDP complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Transforming protein p21/H-Ras-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1XJ0", "evidence_id": "EV-PDB-1XJ0-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1XJ0", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1XJ0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of the GDP-bound form of the RasG60A mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Transforming protein p21/H-Ras-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1ZW6", "evidence_id": "EV-PDB-1ZW6-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "1ZW6", "doi": "10.1016/j.str.2005.12.010", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1ZW6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of the GTP-bound form of RasQ61G" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "H-RAS P21 PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/221P", "evidence_id": "EV-PDB-221P-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "221P", "doi": "10.1016/0092-8674(90)90018-A", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/221P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THREE-DIMENSIONAL STRUCTURES OF H-RAS P21 MUTANTS: MOLECULAR BASIS FOR THEIR INABILITY TO FUNCTION AS SIGNAL SWITCH MOLECULES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "GTP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPASE HRAS (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2C5L", "evidence_id": "EV-PDB-2C5L-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "2C5L", "doi": "10.1016/J.MOLCEL.2006.01.008", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2C5L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of PLC epsilon Ras association domain with hRas" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG", "XY2" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPASE HRAS (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2CE2", "evidence_id": "EV-PDB-2CE2-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.0 }, "provenance": { "deposit_id": "2CE2", "doi": "10.1529/BIOPHYSJ.105.078931", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2CE2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE ANALYSIS OF A FLUORESCENT FORM OF H-RAS P21 IN COMPLEX WITH GDP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG", "TRS", "XY2" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPASE HRAS (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2CL0", "evidence_id": "EV-PDB-2CL0-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2CL0", "doi": "10.1529/BIOPHYSJ.105.078931", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2CL0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE ANALYSIS OF A FLUORESCENT FORM OF H-RAS P21 IN COMPLEX WITH GppNHp" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CAG", "MG", "XY2" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPASE HRAS (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2CL6", "evidence_id": "EV-PDB-2CL6-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.24 }, "provenance": { "deposit_id": "2CL6", "doi": "10.1529/BIOPHYSJ.105.078931", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2CL6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE ANALYSIS OF A FLUORESCENT FORM OF H-RAS P21 IN COMPLEX WITH S-caged GTP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GTP", "MG", "XY2" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPASE HRAS (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2CL7", "evidence_id": "EV-PDB-2CL7-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "2CL7", "doi": "10.1529/BIOPHYSJ.105.078931", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2CL7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE ANALYSIS OF A FLUORESCENT FORM OF H-RAS P21 IN COMPLEX WITH GTP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GTP", "MG", "XY2" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPASE HRAS (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2CLC", "evidence_id": "EV-PDB-2CLC-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "2CLC", "doi": "10.1529/BIOPHYSJ.105.078931", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2CLC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE ANALYSIS OF A FLUORESCENT FORM OF H-RAS P21 IN COMPLEX WITH GTP (2)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas, N-terminally processed (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/24SQ", "evidence_id": "EV-PDB-24SQ-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.08 }, "provenance": { "deposit_id": "24SQ", "doi": "10.1021/jacs.6c14212", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/24SQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Human HRAS WT (GDP-bound) in complex with macrocyclic peptide inhibitor AP6296" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Transforming protein p21/H-Ras-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1ZVQ", "evidence_id": "EV-PDB-1ZVQ-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1ZVQ", "doi": "10.1016/j.str.2005.12.010", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1ZVQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Q61G mutant of Ras in the GDP-bound form" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Transforming protein p21/H-Ras-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1XCM", "evidence_id": "EV-PDB-1XCM-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.84 }, "provenance": { "deposit_id": "1XCM", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1XCM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the GppNHp-bound H-Ras G60A mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GTP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "TRANSFORMING PROTEIN P21/H-RAS-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QRA", "evidence_id": "EV-PDB-1QRA-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "1QRA", "doi": "10.1016/S0969-2126(00)80021-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QRA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURE OF P21RAS IN COMPLEX WITH GTP AT 100 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GTP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "C-H-RAS P21 PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1PLK", "evidence_id": "EV-PDB-1PLK-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "1PLK", "doi": "10.1107/S090744499301443X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1PLK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTALLOGRAPHIC STUDIES ON P21H-RAS USING SYNCHROTRON LAUE METHOD: IMPROVEMENT OF CRYSTAL QUALITY AND MONITORING OF THE GTPASE REACTION AT DIFFERENT TIME POINTS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CAG", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "C-H-RAS P21 PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1PLJ", "evidence_id": "EV-PDB-1PLJ-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "1PLJ", "doi": "10.1107/S090744499301443X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1PLJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTALLOGRAPHIC STUDIES ON P21H-RAS USING SYNCHROTRON LAUE METHOD: IMPROVEMENT OF CRYSTAL QUALITY AND MONITORING OF THE GTPASE REACTION AT DIFFERENT TIME POINTS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "HEZ", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Transforming protein p21/H-RAS-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1P2V", "evidence_id": "EV-PDB-1P2V-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "1P2V", "doi": "10.1016/S0969-2126(03)00128-X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1P2V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-RAS 166 in 60 % 1,6 hexanediol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ETF", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.6, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "Transforming protein p21/H-RAS-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1P2S", "evidence_id": "EV-PDB-1P2S-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.45 }, "provenance": { "deposit_id": "1P2S", "doi": "10.1016/S0969-2126(03)00128-X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1P2S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras 166 in 50% 2,2,2 triflouroethanol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GTP", "MG", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Transforming protein p21/H-RAS-1 (chains Q,R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1NVU", "evidence_id": "EV-PDB-1NVU-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "1NVU", "doi": "10.1016/S0092-8674(03)00149-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1NVU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structural evidence for feedback activation by RasGTP of the Ras-specific nucleotide exchange factor SOS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AGN", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "C-H-RAS P21 PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1GNP", "evidence_id": "EV-PDB-1GNP-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "1GNP", "doi": "10.1006/jmbi.1995.0541", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1GNP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-RAY CRYSTAL STRUCTURE ANALYSIS OF THE CATALYTIC DOMAIN OF THE ONCOGENE PRODUCT P21H-RAS COMPLEXED WITH CAGED GTP AND MANT DGPPNHP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DBG", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "TRANSFORMING PROTEIN P21/H-RAS-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CLU", "evidence_id": "EV-PDB-1CLU-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1CLU", "doi": "10.1073/pnas.96.12.7065", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CLU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-RAS COMPLEXED WITH DIAMINOBENZOPHENONE-BETA,GAMMA-IMIDO-GTP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "C-H-RAS P21 PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1AGP", "evidence_id": "EV-PDB-1AGP-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "1AGP", "doi": "10.1021/bi00084a005", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1AGP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THREE-DIMENSIONAL STRUCTURES AND PROPERTIES OF A TRANSFORMING AND A NONTRANSFORMING GLY-12 MUTANT OF P21-H-RAS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": 29.85 }, "construct": { "description": "C-HA-RAS (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1AA9", "evidence_id": "EV-PDB-1AA9-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "1AA9", "doi": "10.1021/bi970296u", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1AA9" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "HUMAN C-HA-RAS(1-171)(DOT)GDP, NMR, MINIMIZED AVERAGE STRUCTURE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CAG", "MG", "XY2" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2EVW", "evidence_id": "EV-PDB-2EVW-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.05 }, "provenance": { "deposit_id": "2EVW", "doi": "10.1529/biophysj.105.078931", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2EVW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure analysis of a fluorescent form of H-Ras p21 in complex with R-caged GTP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2LCF", "evidence_id": "EV-PDB-2LCF-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2LCF", "doi": "10.1074/jbc.M111.227074", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2LCF" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution structure of GppNHp-bound H-RasT35S mutant protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "KOB", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 4.85 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2LWI", "evidence_id": "EV-PDB-2LWI-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2LWI", "doi": "10.1073/pnas.1217730110", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2LWI" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution structure of H-RasT35S mutant protein in complex with Kobe2601" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2N42", "evidence_id": "EV-PDB-2N42-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2N42", "doi": "10.1038/nmeth.3455", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2N42" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "EC-NMR Structure of Human H-RasT35S mutant protein Determined by Combining Evolutionary Couplings (EC) and Sparse NMR Data" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2N46", "evidence_id": "EV-PDB-2N46-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2N46", "doi": "10.1038/nmeth.3455", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2N46" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "EC-NMR Structure of Human H-RasT35S mutant protein Determined by Combining Evolutionary Couplings (EC) and Sparse NMR Data" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "C-H-RAS P21 PROTEIN CATALYTIC DOMAIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2Q21", "evidence_id": "EV-PDB-2Q21-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "2Q21", "doi": "10.1016/0022-2836(91)90753-S", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2Q21" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURES AT 2.2 ANGSTROMS RESOLUTION OF THE CATALYTIC DOMAINS OF NORMAL RAS PROTEIN AND AN ONCOGENIC MUTANT COMPLEXED WITH GSP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2QUZ", "evidence_id": "EV-PDB-2QUZ-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.49 }, "provenance": { "deposit_id": "2QUZ", "doi": "10.1002/humu.20616", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2QUZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of the activating H-RasK117R mutant in Costello Syndrome, bound to Mg-GDP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2RGA", "evidence_id": "EV-PDB-2RGA-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "2RGA", "doi": "10.1016/j.str.2007.10.011", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2RGA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of H-RasQ61I-GppNHp" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2RGB", "evidence_id": "EV-PDB-2RGB-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "2RGB", "doi": "10.1016/j.str.2007.10.011", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2RGB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of