{ "conflicts": [], "coverage": { "cells": { "T4L-L99A-apo": { "cryoem": 0, "force_spectroscopy": 0, "integrative": 0, "md": 0, "neutron": 0, "nmr_shifts": 0, "nmr_structure": 0, "xray": 1 }, "T4L-L99A-benzene": { "cryoem": 0, "force_spectroscopy": 0, "integrative": 0, "md": 0, "neutron": 0, "nmr_shifts": 0, "nmr_structure": 0, "xray": 7 }, "T4L-WT": { "cryoem": 0, "force_spectroscopy": 0, "integrative": 0, "md": 0, "neutron": 0, "nmr_shifts": 0, "nmr_structure": 0, "xray": 1 } }, "data_levels": { "T4L-L99A-apo": { "xray": "processed" }, "T4L-L99A-benzene": { "xray": "processed" }, "T4L-WT": { "xray": "processed" } }, "single_method_states": [ "T4L-WT", "T4L-L99A-apo", "T4L-L99A-benzene" ], "states": [ "T4L-WT", "T4L-L99A-apo", "T4L-L99A-benzene" ], "techniques": [ "xray", "cryoem", "neutron", "nmr_structure", "nmr_shifts", "force_spectroscopy", "integrative", "md" ], "unmapped_evidence": 784 }, "curation": { "as_of": "2026-10-19", "curator": "draft (unreviewed)", "file": "P00720.yaml", "status": "draft" }, "evidence": [ { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/102L", "evidence_id": "EV-PDB-102L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.74 }, "provenance": { "deposit_id": "102L", "doi": "10.1038/361561a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/102L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HOW AMINO-ACID INSERTIONS ARE ALLOWED IN AN ALPHA-HELIX OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/103L", "evidence_id": "EV-PDB-103L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "103L", "doi": "10.1038/361561a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/103L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HOW AMINO-ACID INSERTIONS ARE ALLOWED IN AN ALPHA-HELIX OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/104L", "evidence_id": "EV-PDB-104L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "104L", "doi": "10.1038/361561a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/104L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HOW AMINO-ACID INSERTIONS ARE ALLOWED IN AN ALPHA-HELIX OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/107L", "evidence_id": "EV-PDB-107L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "107L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/107L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/108L", "evidence_id": "EV-PDB-108L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "108L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/108L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/109L", "evidence_id": "EV-PDB-109L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "109L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/109L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/110L", "evidence_id": "EV-PDB-110L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "110L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/110L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/111L", "evidence_id": "EV-PDB-111L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "111L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/111L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/112L", "evidence_id": "EV-PDB-112L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "112L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/112L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/113L", "evidence_id": "EV-PDB-113L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "113L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/113L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/114L", "evidence_id": "EV-PDB-114L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "114L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/114L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/115L", "evidence_id": "EV-PDB-115L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "115L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/115L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/118L", "evidence_id": "EV-PDB-118L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "118L", "doi": "10.1021/bi00093a013", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/118L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE ENERGETIC COST AND THE STRUCTURAL CONSEQUENCES OF BURYING A HYDROXYL GROUP WITHIN THE CORE OF A PROTEIN DETERMINED FROM ALA TO SER AND VAL TO THR SUBSTITUTIONS IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/119L", "evidence_id": "EV-PDB-119L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "119L", "doi": "10.1021/bi00093a013", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/119L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE ENERGETIC COST AND THE STRUCTURAL CONSEQUENCES OF BURYING A HYDROXYL GROUP WITHIN THE CORE OF A PROTEIN DETERMINED FROM ALA TO SER AND VAL TO THR SUBSTITUTIONS IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/120L", "evidence_id": "EV-PDB-120L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "120L", "doi": "10.1021/bi00093a013", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/120L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE ENERGETIC COST AND THE STRUCTURAL CONSEQUENCES OF BURYING A HYDROXYL GROUP WITHIN THE CORE OF A PROTEIN DETERMINED FROM ALA TO SER AND VAL TO THR SUBSTITUTIONS IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/122L", "evidence_id": "EV-PDB-122L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "122L", "doi": "10.1021/bi00093a013", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/122L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE ENERGETIC COST AND THE STRUCTURAL CONSEQUENCES OF BURYING A HYDROXYL GROUP WITHIN THE CORE OF A PROTEIN DETERMINED FROM ALA TO SER AND VAL TO THR SUBSTITUTIONS IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/123L", "evidence_id": "EV-PDB-123L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "123L", "doi": "10.1021/bi00093a013", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/123L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE ENERGETIC COST AND THE STRUCTURAL CONSEQUENCES OF BURYING A HYDROXYL GROUP WITHIN THE CORE OF A PROTEIN DETERMINED FROM ALA TO SER AND VAL TO THR SUBSTITUTIONS IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/125L", "evidence_id": "EV-PDB-125L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "125L", "doi": "10.1021/bi00093a013", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/125L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE ENERGETIC COST AND THE STRUCTURAL CONSEQUENCES OF BURYING A HYDROXYL GROUP WITHIN THE CORE OF A PROTEIN DETERMINED FROM ALA TO SER AND VAL TO THR SUBSTITUTIONS IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/126L", "evidence_id": "EV-PDB-126L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "126L", "doi": "10.1021/bi00093a013", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/126L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE ENERGETIC COST AND THE STRUCTURAL CONSEQUENCES OF BURYING A HYDROXYL GROUP WITHIN THE CORE OF A PROTEIN DETERMINED FROM ALA TO SER AND VAL TO THR SUBSTITUTIONS IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/127L", "evidence_id": "EV-PDB-127L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "127L", "doi": "10.1021/bi00093a013", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/127L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE ENERGETIC COST AND THE STRUCTURAL CONSEQUENCES OF BURYING A HYDROXYL GROUP WITHIN THE CORE OF A PROTEIN DETERMINED FROM ALA TO SER AND VAL TO THR SUBSTITUTIONS IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/128L", "evidence_id": "EV-PDB-128L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "128L", "doi": "10.1021/bi00093a013", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/128L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE ENERGETIC COST AND THE STRUCTURAL CONSEQUENCES OF BURYING A HYDROXYL GROUP WITHIN THE CORE OF A PROTEIN DETERMINED FROM ALA TO SER AND VAL TO THR SUBSTITUTIONS IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/129L", "evidence_id": "EV-PDB-129L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "129L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/129L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURES OF RANDOMLY GENERATED MUTANTS OF T4 LYSOZYME SHOW THAT PROTEIN STABILITY CAN BE ENHANCED BY RELAXATION OF STRAIN AND BY IMPROVED HYDROGEN BONDING VIA BOUND SOLVENT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/130L", "evidence_id": "EV-PDB-130L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "130L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/130L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURES OF RANDOMLY GENERATED MUTANTS OF T4 LYSOZYME SHOW THAT PROTEIN STABILITY CAN BE ENHANCED BY RELAXATION OF STRAIN AND BY IMPROVED HYDROGEN BONDING VIA BOUND SOLVENT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/131L", "evidence_id": "EV-PDB-131L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "131L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/131L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURES OF RANDOMLY GENERATED MUTANTS OF T4 LYSOZYME SHOW THAT PROTEIN STABILITY CAN BE ENHANCED BY RELAXATION OF STRAIN AND BY IMPROVED HYDROGEN BONDING VIA BOUND SOLVENT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/137L", "evidence_id": "EV-PDB-137L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "137L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/137L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL BASIS OF AMINO ACID ALPHA HELIX PROPENSITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/138L", "evidence_id": "EV-PDB-138L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "138L", "doi": "10.1093/protein/7.3.301", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/138L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "RAPID CRYSTALLIZATION OF T4 LYSOZYME BY INTERMOLECULAR DISULFIDE CROSSLINKING" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/139L", "evidence_id": "EV-PDB-139L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "139L", "doi": "10.1093/protein/7.3.301", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/139L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "RAPID CRYSTALLIZATION OF T4 LYSOZYME BY INTERMOLECULAR DISULFIDE CROSSLINKING" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/140L", "evidence_id": "EV-PDB-140L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "140L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/140L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ROLE OF BACKBONE FLEXIBILITY IN THE ACCOMMODATION OF VARIANTS THAT REPACK THE CORE OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/141L", "evidence_id": "EV-PDB-141L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "141L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/141L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ROLE OF BACKBONE FLEXIBILITY IN THE ACCOMMODATION OF VARIANTS THAT REPACK THE CORE OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/142L", "evidence_id": "EV-PDB-142L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "142L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/142L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ROLE OF BACKBONE FLEXIBILITY IN THE ACCOMMODATION OF VARIANTS THAT REPACK THE CORE OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/143L", "evidence_id": "EV-PDB-143L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "143L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/143L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ROLE OF BACKBONE FLEXIBILITY IN THE ACCOMMODATION OF VARIANTS THAT REPACK THE CORE OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/144L", "evidence_id": "EV-PDB-144L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "144L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/144L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ROLE OF BACKBONE FLEXIBILITY IN THE ACCOMMODATION OF VARIANTS THAT REPACK THE CORE OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/145L", "evidence_id": "EV-PDB-145L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "145L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/145L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ROLE OF BACKBONE FLEXIBILITY IN THE ACCOMMODATION OF VARIANTS THAT REPACK THE CORE OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/146L", "evidence_id": "EV-PDB-146L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "146L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/146L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ROLE OF BACKBONE FLEXIBILITY IN THE ACCOMMODATION OF VARIANTS THAT REPACK THE CORE OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/147L", "evidence_id": "EV-PDB-147L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "147L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/147L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ROLE OF BACKBONE FLEXIBILITY IN THE ACCOMMODATION OF VARIANTS THAT REPACK THE CORE OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-N-acetyl-alpha-muramic acid" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/148L", "evidence_id": "EV-PDB-148L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "148L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/148L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "A COVALENT ENZYME-SUBSTRATE INTERMEDIATE WITH SACCHARIDE DISTORTION IN A MUTANT