H-RasQ61K-GppNHp" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2RGC", "evidence_id": "EV-PDB-2RGC-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "2RGC", "doi": "10.1016/j.str.2007.10.011", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2RGC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of H-RasQ61V-GppNHp" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2RGD", "evidence_id": "EV-PDB-2RGD-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2RGD", "doi": "10.1016/j.str.2007.10.011", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2RGD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of H-RasQ61L-GppNHp" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2RGE", "evidence_id": "EV-PDB-2RGE-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "2RGE", "doi": "10.1016/j.str.2007.10.011", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2RGE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of H-Ras-GppNHp" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2RGG", "evidence_id": "EV-PDB-2RGG-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "2RGG", "doi": "10.1016/j.str.2007.10.011", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2RGG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of H-RasQ61I-GppNHp, trigonal crystal form" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GTP", "MG", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPASE HRAS (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2UZI", "evidence_id": "EV-PDB-2UZI-3", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2UZI", "doi": "10.1038/SJ.EMBOJ.7601744", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2UZI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of HRAS(G12V) - anti-RAS Fv complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GTP", "MG", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPASE HRAS (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2VH5", "evidence_id": "EV-PDB-2VH5-3", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "2VH5", "doi": "10.1016/J.JMB.2007.11.085", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2VH5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF HRAS(G12V) - ANTI-RAS FV (disulfide free mutant) COMPLEX" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPASE HRAS (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2X1V", "evidence_id": "EV-PDB-2X1V-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "2X1V", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2X1V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of the activating H-Ras I163F mutant in Costello Syndrome, bound to MG-GDP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DDC", "evidence_id": "EV-PDB-3DDC-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "3DDC", "doi": "10.1038/emboj.2008.125", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DDC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of NORE1A in Complex with RAS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3I3S", "evidence_id": "EV-PDB-3I3S-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.36 }, "provenance": { "deposit_id": "3I3S", "doi": "10.1038/ng.497", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3I3S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of H-Ras with Thr50 replaced by Isoleucine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3K8Y", "evidence_id": "EV-PDB-3K8Y-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "3K8Y", "doi": "10.1073/pnas.0912226107", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3K8Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Allosteric modulation of H-Ras GTPase" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3K9L", "evidence_id": "EV-PDB-3K9L-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "3K9L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3K9L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Allosteric modulation of H-Ras GTPase" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3K9N", "evidence_id": "EV-PDB-3K9N-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "3K9N", "doi": "10.1073/pnas.0912226107", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3K9N" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Allosteric modulation of H-Ras GTPase" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3KKN", "evidence_id": "EV-PDB-3KKN-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.09 }, "provenance": { "deposit_id": "3KKN", "doi": "10.1074/jbc.M110.125161", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3KKN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of H-Ras T35S in complex with GppNHp" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3KUD", "evidence_id": "EV-PDB-3KUD-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.15 }, "provenance": { "deposit_id": "3KUD", "doi": "10.1016/j.jmb.2010.03.046", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3KUD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Complex of Ras-GDP with RafRBD(A85K)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG", "YCN", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3L8Y", "evidence_id": "EV-PDB-3L8Y-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.02 }, "provenance": { "deposit_id": "3L8Y", "doi": "10.1002/anie.200907002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3L8Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Complex of Ras with cyclen" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3L8Z", "evidence_id": "EV-PDB-3L8Z-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.44 }, "provenance": { "deposit_id": "3L8Z", "doi": "10.1002/anie.200907002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3L8Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras wildtype new crystal form" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3LBH", "evidence_id": "EV-PDB-3LBH-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "3LBH", "doi": "10.1073/pnas.0912226107", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3LBH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras soaked in Calcium Acetate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3LBI", "evidence_id": "EV-PDB-3LBI-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.087 }, "provenance": { "deposit_id": "3LBI", "doi": "10.1073/pnas.0912226107", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3LBI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras soaked in Magnesium Acetate and back soaked in Calcium Acetate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3LBN", "evidence_id": "EV-PDB-3LBN-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.862 }, "provenance": { "deposit_id": "3LBN", "doi": "10.1073/pnas.0912226107", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3LBN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras soaked in Magnesium Acetate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GDP", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A,C,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3LO5", "evidence_id": "EV-PDB-3LO5-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.568 }, "provenance": { "deposit_id": "3LO5", "doi": "10.1021/bi9020742", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3LO5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of the dominant negative S17N mutant of Ras" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3OIU", "evidence_id": "EV-PDB-3OIU-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.32 }, "provenance": { "deposit_id": "3OIU", "doi": "10.1074/jbc.M110.193854", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3OIU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-RasQ61L with allosteric switch in the \"on\" state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "DTT", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3OIV", "evidence_id": "EV-PDB-3OIV-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.837 }, "provenance": { "deposit_id": "3OIV", "doi": "10.1074/jbc.M110.193854", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3OIV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-RasG12V with allosteric switch in the \"off\" state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3OIW", "evidence_id": "EV-PDB-3OIW-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "3OIW", "doi": "10.1074/jbc.M110.193854", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3OIW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-RasG12V with allosteric switch in the \"on\" state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3RRY", "evidence_id": "EV-PDB-3RRY-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "3RRY", "doi": "10.1016/j.jmb.2011.09.011", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3RRY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras crosslinked control, soaked in aqueous solution: one of 10 in MSCS set" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "GOL", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3RRZ", "evidence_id": "EV-PDB-3RRZ-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "3RRZ", "doi": "10.1016/j.jmb.2011.09.011", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3RRZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras in 70% glycerol: one of 10 in MSCS set" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG", "YEG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3RS0", "evidence_id": "EV-PDB-3RS0-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "3RS0", "doi": "10.1016/j.jmb.2011.09.011", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3RS0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras soaked in neat cyclopentanol: one of 10 in MSCS set" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "ETF", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3RS2", "evidence_id": "EV-PDB-3RS2-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.836 }, "provenance": { "deposit_id": "3RS2", "doi": "10.1016/j.jmb.2011.09.011", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3RS2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras soaked in 50% 2,2,2-trifluoroethanol: one of 10 in MSCS set" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "HEZ", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3RS4", "evidence_id": "EV-PDB-3RS4-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "3RS4", "doi": "10.1016/j.jmb.2011.09.011", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3RS4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras soaked in 60% 1,6-hexanediol: 1 of 10 in MSCS set" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "DMF", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3RS5", "evidence_id": "EV-PDB-3RS5-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.68 }, "provenance": { "deposit_id": "3RS5", "doi": "10.1016/j.jmb.2011.09.011", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3RS5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras soaked in 55% dimethylformamide: 1 of 10 in MSCS set" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3RS7", "evidence_id": "EV-PDB-3RS7-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "3RS7", "doi": "10.1016/j.jmb.2011.09.011", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3RS7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras soaked in 50% isopropanol: 1 of 10 in MSCS set" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG", "RSF" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3RSL", "evidence_id": "EV-PDB-3RSL-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "3RSL", "doi": "10.1016/j.jmb.2011.09.011", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3RSL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras soaked in 90% R,S,R-bisfuranol: one of 10 in MSCS set" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG", "RSG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3RSO", "evidence_id": "EV-PDB-3RSO-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "3RSO", "doi": "10.1016/j.jmb.2011.09.011", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3RSO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras soaked in 20% S,R,S-bisfuranol: 1 of 10 in MSCS set" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.6, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3TGP", "evidence_id": "EV-PDB-3TGP-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3075 }, "provenance": { "deposit_id": "3TGP", "doi": "10.1073/pnas.1111325108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3TGP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature H-ras" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "H-RAS P21 PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/421P", "evidence_id": "EV-PDB-421P-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "421P", "doi": "10.1016/0092-8674(90)90018-A", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/421P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THREE-DIMENSIONAL STRUCTURES OF H-RAS P21 MUTANTS: MOLECULAR BASIS FOR THEIR INABILITY TO FUNCTION AS SIGNAL SWITCH MOLECULES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "DTU", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4DLR", "evidence_id": "EV-PDB-4DLR-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.319 }, "provenance": { "deposit_id": "4DLR", "doi": "10.1021/bi300509j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4DLR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras PEG 400/Ca(OAc)2, ordered off" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4DLS", "evidence_id": "EV-PDB-4DLS-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.819 }, "provenance": { "deposit_id": "4DLS", "doi": "10.1021/bi300509j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4DLS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras Set 1 CaCl2 'Mixed'" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4DLT", "evidence_id": "EV-PDB-4DLT-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.699 }, "provenance": { "deposit_id": "4DLT", "doi": "10.1021/bi300509j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4DLT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras Set 2 Ca(OAc)2, on" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4DLU", "evidence_id": "EV-PDB-4DLU-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "4DLU", "doi": "10.1021/bi300509j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4DLU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras Set 1 Ca(OAc)2, on" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "HEX", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3RS3", "evidence_id": "EV-PDB-3RS3-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.52 }, "provenance": { "deposit_id": "3RS3", "doi": "10.1016/j.jmb.2011.09.011", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3RS3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras soaked in neat hexane: 1 of 10 in MSCS set" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3KKM", "evidence_id": "EV-PDB-3KKM-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "3KKM", "doi": "10.1074/jbc.M110.125161", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3KKM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of H-Ras T35S in complex with GppNHp" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPASE HRAS (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2CLD", "evidence_id": "EV-PDB-2CLD-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.22 }, "provenance": { "deposit_id": "2CLD", "doi": "10.1529/BIOPHYSJ.105.078931", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2CLD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE ANALYSIS OF A FLUORESCENT FORM OF H-RAS P21 IN COMPLEX WITH GDP (2)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CA", "DTU", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4G0N", "evidence_id": "EV-PDB-4G0N-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.45 }, "provenance": { "deposit_id": "4G0N", "doi": "10.1016/j.str.2014.12.017", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4G0N" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of wt H-Ras-GppNHp bound to the RBD of Raf Kinase" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4G3X", "evidence_id": "EV-PDB-4G3X-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.25 }, "provenance": { "deposit_id": "4G3X", "doi": "10.1016/j.str.2014.12.017", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4G3X" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Q61L H-Ras-GppNHp bound to the RBD of Raf Kinase" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GDP", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4L9S", "evidence_id": "EV-PDB-4L9S-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.606 }, "provenance": { "deposit_id": "4L9S", "doi": "10.1038/nature12796", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4L9S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of H-Ras G12C, GDP-bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "2PZ", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NYJ", "evidence_id": "EV-PDB-4NYJ-2", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8522 }, "provenance": { "deposit_id": "4NYJ", "doi": "10.1073/pnas.1315798111", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NYJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Approach for Targeting Ras with Small Molecules that Activate SOS-Mediated Nucleotide Exchange" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "2PZ", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains Q)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NYJ", "evidence_id": "EV-PDB-4NYJ-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8522 }, "provenance": { "deposit_id": "4NYJ", "doi": "10.1073/pnas.1315798111", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NYJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Approach for Targeting Ras with Small Molecules that Activate SOS-Mediated Nucleotide Exchange" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "RV1" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPASE HRAS (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4URY", "evidence_id": "EV-PDB-4URY-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.47 }, "provenance": { "deposit_id": "4URY", "doi": "10.1021/JM501660T", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4URY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The crystal structure of H-Ras and SOS in complex with ligands" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "C-H-RAS P21 PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5P21", "evidence_id": "EV-PDB-5P21-1", "mappings": [ { "confidence": "high", "justification": "GppNHp (GNP) bound, triphosphate conformation.", "rule": "curator_assignment", "state_id": "Ras-GTP", "who": "curator:draft (unreviewed)" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "5P21", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5P21" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "REFINED CRYSTAL STRUCTURE OF THE TRIPHOSPHATE CONFORMATION OF H-RAS P21 AT 1.35 ANGSTROMS RESOLUTION: IMPLICATIONS FOR THE MECHANISM OF GTP HYDROLYSIS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "92V", "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5VBE", "evidence_id": "EV-PDB-5VBE-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.57 }, "provenance": { "deposit_id": "5VBE", "doi": "10.1016/j.chembiol.2017.08.025", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5VBE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Small Molecule Disulfide 2C07 Bound to H-Ras M72C GDP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A,D,G,J)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5WPL", "evidence_id": "EV-PDB-5WPL-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.15 }, "provenance": { "deposit_id": "5WPL", "doi": "10.1074/jbc.M117.816348", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5WPL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "KRas G12V, bound to GppNHp and miniprotein 225-11" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EC4", "FMT", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6BVI", "evidence_id": "EV-PDB-6BVI-3", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.746 }, "provenance": { "deposit_id": "6BVI", "doi": "10.1021/acs.jmedchem.8b00360", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6BVI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EC4", "FMT", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6BVI", "evidence_id": "EV-PDB-6BVI-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.746 }, "provenance": { "deposit_id": "6BVI", "doi": "10.1021/acs.jmedchem.8b00360", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6BVI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains B,D,F,H,J,L)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6AXG", "evidence_id": "EV-PDB-6AXG-2", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.302 }, "provenance": { "deposit_id": "6AXG", "doi": "10.7554/eLife.29002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6AXG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of RasGRP4 in complex with HRas" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6AMB", "evidence_id": "EV-PDB-6AMB-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "6AMB", "doi": "10.1038/s41467-017-01326-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6AMB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of the Afadin RA1 domain in complex with HRAS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "H-RAS P21 PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/621P", "evidence_id": "EV-PDB-621P-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "621P", "doi": "10.1016/0092-8674(90)90018-A", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/621P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THREE-DIMENSIONAL STRUCTURES OF H-RAS P21 MUTANTS: MOLECULAR BASIS FOR THEIR INABILITY TO FUNCTION AS SIGNAL SWITCH MOLECULES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "KBF", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 4.85 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5ZC6", "evidence_id": "EV-PDB-5ZC6-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "5ZC6", "doi": "10.1021/acs.biochem.8b00680", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5ZC6" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution structure of H-RasT35S mutant protein in complex with KBFM123" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5X9S", "evidence_id": "EV-PDB-5X9S-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "5X9S", "doi": "10.1002/1873-3468.12759", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5X9S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of fully modified H-Ras-GppNHp" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "5UW", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains Q,R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5WFR", "evidence_id": "EV-PDB-5WFR-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.46 }, "provenance": { "deposit_id": "5WFR", "doi": "10.1016/j.ab.2018.01.025", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5WFR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ligand-bound Ras:SOS:Ras complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "5UV", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains Q,R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5WFQ", "evidence_id": "EV-PDB-5WFQ-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.26 }, "provenance": { "deposit_id": "5WFQ", "doi": "10.1016/j.ab.2018.01.025", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5WFQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ligand-bound Ras:SOS:Ras complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "5UX", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains Q,R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5WFP", "evidence_id": "EV-PDB-5WFP-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.08 }, "provenance": { "deposit_id": "5WFP", "doi": "10.1016/j.ab.2018.01.025", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5WFP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ligand-bound Ras:SOS:Ras complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "5UU", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains Q,R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5WFO", "evidence_id": "EV-PDB-5WFO-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.99 }, "provenance": { "deposit_id": "5WFO", "doi": "10.1016/j.ab.2018.01.025", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5WFO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ligand-bound Ras:SOS:Ras complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CA", "GNP", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5WDQ", "evidence_id": "EV-PDB-5WDQ-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "5WDQ", "doi": "10.7554/eLife.27810", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5WDQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras mutant L120A bound to GMP-PNP at 100K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5WDP", "evidence_id": "EV-PDB-5WDP-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "5WDP", "doi": "10.7554/eLife.27810", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5WDP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras mutant L120A bound to GMP-PNP at 277K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5WDO", "evidence_id": "EV-PDB-5WDO-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "5WDO", "doi": "10.7554/eLife.27810", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5WDO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras bound to GMP-PNP at 277K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "92V", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5VBZ", "evidence_id": "EV-PDB-5VBZ-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "5VBZ", "doi": "10.1016/j.chembiol.2017.08.025", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5VBZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Small Molecule Disulfide 2C07 Bound to H-Ras M72C GppNHp" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5E95", "evidence_id": "EV-PDB-5E95-2", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.402 }, "provenance": { "deposit_id": "5E95", "doi": "10.1038/nchembio.2231", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5E95" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Mb(NS1)/H-Ras Complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5B30", "evidence_id": "EV-PDB-5B30-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "5B30", "doi": "10.1038/srep25931", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5B30" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras WT in complex with GppNHp (state 1) after structural transition by humidity control" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5B2Z", "evidence_id": "EV-PDB-5B2Z-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.56 }, "provenance": { "deposit_id": "5B2Z", "doi": "10.1038/srep25931", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5B2Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras WT in complex with GppNHp (state 2*) before structural transition by humidity control" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GTP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "H-RAS P21 PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/521P", "evidence_id": "EV-PDB-521P-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "521P", "doi": "10.1016/0092-8674(90)90018-A", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/521P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THREE-DIMENSIONAL STRUCTURES OF H-RAS P21 MUTANTS: MOLECULAR BASIS FOR THEIR INABILITY TO FUNCTION AS SIGNAL SWITCH MOLECULES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4XVR", "evidence_id": "EV-PDB-4XVR-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.031 }, "provenance": { "deposit_id": "4XVR", "doi": "10.1096/fj.15-271510", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4XVR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras Y137F" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "GOL", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4XVQ", "evidence_id": "EV-PDB-4XVQ-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.887 }, "provenance": { "deposit_id": "4XVQ", "doi": "10.1096/fj.15-271510", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4XVQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras Y137E" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "L7S" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPASE HRAS (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4US2", "evidence_id": "EV-PDB-4US2-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.48 }, "provenance": { "deposit_id": "4US2", "doi": "10.1021/JM501660T", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4US2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The crystal structure of H-Ras and SOS in complex with ligands" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "L71" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPASE HRAS (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4US1", "evidence_id": "EV-PDB-4US1-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.65 }, "provenance": { "deposit_id": "4US1", "doi": "10.1021/JM501660T", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4US1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The crystal structure of H-Ras and SOS in complex with ligands" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NEN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4US0", "evidence_id": "EV-PDB-4US0-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.17 }, "provenance": { "deposit_id": "4US0", "doi": "10.1021/JM501660T", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4US0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The crystal structure of H-Ras and SOS in complex with ligands" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "VJP" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPASE HRAS (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4URZ", "evidence_id": "EV-PDB-4URZ-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.24 }, "provenance": { "deposit_id": "4URZ", "doi": "10.1021/JM501660T", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4URZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The crystal structure of H-Ras and SOS in complex with ligands" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FK1", "FMT", "HXY" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPASE HRAS (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4URX", "evidence_id": "EV-PDB-4URX-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.49 }, "provenance": { "deposit_id": "4URX", "doi": "10.1021/JM501660T", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4URX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The crystal structure of H-Ras and SOS in complex with ligands" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DXO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPASE HRAS (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4URW", "evidence_id": "EV-PDB-4URW-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.76 }, "provenance": { "deposit_id": "4URW", "doi": "10.1021/JM501660T", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4URW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The crystal structure of H-Ras and SOS in complex with ligands" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT", "UMK" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPASE HRAS (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4URV", "evidence_id": "EV-PDB-4URV-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.58 }, "provenance": { "deposit_id": "4URV", "doi": "10.1021/JM501660T", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4URV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The crystal structure of H-Ras and SOS in complex with ligands" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "6W2" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPASE HRAS (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4URU", "evidence_id": "EV-PDB-4URU-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.83 }, "provenance": { "deposit_id": "4URU", "doi": "10.1021/JM501660T", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4URU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The crystal structure of H-Ras and SOS in complex with ligands" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4RSG", "evidence_id": "EV-PDB-4RSG-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.907 }, "provenance": { "deposit_id": "4RSG", "doi": "10.1074/jbc.M115.679860", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4RSG" }, "reader": null, "source_kind": "deposit", "technique": "neutron", "title": "Neutron crystal structure of Ras bound to the GTP analogue GppNHp" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "C-H-RAS P21 PROTEIN CATALYTIC DOMAIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4Q21", "evidence_id": "EV-PDB-4Q21-1", "mappings": [ { "confidence": "high", "justification": "GDP and Mg2+ bound.", "rule": "curator_assignment", "state_id": "Ras-GDP", "who": "curator:draft (unreviewed)" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "4Q21", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4Q21" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "MOLECULAR SWITCH FOR SIGNAL TRANSDUCTION: STRUCTURAL DIFFERENCES BETWEEN ACTIVE AND INACTIVE FORMS OF PROTOONCOGENIC RAS PROTEINS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG", "RND" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NYM", "evidence_id": "EV-PDB-4NYM-2", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.5529 }, "provenance": { "deposit_id": "4NYM", "doi": "10.1073/pnas.1315798111", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NYM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Approach for Targeting Ras with Small Molecules that Activate SOS-Mediated Nucleotide Exchange" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG", "RND" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains Q)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NYM", "evidence_id": "EV-PDB-4NYM-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.5529 }, "provenance": { "deposit_id": "4NYM", "doi": "10.1073/pnas.1315798111", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NYM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Approach for Targeting Ras with Small Molecules that Activate SOS-Mediated Nucleotide Exchange" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "2PX", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NYI", "evidence_id": "EV-PDB-4NYI-2", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.9612 }, "provenance": { "deposit_id": "4NYI", "doi": "10.1073/pnas.1315798111", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NYI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Approach for Targeting Ras with Small Molecules that Activate SOS-Mediated Nucleotide Exchange" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "2PX", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains Q)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NYI", "evidence_id": "EV-PDB-4NYI-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.9612 }, "provenance": { "deposit_id": "4NYI", "doi": "10.1073/pnas.1315798111", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NYI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Approach for Targeting Ras with Small Molecules that Activate SOS-Mediated Nucleotide Exchange" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4L9W", "evidence_id": "EV-PDB-4L9W-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.952 }, "provenance": { "deposit_id": "4L9W", "doi": "10.1038/nature12796", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4L9W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of H-Ras G12C, GMPPNP-bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "GTP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains B,D,F,H)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4K81", "evidence_id": "EV-PDB-4K81-2", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "4K81", "doi": "10.1371/journal.pone.0072473", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4K81" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the Grb14 RA and PH domains in complex with GTP-loaded H-Ras" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4EFN", "evidence_id": "EV-PDB-4EFN-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "4EFN", "doi": "10.1016/j.febslet.2012.04.058", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4EFN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of H-Ras Q61L in complex with GppNHp (state 1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4EFM", "evidence_id": "EV-PDB-4EFM-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "4EFM", "doi": "10.1016/j.febslet.2012.04.058", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4EFM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of H-Ras G12V in complex with GppNHp (state 1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4EFL", "evidence_id": "EV-PDB-4EFL-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "4EFL", "doi": "10.1016/j.febslet.2012.04.058", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4EFL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of H-Ras WT in complex with GppNHp (state 1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "DTU", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4DLZ", "evidence_id": "EV-PDB-4DLZ-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.662 }, "provenance": { "deposit_id": "4DLZ", "doi": "10.1021/bi300509j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4DLZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras Set 2 Ca(OAc)2/DTE, ordered off" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "DTT", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4DLY", "evidence_id": "EV-PDB-4DLY-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.57 }, "provenance": { "deposit_id": "4DLY", "doi": "10.1021/bi300509j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4DLY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Set 1 CaCl2/DTT, ordered off" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "DTU", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4DLX", "evidence_id": "EV-PDB-4DLX-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.731 }, "provenance": { "deposit_id": "4DLX", "doi": "10.1021/bi300509j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4DLX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras Set 1 CaCl2/DTE, ordered off" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4DLW", "evidence_id": "EV-PDB-4DLW-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.72 }, "provenance": { "deposit_id": "4DLW", "doi": "10.1021/bi300509j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4DLW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras Set 2 Ca(OAc)2/DTT, on" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "DTT", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4DLV", "evidence_id": "EV-PDB-4DLV-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.572 }, "provenance": { "deposit_id": "4DLV", "doi": "10.1021/bi300509j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4DLV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras Set 2 CaCl2/DTT, ordered off" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EAS", "FMT", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6BVJ", "evidence_id": "EV-PDB-6BVJ-3", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.747 }, "provenance": { "deposit_id": "6BVJ", "doi": "10.1021/acs.jmedchem.8b00360", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6BVJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EAS", "FMT", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6BVJ", "evidence_id": "EV-PDB-6BVJ-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.747 }, "provenance": { "deposit_id": "6BVJ", "doi": "10.1021/acs.jmedchem.8b00360", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6BVJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EAV", "FMT", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6BVK", "evidence_id": "EV-PDB-6BVK-3", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.799 }, "provenance": { "deposit_id": "6BVK", "doi": "10.1021/acs.jmedchem.8b00360", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6BVK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EAV", "FMT", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6BVK", "evidence_id": "EV-PDB-6BVK-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.799 }, "provenance": { "deposit_id": "6BVK", "doi": "10.1021/acs.jmedchem.8b00360", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6BVK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EBY", "FMT", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6BVL", "evidence_id": "EV-PDB-6BVL-3", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.748 }, "provenance": { "deposit_id": "6BVL", "doi": "10.1021/acs.jmedchem.8b00360", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6BVL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EBY", "FMT", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRAS (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6BVL", "evidence_id": "EV-PDB-6BVL-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.748 }, "provenance": { "deposit_id": "6BVL", "doi": "10.1021/acs.jmedchem.8b00360", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6BVL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EBV", "FMT", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6BVM", "evidence_id": "EV-PDB-6BVM-3", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.796 }, "provenance": { "deposit_id": "6BVM", "doi": "10.1021/acs.jmedchem.8b00360", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6BVM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EBV", "FMT", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6BVM", "evidence_id": "EV-PDB-6BVM-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.796 }, "provenance": { "deposit_id": "6BVM", "doi": "10.1021/acs.jmedchem.8b00360", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6BVM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FFS", "FMT", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6CUO", "evidence_id": "EV-PDB-6CUO-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.73 }, "provenance": { "deposit_id": "6CUO", "doi": "10.1021/acsmedchemlett.8b00296", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6CUO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FFS", "FMT", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6CUO", "evidence_id": "EV-PDB-6CUO-3", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.73 }, "provenance": { "deposit_id": "6CUO", "doi": "10.1021/acsmedchemlett.8b00296", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6CUO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FFV", "FMT", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6CUP", "evidence_id": "EV-PDB-6CUP-3", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.833 }, "provenance": { "deposit_id": "6CUP", "doi": "10.1021/acsmedchemlett.8b00296", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6CUP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FFV", "FMT", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6CUP", "evidence_id": "EV-PDB-6CUP-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.833 }, "provenance": { "deposit_id": "6CUP", "doi": "10.1021/acsmedchemlett.8b00296", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6CUP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FFY", "FMT", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6CUR", "evidence_id": "EV-PDB-6CUR-3", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.73 }, "provenance": { "deposit_id": "6CUR", "doi": "10.1021/acsmedchemlett.8b00296", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6CUR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FFY", "FMT", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6CUR", "evidence_id": "EV-PDB-6CUR-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.73 }, "provenance": { "deposit_id": "6CUR", "doi": "10.1021/acsmedchemlett.8b00296", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6CUR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT", "FWA", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D55", "evidence_id": "EV-PDB-6D55-3", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.68 }, "provenance": { "deposit_id": "6D55", "doi": "10.1021/acs.jmedchem.8b01108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D55" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT", "FWA", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D55", "evidence_id": "EV-PDB-6D55-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.68 }, "provenance": { "deposit_id": "6D55", "doi": "10.1021/acs.jmedchem.8b01108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D55" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT", "FVM", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D56", "evidence_id": "EV-PDB-6D56-3", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.68 }, "provenance": { "deposit_id": "6D56", "doi": "10.1021/acs.jmedchem.8b01108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D56" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT", "FVM", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D56", "evidence_id": "EV-PDB-6D56-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.68 }, "provenance": { "deposit_id": "6D56", "doi": "10.1021/acs.jmedchem.8b01108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D56" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT", "FVJ", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 1.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D59", "evidence_id": "EV-PDB-6D59-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "6D59", "doi": "10.1021/acs.jmedchem.8b01108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D59" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT", "FVJ", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 1.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D59", "evidence_id": "EV-PDB-6D59-3", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "6D59", "doi": "10.1021/acs.jmedchem.8b01108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D59" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "FMT", "FVG", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D5E", "evidence_id": "EV-PDB-6D5E-3", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "6D5E", "doi": "10.1021/acs.jmedchem.8b01108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D5E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "FMT", "FVG", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D5E", "evidence_id": "EV-PDB-6D5E-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "6D5E", "doi": "10.1021/acs.jmedchem.8b01108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D5E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "FMT", "FVD", "GNP", "GOL", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D5G", "evidence_id": "EV-PDB-6D5G-3", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.92 }, "provenance": { "deposit_id": "6D5G", "doi": "10.1021/acs.jmedchem.8b01108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D5G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "FMT", "FVD", "GNP", "GOL", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D5G", "evidence_id": "EV-PDB-6D5G-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.92 }, "provenance": { "deposit_id": "6D5G", "doi": "10.1021/acs.jmedchem.8b01108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D5G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "FMT", "FV7", "GNP", "GOL", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D5H", "evidence_id": "EV-PDB-6D5H-3", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "6D5H", "doi": "10.1021/acs.jmedchem.8b01108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D5H" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "FMT", "FV7", "GNP", "GOL", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D5H", "evidence_id": "EV-PDB-6D5H-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "6D5H", "doi": "10.1021/acs.jmedchem.8b01108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D5H" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT", "FV4", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D5J", "evidence_id": "EV-PDB-6D5J-3", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.751 }, "provenance": { "deposit_id": "6D5J", "doi": "10.1021/acs.jmedchem.8b01108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D5J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT", "FV4", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D5J", "evidence_id": "EV-PDB-6D5J-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.751 }, "provenance": { "deposit_id": "6D5J", "doi": "10.1021/acs.jmedchem.8b01108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D5J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT", "FW7", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D5L", "evidence_id": "EV-PDB-6D5L-3", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "6D5L", "doi": "10.1021/acs.jmedchem.8b01108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D5L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT", "FW7", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D5L", "evidence_id": "EV-PDB-6D5L-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "6D5L", "doi": "10.1021/acs.jmedchem.8b01108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D5L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FW4", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D5M", "evidence_id": "EV-PDB-6D5M-2", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.081 }, "provenance": { "deposit_id": "6D5M", "doi": "10.1021/acs.jmedchem.8b01108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D5M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FW4", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains Q)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D5M", "evidence_id": "EV-PDB-6D5M-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.081 }, "provenance": { "deposit_id": "6D5M", "doi": "10.1021/acs.jmedchem.8b01108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D5M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FVY", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D5V", "evidence_id": "EV-PDB-6D5V-2", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.04 }, "provenance": { "deposit_id": "6D5V", "doi": "10.1021/acs.jmedchem.8b01108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D5V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FVY", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains Q)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D5V", "evidence_id": "EV-PDB-6D5V-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.04 }, "provenance": { "deposit_id": "6D5V", "doi": "10.1021/acs.jmedchem.8b01108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D5V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FVV", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D5W", "evidence_id": "EV-PDB-6D5W-2", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.478 }, "provenance": { "deposit_id": "6D5W", "doi": "10.1021/acs.jmedchem.8b01108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D5W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FVV", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains Q)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D5W", "evidence_id": "EV-PDB-6D5W-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.478 }, "provenance": { "deposit_id": "6D5W", "doi": "10.1021/acs.jmedchem.8b01108", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D5W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ras:SOS:Ras in complex with a small molecule activator" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "DTT", "GDP", "GOL", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6DZH", "evidence_id": "EV-PDB-6DZH-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "6DZH", "doi": "10.1016/j.celrep.2019.07.026", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6DZH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS G13D bound to GDP (H13GDP)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -100.0 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6E6C", "evidence_id": "EV-PDB-6E6C-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "6E6C", "doi": "10.1016/j.celrep.2019.07.026", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6E6C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS G13D bound to GppNHp (H13GNP)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A,B,C,D,E,F,G,H)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6MQT", "evidence_id": "EV-PDB-6MQT-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.498 }, "provenance": { "deposit_id": "6MQT", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6MQT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS G12S in complex with GDP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "GOL", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6NTC", "evidence_id": "EV-PDB-6NTC-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.9 }, "provenance": { "deposit_id": "6NTC", "doi": "10.1074/jbc.RA119.011025", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6NTC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of G12V HRas-GppNHp bound in complex with the engineered RBD variant 1 of CRAF Kinase protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6NTD", "evidence_id": "EV-PDB-6NTD-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.15 }, "provenance": { "deposit_id": "6NTD", "doi": "10.1074/jbc.RA119.011025", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6NTD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of G12V HRas-GppNHp bound in complex with the engineered RBD variant 12 of CRAF Kinase protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GCP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "C-H-RAS P21 PROTEIN CATALYTIC DOMAIN (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6Q21", "evidence_id": "EV-PDB-6Q21-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "6Q21", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6Q21" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "MOLECULAR SWITCH FOR SIGNAL TRANSDUCTION: STRUCTURAL DIFFERENCES BETWEEN ACTIVE AND INACTIVE FORMS OF PROTOONCOGENIC RAS PROTEINS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT", "GNP", "GOL", "MG", "NA", "QTV" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6V94", "evidence_id": "EV-PDB-6V94-3", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "6V94", "doi": "10.1021/acs.jmedchem.0c00511", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6V94" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Expanding the Chemical Landscape of SOS1 Activators Using Fragment Based Methods" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT", "GNP", "GOL", "MG", "NA", "QTV" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6V94", "evidence_id": "EV-PDB-6V94-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "6V94", "doi": "10.1021/acs.jmedchem.0c00511", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6V94" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Expanding the Chemical Landscape of SOS1 Activators Using Fragment Based Methods" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT", "GNP", "GOL", "MG", "NA", "QTS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6V9F", "evidence_id": "EV-PDB-6V9F-3", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.849 }, "provenance": { "deposit_id": "6V9F", "doi": "10.1021/acs.jmedchem.0c00511", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6V9F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Expanding the Chemical Landscape of SOS1 Activators Using Fragment Based Methods" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT", "GNP", "GOL", "MG", "NA", "QTS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6V9F", "evidence_id": "EV-PDB-6V9F-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.849 }, "provenance": { "deposit_id": "6V9F", "doi": "10.1021/acs.jmedchem.0c00511", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6V9F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Expanding the Chemical Landscape of SOS1 Activators Using Fragment Based Methods" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT", "GNP", "GOL", "MG", "NA", "QTM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6V9J", "evidence_id": "EV-PDB-6V9J-3", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.76 }, "provenance": { "deposit_id": "6V9J", "doi": "10.1021/acs.jmedchem.0c00511", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6V9J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Expanding the Chemical Landscape of SOS1 Activators Using Fragment Based Methods" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT", "GNP", "GOL", "MG", "NA", "QTM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6V9J", "evidence_id": "EV-PDB-6V9J-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.76 }, "provenance": { "deposit_id": "6V9J", "doi": "10.1021/acs.jmedchem.0c00511", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6V9J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Expanding the Chemical Landscape of SOS1 Activators Using Fragment Based