T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/149L", "evidence_id": "EV-PDB-149L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "149L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/149L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONSERVATION OF SOLVENT-BINDING SITES IN 10 CRYSTAL FORMS OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/150L", "evidence_id": "EV-PDB-150L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "150L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/150L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONSERVATION OF SOLVENT-BINDING SITES IN 10 CRYSTAL FORMS OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/151L", "evidence_id": "EV-PDB-151L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "151L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/151L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONSERVATION OF SOLVENT-BINDING SITES IN 10 CRYSTAL FORMS OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/152L", "evidence_id": "EV-PDB-152L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "152L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/152L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONSERVATION OF SOLVENT-BINDING SITES IN 10 CRYSTAL FORMS OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/155L", "evidence_id": "EV-PDB-155L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "155L", "doi": "10.1006/jmbi.1994.0087", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/155L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTROL OF ENZYME ACTIVITY BY AN ENGINEERED DISULFIDE BOND" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/156L", "evidence_id": "EV-PDB-156L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "156L", "doi": "10.1006/jmbi.1994.0087", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/156L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTROL OF ENZYME ACTIVITY BY AN ENGINEERED DISULFIDE BOND" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/157L", "evidence_id": "EV-PDB-157L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "157L", "doi": "10.1006/jmbi.1994.0087", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/157L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTROL OF ENZYME ACTIVITY BY AN ENGINEERED DISULFIDE BOND" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/158L", "evidence_id": "EV-PDB-158L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "158L", "doi": "10.1006/jmbi.1994.0087", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/158L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTROL OF ENZYME ACTIVITY BY AN ENGINEERED DISULFIDE BOND" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/159L", "evidence_id": "EV-PDB-159L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "159L", "doi": "10.1006/jmbi.1994.0087", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/159L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTROL OF ENZYME ACTIVITY BY AN ENGINEERED DISULFIDE BOND" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/160L", "evidence_id": "EV-PDB-160L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "160L", "doi": "10.1006/jmbi.1994.0087", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/160L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTROL OF ENZYME ACTIVITY BY AN ENGINEERED DISULFIDE BOND" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/161L", "evidence_id": "EV-PDB-161L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "161L", "doi": "10.1006/jmbi.1994.0087", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/161L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTROL OF ENZYME ACTIVITY BY AN ENGINEERED DISULFIDE BOND" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/162L", "evidence_id": "EV-PDB-162L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "162L", "doi": "10.1006/jmbi.1994.0087", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/162L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTROL OF ENZYME ACTIVITY BY AN ENGINEERED DISULFIDE BOND" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/163L", "evidence_id": "EV-PDB-163L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "163L", "doi": "10.1006/jmbi.1994.0087", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/163L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTROL OF ENZYME ACTIVITY BY AN ENGINEERED DISULFIDE BOND" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/164L", "evidence_id": "EV-PDB-164L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "164L", "doi": "10.1006/jmbi.1994.0087", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/164L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTROL OF ENZYME ACTIVITY BY AN ENGINEERED DISULFIDE BOND" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A,B,C,D,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/168L", "evidence_id": "EV-PDB-168L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.9 }, "provenance": { "deposit_id": "168L", "doi": "10.1006/jmbi.1995.0396", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/168L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PROTEIN FLEXIBILITY AND ADAPTABILITY SEEN IN 25 CRYSTAL FORMS OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A,B,C,D,E)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/169L", "evidence_id": "EV-PDB-169L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "169L", "doi": "10.1006/jmbi.1995.0396", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/169L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PROTEIN FLEXIBILITY AND ADAPTABILITY SEEN IN 25 CRYSTAL FORMS OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BNZ", "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/181L", "evidence_id": "EV-PDB-181L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "181L", "doi": "10.1021/bi00027a007", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/181L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPECIFICITY OF LIGAND BINDING IN A BURIED NON-POLAR CAVITY OF T4 LYSOZYME: LINKAGE OF DYNAMICS AND STRUCTURAL PLASTICITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED", "IND" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/185L", "evidence_id": "EV-PDB-185L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "185L", "doi": "10.1021/bi00027a007", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/185L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPECIFICITY OF LIGAND BINDING IN A BURIED NON-POLAR CAVITY OF T4 LYSOZYME: LINKAGE OF DYNAMICS AND STRUCTURAL PLASTICITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED", "PXY" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/187L", "evidence_id": "EV-PDB-187L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "187L", "doi": "10.1021/bi00027a007", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/187L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPECIFICITY OF LIGAND BINDING IN A BURIED NON-POLAR CAVITY OF T4 LYSOZYME: LINKAGE OF DYNAMICS AND STRUCTURAL PLASTICITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "KR" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C6G", "evidence_id": "EV-PDB-1C6G-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1C6G", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C6G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/L99A IN THE PRESENCE OF 4 ATM KRYPTON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AR", "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C6F", "evidence_id": "EV-PDB-1C6F-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1C6F", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C6F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/L99A IN THE PRESENCE OF 32 ATM ARGON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "XE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C6E", "evidence_id": "EV-PDB-1C6E-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1C6E", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C6E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/L99A IN THE PRESENCE OF 2 ATM XENON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "KR" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C6D", "evidence_id": "EV-PDB-1C6D-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1C6D", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C6D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/L99A IN THE PRESENCE OF 16 ATM KRYPTON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AR", "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C6C", "evidence_id": "EV-PDB-1C6C-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1C6C", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C6C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/L99A IN THE PRESENCE OF 16 ATM ARGON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "XE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C6B", "evidence_id": "EV-PDB-1C6B-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "1C6B", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C6B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/L133A IN THE PRESENCE OF 8 ATM XENON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "KR" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C6A", "evidence_id": "EV-PDB-1C6A-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1C6A", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C6A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/L133A IN THE PRESENCE OF 8 ATM KRYPTON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C69", "evidence_id": "EV-PDB-1C69-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1C69", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C69" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/L133A IN THE PRESENCE OF 8 ATM ARGON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "XE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C68", "evidence_id": "EV-PDB-1C68-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "1C68", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C68" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/L121A/L133A IN THE PRESENCE OF 8 ATM XENON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "KR" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C67", "evidence_id": "EV-PDB-1C67-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "1C67", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C67" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/L121A/L133A IN THE PRESENCE OF 8 ATM KRYPTON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AR", "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C66", "evidence_id": "EV-PDB-1C66-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1C66", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C66" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/L121A/L133A IN THE PRESENCE OF 8 ATM ARGON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "XE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C65", "evidence_id": "EV-PDB-1C65-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1C65", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C65" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/L121A IN THE PRESENCE OF 8 ATM XENON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "KR" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C64", "evidence_id": "EV-PDB-1C64-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1C64", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C64" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/L121A IN THE PRESENCE OF 8 ATM KRYPTON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C63", "evidence_id": "EV-PDB-1C63-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1C63", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C63" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/L121A IN THE PRESENCE OF 8 ATM ARGON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "XE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C62", "evidence_id": "EV-PDB-1C62-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "1C62", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C62" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/F153A IN THE PRESENCE OF 8 ATM XENON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "KR" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C61", "evidence_id": "EV-PDB-1C61-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1C61", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C61" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/F153A IN THE PRESENCE OF 8 ATM KRYPTON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C60", "evidence_id": "EV-PDB-1C60-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1C60", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C60" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/F153A IN THE PRESENCE OF 8 ATM ARGON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1B6I", "evidence_id": "EV-PDB-1B6I-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1B6I", "doi": "10.1073/pnas.97.1.139", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1B6I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT WITH CYS 54 REPLACED BY THR, CYS 97 REPLACED BY ALA, THR 21 REPLACED BY CYS AND LYS 124 REPLACED BY CYS (C54T,C97A,T21C,K124C)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/199L", "evidence_id": "EV-PDB-199L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "199L", "doi": "10.1006/jmbi.1996.0338", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/199L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THERMODYNAMIC AND STRUCTURAL COMPENSATION