Methods" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "FMT", "GNP", "GOL", "MG", "NA", "QTJ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6V9L", "evidence_id": "EV-PDB-6V9L-3", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.698 }, "provenance": { "deposit_id": "6V9L", "doi": "10.1021/acs.jmedchem.0c00511", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6V9L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Expanding the Chemical Landscape of SOS1 Activators Using Fragment Based Methods" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "FMT", "GNP", "GOL", "MG", "NA", "QTJ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6V9L", "evidence_id": "EV-PDB-6V9L-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.698 }, "provenance": { "deposit_id": "6V9L", "doi": "10.1021/acs.jmedchem.0c00511", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6V9L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Expanding the Chemical Landscape of SOS1 Activators Using Fragment Based Methods" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT", "GNP", "GOL", "MG", "NA", "QTD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6V9N", "evidence_id": "EV-PDB-6V9N-3", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.648 }, "provenance": { "deposit_id": "6V9N", "doi": "10.1021/acs.jmedchem.0c00511", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6V9N" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Expanding the Chemical Landscape of SOS1 Activators Using Fragment Based Methods" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT", "GNP", "GOL", "MG", "NA", "QTD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6V9N", "evidence_id": "EV-PDB-6V9N-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.648 }, "provenance": { "deposit_id": "6V9N", "doi": "10.1021/acs.jmedchem.0c00511", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6V9N" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Expanding the Chemical Landscape of SOS1 Activators Using Fragment Based Methods" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT", "GNP", "GOL", "MG", "NA", "QTA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6V9O", "evidence_id": "EV-PDB-6V9O-3", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.799 }, "provenance": { "deposit_id": "6V9O", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6V9O" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Expanding the Chemical Landscape of SOS1 Activators Using Fragment Based Methods" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT", "GNP", "GOL", "MG", "NA", "QTA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6V9O", "evidence_id": "EV-PDB-6V9O-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.799 }, "provenance": { "deposit_id": "6V9O", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6V9O" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Expanding the Chemical Landscape of SOS1 Activators Using Fragment Based Methods" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EZZ", "GCP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6ZJ0", "evidence_id": "EV-PDB-6ZJ0-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.763 }, "provenance": { "deposit_id": "6ZJ0", "doi": "10.4155/fmc-2020-0221", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6ZJ0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF HRAS-G12D IN COMPLEX WITH GCP AND COMPOUND 18" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EZZ", "GDP", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6ZL3", "evidence_id": "EV-PDB-6ZL3-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.031 }, "provenance": { "deposit_id": "6ZL3", "doi": "10.4155/fmc-2020-0221", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6ZL3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF HRAS IN COMPLEX WITH COMPOUND 18 and GDP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "H-RAS P21 PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/721P", "evidence_id": "EV-PDB-721P-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "721P", "doi": "10.1016/0092-8674(90)90018-A", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/721P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THREE-DIMENSIONAL STRUCTURES OF H-RAS P21 MUTANTS: MOLECULAR BASIS FOR THEIR INABILITY TO FUNCTION AS SIGNAL SWITCH MOLECULES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7DPH", "evidence_id": "EV-PDB-7DPH-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.54 }, "provenance": { "deposit_id": "7DPH", "doi": "10.1016/j.bbrc.2021.05.084", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7DPH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras Q61H in complex with GppNHp (state 1) after structural transition by humidity control" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7DPJ", "evidence_id": "EV-PDB-7DPJ-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.976 }, "provenance": { "deposit_id": "7DPJ", "doi": "10.1016/j.bbrc.2021.05.084", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7DPJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H-Ras Q61L in complex with GppNHp (state 1) after structural transition by humidity control" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "GOL", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -100.0 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7JIF", "evidence_id": "EV-PDB-7JIF-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.757 }, "provenance": { "deposit_id": "7JIF", "doi": "10.1016/j.molcel.2022.02.011", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7JIF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS A59T GppNHp" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -100.0 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7JIG", "evidence_id": "EV-PDB-7JIG-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.322 }, "provenance": { "deposit_id": "7JIG", "doi": "10.1016/j.molcel.2022.02.011", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7JIG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS A59T GppNHp crystal 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -100.0 }, "construct": { "description": "GTPase HRas (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7JII", "evidence_id": "EV-PDB-7JII-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.532 }, "provenance": { "deposit_id": "7JII", "doi": "10.1016/j.molcel.2022.02.011", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7JII" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS A59E GDP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GSP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A,E,G,L)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7L0F", "evidence_id": "EV-PDB-7L0F-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.98 }, "provenance": { "deposit_id": "7L0F", "doi": "10.1038/s41467-021-22969-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7L0F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Monobody 12VC3 Bound to HRAS(WT)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GSP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A,B,E,G)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7L0G", "evidence_id": "EV-PDB-7L0G-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.54 }, "provenance": { "deposit_id": "7L0G", "doi": "10.1038/s41467-021-22969-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7L0G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Monobody 12VC1 Bound to HRAS(G12C)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG", "PGE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7OG9", "evidence_id": "EV-PDB-7OG9-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "7OG9", "doi": "10.1039/d1sc05488k", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7OG9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GTPase HRAS under ambient pressure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG", "PGE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7OGA", "evidence_id": "EV-PDB-7OGA-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "7OGA", "doi": "10.1039/d1sc05488k", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7OGA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GTPase HRAS under 200 MPa pressure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1PE", "GNP", "MG", "PGE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7OGB", "evidence_id": "EV-PDB-7OGB-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "7OGB", "doi": "10.1039/d1sc05488k", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7OGB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GTPase HRAS under 500 MPa pressure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1PE", "GNP", "MG", "PGE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7OGC", "evidence_id": "EV-PDB-7OGC-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "7OGC", "doi": "10.1039/d1sc05488k", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7OGC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GTPase HRAS under 650 MPa pressure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG", "PGE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7OGD", "evidence_id": "EV-PDB-7OGD-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "7OGD", "doi": "10.1039/d1sc05488k", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7OGD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GTPase HRAS mutant D33K under ambient pressure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG", "PGE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7OGE", "evidence_id": "EV-PDB-7OGE-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "7OGE", "doi": "10.1039/d1sc05488k", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7OGE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GTPase HRAS mutant D33K under 200 MPa pressure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "GOL", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -100.0 }, "construct": { "description": "GTPase HRas (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7JIH", "evidence_id": "EV-PDB-7JIH-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.989 }, "provenance": { "deposit_id": "7JIH", "doi": "10.1016/j.molcel.2022.02.011", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7JIH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS A59E GppNHp" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7JHP", "evidence_id": "EV-PDB-7JHP-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.766 }, "provenance": { "deposit_id": "7JHP", "doi": "10.3390/biom11070996", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7JHP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of HRas in complex with the Ras-binding and cysteine-rich domains of CRaf-kinase" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT", "GNP", "GOL", "MG", "NA", "QTG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6V9M", "evidence_id": "EV-PDB-6V9M-3", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.648 }, "provenance": { "deposit_id": "6V9M", "doi": "10.1021/acs.jmedchem.0c00511", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6V9M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Expanding the Chemical Landscape of SOS1 Activators Using Fragment Based Methods" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT", "GNP", "GOL", "MG", "NA", "QTG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6V9M", "evidence_id": "EV-PDB-6V9M-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.648 }, "provenance": { "deposit_id": "6V9M", "doi": "10.1021/acs.jmedchem.0c00511", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6V9M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Expanding the Chemical Landscape of SOS1 Activators Using Fragment Based Methods" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "GOL", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6E6P", "evidence_id": "EV-PDB-6E6P-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.93 }, "provenance": { "deposit_id": "6E6P", "doi": "10.1016/j.celrep.2019.07.026", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6E6P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS G13D bound to GppNHp (Ha,b,c13GNP)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FG3", "evidence_id": "EV-PDB-8FG3-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.49 }, "provenance": { "deposit_id": "8FG3", "doi": "10.1002/pro.4767", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FG3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS R97L Crystal Form 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "GOL", "MG", "ZNI" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8TBG", "evidence_id": "EV-PDB-8TBG-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "8TBG", "doi": "10.1038/s41586-024-07205-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8TBG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Tricomplex of RMC-7977, HRAS WT, and CypA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9PUZ", "evidence_id": "EV-PDB-9PUZ-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "9PUZ", "doi": "10.1021/acsmedchemlett.6c00078", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9PUZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS complex with UM0153030 compound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.3, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9PVE", "evidence_id": "EV-PDB-9PVE-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "9PVE", "doi": "10.1021/acsmedchemlett.6c00078", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9PVE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS complex with UM0152533 compound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "GTP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9WRU", "evidence_id": "EV-PDB-9WRU-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "9WRU", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9WRU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SS-ROX structure analysis of H-Ras using caged-compound complex: freeze-trap series (5 hr after UV light irradiation)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GTP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9WRT", "evidence_id": "EV-PDB-9WRT-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "9WRT", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9WRT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SS-ROX structure analysis of H-Ras using caged-compound complex: freeze-trap series (2.5 h after UV light irradiation)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GTP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9WRS", "evidence_id": "EV-PDB-9WRS-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "9WRS", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9WRS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SS-ROX structure analysis of H-Ras using caged-compound complex: freeze-trap series (within 15 min after UV light irradiation)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.4, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9WRR", "evidence_id": "EV-PDB-9WRR-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "9WRR", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9WRR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SS-ROX structure analysis of H-Ras using caged-compound complex: 28 hr after UV light irradiation (GDP bound form)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GTP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9WRQ", "evidence_id": "EV-PDB-9WRQ-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "9WRQ", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9WRQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SS-ROX structure analysis of H-Ras using caged-compound complex: 15 min after UV light irradiation (GTP bound form state 1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "CAG", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9WRP", "evidence_id": "EV-PDB-9WRP-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "9WRP", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9WRP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SS-ROX structure analysis of H-Ras using caged-compound complex: before UV light irradiation (NPE-caged GTP bound)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9PUT", "evidence_id": "EV-PDB-9PUT-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "9PUT", "doi": "10.1021/acsmedchemlett.6c00078", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9PUT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS complex with UM0152535 compound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9PUQ", "evidence_id": "EV-PDB-9PUQ-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "9PUQ", "doi": "10.1021/acsmedchemlett.6c00078", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9PUQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS complex with UM0152248 compound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9PUN", "evidence_id": "EV-PDB-9PUN-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "9PUN", "doi": "10.1021/acsmedchemlett.6c00078", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9PUN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS complex with UM0148697 compound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9PUL", "evidence_id": "EV-PDB-9PUL-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "9PUL", "doi": "10.1021/acsmedchemlett.6c00078", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9PUL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS complex with UM0143525 compound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9PU8", "evidence_id": "EV-PDB-9PU8-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "9PU8", "doi": "10.1021/acsmedchemlett.6c00078", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9PU8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS complex with UM0140693 compound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9PU3", "evidence_id": "EV-PDB-9PU3-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "9PU3", "doi": "10.1021/acsmedchemlett.6c00078", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9PU3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS complex with UM0140692 compound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9PU1", "evidence_id": "EV-PDB-9PU1-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "9PU1", "doi": "10.1021/acsmedchemlett.6c00078", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9PU1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS complex with UM0140401 compound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1CG4", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P46", "evidence_id": "EV-PDB-9P46-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.02 }, "provenance": { "deposit_id": "9P46", "doi": "10.1158/2159-8290.CD-25-1280", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P46" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of HRAS-G12D/Q95H (GMPPNP-bound) in complex with BBO-11818" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8WWC", "evidence_id": "EV-PDB-8WWC-2", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "8WWC", "doi": "10.1038/s41592-024-02437-w", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8WWC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "De novo design binder of HRAS -120-4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG", "MOV" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -195.79 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8TLR", "evidence_id": "EV-PDB-8TLR-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.70003947485 }, "provenance": { "deposit_id": "8TLR", "doi": "10.1016/j.cell.2024.08.017", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8TLR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of human HRAS G12C covalently bound to AMG 510" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG", "PGE", "YCN", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8OSO", "evidence_id": "EV-PDB-8OSO-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "8OSO", "doi": "10.1002/chem.202400304", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8OSO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GTPase HRAS in complex with Zn-cyclen under 500 MPa pressure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG", "PGE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8OSN", "evidence_id": "EV-PDB-8OSN-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "8OSN", "doi": "10.1002/chem.202400304", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8OSN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GTPASE HRAS IN COMPLEX WITH ZN-CYCLEN AT AMBIENT PRESSURE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG", "PGE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8OSM", "evidence_id": "EV-PDB-8OSM-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.05 }, "provenance": { "deposit_id": "8OSM", "doi": "10.1002/chem.202400304", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8OSM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GTPASE HRAS IN COMPLEX WITH ZN-CYCLEN AT 200 MPA PRESSURE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FG4", "evidence_id": "EV-PDB-8FG4-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "8FG4", "doi": "10.1002/pro.4767", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FG4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS R97L Crystal Form 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8EM0", "evidence_id": "EV-PDB-8EM0-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.109 }, "provenance": { "deposit_id": "8EM0", "doi": "10.1002/pro.4767", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8EM0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS R97V Crystal Form 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "DTT", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8ELZ", "evidence_id": "EV-PDB-8ELZ-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.961 }, "provenance": { "deposit_id": "8ELZ", "doi": "10.1002/pro.4767", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8ELZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS R97M Crystal Form 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8ELY", "evidence_id": "EV-PDB-8ELY-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "8ELY", "doi": "10.1002/pro.4767", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8ELY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS R97M Crystal Form 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8ELX", "evidence_id": "EV-PDB-8ELX-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.975 }, "provenance": { "deposit_id": "8ELX", "doi": "10.1002/pro.4767", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8ELX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS R97I Crystal Form 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8ELW", "evidence_id": "EV-PDB-8ELW-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.699 }, "provenance": { "deposit_id": "8ELW", "doi": "10.1002/pro.4767", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8ELW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS R97A Crystal Form 1 T-State" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8ELV", "evidence_id": "EV-PDB-8ELV-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.153 }, "provenance": { "deposit_id": "8ELV", "doi": "10.1002/pro.4767", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8ELV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS R97I Crystal Form 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8ELU", "evidence_id": "EV-PDB-8ELU-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.93 }, "provenance": { "deposit_id": "8ELU", "doi": "10.1002/pro.4767", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8ELU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS R97G Crystal form 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8ELT", "evidence_id": "EV-PDB-8ELT-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.66 }, "provenance": { "deposit_id": "8ELT", "doi": "10.1002/pro.4767", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8ELT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS R97G Crystal Form 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8ELS", "evidence_id": "EV-PDB-8ELS-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.267 }, "provenance": { "deposit_id": "8ELS", "doi": "10.1002/pro.4767", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8ELS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS R97A Crystal Form 1 R-state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8ELR", "evidence_id": "EV-PDB-8ELR-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.05 }, "provenance": { "deposit_id": "8ELR", "doi": "10.1002/pro.4767", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8ELR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS R97F Crystal Form 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GNP", "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8ELK", "evidence_id": "EV-PDB-8ELK-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "8ELK", "doi": "10.1002/pro.4767", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8ELK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRAS R97F Crystal Form 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "BEF", "GDP", "MG", "PEG", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8CNN", "evidence_id": "EV-PDB-8CNN-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.48 }, "provenance": { "deposit_id": "8CNN", "doi": "10.1038/s42004-024-01105-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8CNN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "BeF3 Phospho-HRas GSA complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BEF", "GDP", "MG", "MPD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8CNJ", "evidence_id": "EV-PDB-8CNJ-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "8CNJ", "doi": "10.1038/s42004-024-01105-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8CNJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRas(1-166) in complex with GDP and BeF3-" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "MG", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8BWG", "evidence_id": "EV-PDB-8BWG-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.32 }, "provenance": { "deposit_id": "8BWG", "doi": "10.1038/s42004-024-01105-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8BWG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRas (1-166) Y64 phosphorylation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GAI", "GDP", "MG", "MGF" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8BOS", "evidence_id": "EV-PDB-8BOS-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "8BOS", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8BOS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Transition state analogue complex of small G protein and its GAP effector" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8BEA", "evidence_id": "EV-PDB-8BEA-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.47 }, "provenance": { "deposit_id": "8BEA", "doi": "10.1002/anie.202219095", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8BEA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of SOS1-HRas-peptidomimetic10" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "FMT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8BE9", "evidence_id": "EV-PDB-8BE9-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.51 }, "provenance": { "deposit_id": "8BE9", "doi": "10.1002/anie.202219095", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8BE9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of SOS1-HRas-peptidomimetic5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8BE8", "evidence_id": "EV-PDB-8BE8-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "8BE8", "doi": "10.1002/anie.202219095", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8BE8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of SOS1-HRas-peptidomimetic4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8BE7", "evidence_id": "EV-PDB-8BE7-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "8BE7", "doi": "10.1002/anie.202219095", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8BE7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of SOS1-HRas-peptidomimetic3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8BE6", "evidence_id": "EV-PDB-8BE6-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.89880249261 }, "provenance": { "deposit_id": "8BE6", "doi": "10.1002/anie.202219095", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8BE6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of SOS1-HRas-peptidomimetic2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "C-H-RAS P21 PROTEIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/821P", "evidence_id": "EV-PDB-821P-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "821P", "doi": "10.1021/bi00084a005", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/821P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THREE-DIMENSIONAL STRUCTURES AND PROPERTIES OF A TRANSFORMING AND A NONTRANSFORMING GLYCINE-12 MUTANT OF P21H-RAS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7VVG", "evidence_id": "EV-PDB-7VVG-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "7VVG", "doi": "10.1073/pnas.2119990119", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7VVG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of HRasG12V(GMPPNP-bound) in complex with the Ras-binding domain(RBD) of SIN1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7VV9", "evidence_id": "EV-PDB-7VV9-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7VV9", "doi": "10.1073/pnas.2119990119", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7VV9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of HRas(GMPPNP-bound) in complex with the Ras-binding domain(RBD) of SIN1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GNP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7VV8", "evidence_id": "EV-PDB-7VV8-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "7VV8", "doi": "10.1073/pnas.2119990119", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7VV8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of HRasQ61L(GMPPNP-bound) in complex with the Ras-binding domain(RBD) of SIN1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "GDP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7TAM", "evidence_id": "EV-PDB-7TAM-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.87 }, "provenance": { "deposit_id": "7TAM", "doi": "10.1021/acsomega.4c10493", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7TAM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HRas G12V in complex with GDP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1PE", "GNP", "MG", "PGE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7OGF", "evidence_id": "EV-PDB-7OGF-1", "mappings": [ { "confidence": "high", "justification": "GTP or a non-hydrolysable analogue (GNP, GCP, GSP) bound.", "rule": "ras-gtp-analogue", "state_id": "Ras-GTP", "who": "rule:ras-gtp-analogue" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "7OGF", "doi": "10.1039/d1sc05488k", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7OGF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GTPase HRAS mutant D33K under 900 MPa pressure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "GTP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9WRV", "evidence_id": "EV-PDB-9WRV-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "9WRV", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9WRV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SS-ROX structure analysis of H-Ras using caged-compound complex: freeze-trap series (10 hr after UV light irradiation)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GDP", "GTP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9WRW", "evidence_id": "EV-PDB-9WRW-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "9WRW", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9WRW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SS-ROX structure analysis of H-Ras using caged-compound complex: freeze-trap series (20 hr after UV light irradiation)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "CAG", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.4, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9WS9", "evidence_id": "EV-PDB-9WS9-1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.15 }, "provenance": { "deposit_id": "9WS9", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9WS9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SFX structure analysis of H-Ras using caged-GTP complex: dark condition (NPE-caged GTP bound)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "GDP" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.3, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "GTPase HRas (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9Z5W", "evidence_id": "EV-PDB-9Z5W-1", "mappings": [ { "confidence": "high", "justification": "GDP bound and no GTP analogue present.", "rule": "ras-gdp", "state_id": "Ras-GDP", "who": "rule:ras-gdp" } ], "molecule_id": "P01112", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "9Z5W", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9Z5W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of HRAS in complex with N-LHY affibody" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=10051", "evidence_id": "EV-BMRB-10051", "mappings": [], "molecule_id": "P01112", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr10051", "doi": "10.13018/BMR10051", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=10051" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Backbone 1H and 15N assignment for the human c-Ha Ras (Y32W) in the GDP-bound state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.8, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts, T1 relaxation values, T2 relaxation values, heteronuclear NOE values", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=17610", "evidence_id": "EV-BMRB-17610", "mappings": [], "molecule_id": "P01112", "observable": { "type": "relaxation_rate", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr17610", "doi": "10.13018/BMR17610", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=17610" }, "reader": null, "source_kind": "deposit", "technique": "nmr_dynamics", "title": "Solution structure of GppNHp-bound H-RasT35S mutant protein." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.2, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=17678", "evidence_id": "EV-BMRB-17678", "mappings": [], "molecule_id": "P01112", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr17678", "doi": "10.13018/BMR17678", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=17678" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "HRas166*GppNHp backbone chemical shift assignments" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.8, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts, 13C chemical shifts, 15N chemical shifts, heteronuclear NOE values, T1 relaxation values, T2 relaxation values", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=18461", "evidence_id": "EV-BMRB-18461", "mappings": [], "molecule_id": "P01112", "observable": { "type": "relaxation_rate", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr18461", "doi": "10.13018/BMR18461", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=18461" }, "reader": null, "source_kind": "deposit", "technique": "nmr_dynamics", "title": "Chemical shift assignments and backbone dynamics of H-Ras-GppNHp bound to Ras-binding domain of cRaf1." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.2, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=18479", "evidence_id": "EV-BMRB-18479", "mappings": [], "molecule_id": "P01112", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr18479", "doi": "10.13018/BMR18479", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=18479" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "HRas166*GDP backbone chemical shift assignments" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.8, "salt_mM": null, "temperature_c": 4.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=18629", "evidence_id": "EV-BMRB-18629", "mappings": [], "molecule_id": "P01112", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr18629", "doi": "10.13018/BMR18629", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=18629" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Solution structure of H-RasT35S mutant protein in complex with Kobe2601" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 6.8, "salt_mM": null, "temperature_c": 4.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=36166", "evidence_id": "EV-BMRB-36166", "mappings": [], "molecule_id": "P01112", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr36166", "doi": "10.13018/BMR36166", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=36166" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Solution structure of H-RasT35S mutant protein in complex with KBFM123" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "DisProt annotations do not record sample conditions.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "residues 170-189; evidence: X-ray crystallography-based structural model with missing residue coordinates used in manual assertion", "labels": [] }, "data_format": null, "data_level": "reported", "data_link": "https://europepmc.org/article/MED/2406906", "evidence_id": "EV-DISPROT-DP00153r021", "mappings": [], "molecule_id": "P01112", "observable": { "type": "disorder_region", "uncertainty": null, "unit": "residues", "value": 20 }, "provenance": { "deposit_id": "DP00153r021", "doi": null, "licence": "CC BY 4.0", "retrieved": "2026-10-19", "source": "DisProt", "url": "https://disprot.org/DP00153" }, "reader": null, "source_kind": "literature", "technique": "xray", "title": "DisProt DP00153: disorder, residues 170-189" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_silico", "ions": [], "ligands": [], "notes": "Computed prediction; no experimental conditions.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "AlphaFold Monomer v2.0 pipeline, residues 1-189", "labels": [] }, "data_format": "mmCIF, PAE JSON", "data_level": "processed", "data_link": "https://alphafold.ebi.ac.uk/entry/P01112", "evidence_id": "EV-AFDB-AF-P01112-F1", "mappings": [], "molecule_id": "P01112", "observable": { "type": "plddt", "uncertainty": null, "unit": "pLDDT", "value": 91.94 }, "provenance": { "deposit_id": "AF-P01112-F1", "doi": null, "licence": "CC BY 4.0", "retrieved": "2026-10-19", "source": "AlphaFold DB", "url": "https://alphafold.ebi.ac.uk/entry/P01112" }, "reader": null, "source_kind": "computed", "technique": "af_prediction", "title": "AlphaFold DB prediction AF-P01112-F1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_silico", "ions": [], "ligands": [], "notes": "Simulation; temperature is the thermostat setting.", "ph": null, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "start 1GNR; Amber Parm99", "labels": [] }, "data_format": "trajectory", "data_level": "processed", "data_link": "https://mmb.mddbr.eu/#/id/A00GQ/overview", "evidence_id": "EV-MDDB-A00GQ", "mappings": [], "molecule_id": "P01112", "observable": { "type": "trajectory", "uncertainty": null, "unit": "ns", "value": 10.0 }, "provenance": { "deposit_id": "A00GQ", "doi": "10.1016/j.str.2010.07.013", "licence": "This trajectory dataset is released under a Creative Commons Attribution 4.0 International Public License", "retrieved": "2026-10-19", "source": "MDDB", "url": "https://mmb.mddbr.eu/#/id/A00GQ/overview" }, "reader": null, "source_kind": "computed", "technique": "md", "title": "MoDEL 1GNR" } ], "models": [ { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-4Q21-1" ], "file": "models/P01112/Ras-GDP.cif", "format": "mmCIF", "model_id": "Ras-GDP-cif", "molecule_id": "P01112", "provenance": { "deposit_id": "4Q21", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/4Q21.cif" }, "state_id": "Ras-GDP" }, { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-4Q21-1" ], "file": "models/P01112/Ras-GDP.pdb", "format": "PDB", "model_id": "Ras-GDP-pdb", "molecule_id": "P01112", "provenance": { "deposit_id": "4Q21", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/4Q21.pdb" }, "state_id": "Ras-GDP" }, { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-5P21-1" ], "file": "models/P01112/Ras-GTP.cif", "format": "mmCIF", "model_id": "Ras-GTP-cif", "molecule_id": "P01112", "provenance": { "deposit_id": "5P21", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/5P21.cif" }, "state_id": "Ras-GTP" }, { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-5P21-1" ], "file": "models/P01112/Ras-GTP.pdb", "format": "PDB", "model_id": "Ras-GTP-pdb", "molecule_id": "P01112", "provenance": { "deposit_id": "5P21", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/5P21.pdb" }, "state_id": "Ras-GTP" } ], "molecule": { "components": [], "domains": [], "gene": "HRAS", "identifiers": { "genbank": null, "isoform": null, "nakb": null, "pdb": [], "rfam": null, "rnacentral": null, "uniprot": "P01112" }, "ligands": [ "GTP" ], "modifications": [ { "kind": "ptm", "name": "N-acetylmethionine; in GTPase HRas; alternate", "position": 1, "source": "UniProtKB" }, { "kind": "ptm", "name": "N-acetylthreonine; in GTPase HRas, N-terminally processed", "position": 2, "source": "UniProtKB" }, { "kind": "ptm", "name": "S-nitrosocysteine", "position": 118, "source": "UniProtKB" }, { "kind": "ptm", "name": "Cysteine methyl ester", "position": 186, "source": "UniProtKB" } ], "molecule_id": "P01112", "molecule_type": "protein", "name": "GTPase HRas", "organism": { "name": "Homo sapiens", "taxon_id": 9606 }, "provenance": { "deposit_id": "P01112", "doi": null, "licence": "CC BY 4.0 (UniProt)", "retrieved": "2026-10-19", "source": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01112/entry" }, "sequence": "MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS", "sequence_length": 189 }, "molecule_id": "P01112", "states": [ { "assumptions": [], "basis": "observed", "description": "GDP-bound switch conformation, as in 4Q21.", "family_label": null, "molecule_id": "P01112", "name": "GDP-bound (inactive)", "parent_state": null, "population": null, "provenance": { "deposit_id": null, "doi": null, "licence": "Project licence (pending decision)", "retrieved": "2026-10-19", "source": "Conformome curation (P01112.yaml)", "url": "https://github.com/matth55/conformome/blob/HEAD/curation/P01112.yaml" }, "representative_model": "Ras-GDP-cif", "secondary_structure": null, "state_id": "Ras-GDP", "status": "draft" }, { "assumptions": [], "basis": "observed", "description": "GppNHp-bound active switch conformation, as in 5P21 (1.35 Å). State 1 and state 2 are not separated.", "family_label": null, "molecule_id": "P01112", "name": "GTP-analogue-bound (active)", "parent_state": null, "population": null, "provenance": { "deposit_id": null, "doi": null, "licence": "Project licence (pending decision)", "retrieved": "2026-10-19", "source": "Conformome curation (P01112.yaml)", "url": "https://github.com/matth55/conformome/blob/HEAD/curation/P01112.yaml" }, "representative_model": "Ras-GTP-cif", "secondary_structure": null, "state_id": "Ras-GTP", "status": "draft" } ], "transitions": [] }