IN \"SIZE-SWITCH\" CORE-REPACKING VARIANTS OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/198L", "evidence_id": "EV-PDB-198L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "198L", "doi": "10.1006/jmbi.1996.0338", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/198L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THERMODYNAMIC AND STRUCTURAL COMPENSATION IN \"SIZE-SWITCH\" CORE-REPACKING VARIANTS OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/197L", "evidence_id": "EV-PDB-197L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "197L", "doi": "10.1006/jmbi.1996.0338", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/197L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THERMODYNAMIC AND STRUCTURAL COMPENSATION IN \"SIZE-SWITCH\" CORE-REPACKING VARIANTS OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/196L", "evidence_id": "EV-PDB-196L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "196L", "doi": "10.1006/jmbi.1996.0338", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/196L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THERMODYNAMIC AND STRUCTURAL COMPENSATION IN \"SIZE-SWITCH\" CORE-REPACKING VARIANTS OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/195L", "evidence_id": "EV-PDB-195L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "195L", "doi": "10.1006/jmbi.1996.0338", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/195L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THERMODYNAMIC AND STRUCTURAL COMPENSATION IN \"SIZE-SWITCH\" CORE-REPACKING VARIANTS OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/192L", "evidence_id": "EV-PDB-192L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "192L", "doi": "10.1016/S0301-4622(02)00193-X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/192L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "A HELIX INITIATION SIGNAL IN T4 LYSOZYME IDENTIFIED BY POLYALANINE MUTAGENESIS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/191L", "evidence_id": "EV-PDB-191L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "191L", "doi": "10.1016/S0301-4622(02)00193-X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/191L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "A HELIX INITIATION SIGNAL IN T4 LYSOZYME IDENTIFIED BY POLYALANINE MUTAGENESIS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/190L", "evidence_id": "EV-PDB-190L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "190L", "doi": "10.1016/S0301-4622(02)00193-X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/190L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "A HELIX INITIATION SIGNAL IN T4 LYSOZYME IDENTIFIED BY POLYALANINE MUTAGENESIS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/189L", "evidence_id": "EV-PDB-189L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "189L", "doi": "10.1093/protein/8.10.1017", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/189L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ENHANCEMENT OF PROTEIN STABILITY BY THE COMBINATION OF POINT MUTATIONS IN T4 LYSOZYME IS ADDITIVE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED", "OXE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/188L", "evidence_id": "EV-PDB-188L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "188L", "doi": "10.1021/bi00027a007", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/188L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPECIFICITY OF LIGAND BINDING IN A BURIED NON-POLAR CAVITY OF T4 LYSOZYME: LINKAGE OF DYNAMICS AND STRUCTURAL PLASTICITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED", "N4B" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/186L", "evidence_id": "EV-PDB-186L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "186L", "doi": "10.1021/bi00027a007", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/186L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPECIFICITY OF LIGAND BINDING IN A BURIED NON-POLAR CAVITY OF T4 LYSOZYME: LINKAGE OF DYNAMICS AND STRUCTURAL PLASTICITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED", "I4B" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/184L", "evidence_id": "EV-PDB-184L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "184L", "doi": "10.1021/bi00027a007", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/184L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPECIFICITY OF LIGAND BINDING IN A BURIED NON-POLAR CAVITY OF T4 LYSOZYME: LINKAGE OF DYNAMICS AND STRUCTURAL PLASTICITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DEN", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/183L", "evidence_id": "EV-PDB-183L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "183L", "doi": "10.1021/bi00027a007", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/183L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPECIFICITY OF LIGAND BINDING IN A BURIED NON-POLAR CAVITY OF T4 LYSOZYME: LINKAGE OF DYNAMICS AND STRUCTURAL PLASTICITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BZF", "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/182L", "evidence_id": "EV-PDB-182L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "182L", "doi": "10.1021/bi00027a007", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/182L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPECIFICITY OF LIGAND BINDING IN A BURIED NON-POLAR CAVITY OF T4 LYSOZYME: LINKAGE OF DYNAMICS AND STRUCTURAL PLASTICITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/180L", "evidence_id": "EV-PDB-180L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "180L", "doi": "10.1006/jmbi.1995.0396", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/180L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PROTEIN FLEXIBILITY AND ADAPTABILITY SEEN IN 25 CRYSTAL FORMS OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 16.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/178L", "evidence_id": "EV-PDB-178L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.71 }, "provenance": { "deposit_id": "178L", "doi": "10.1006/jmbi.1995.0396", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/178L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Protein flexibility and adaptability seen in 25 crystal forms of T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.6, "salt_mM": null, "temperature_c": 16.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/177L", "evidence_id": "EV-PDB-177L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "177L", "doi": "10.1006/jmbi.1995.0396", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/177L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Protein flexibility and adaptability seen in 25 crystal forms of T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/176L", "evidence_id": "EV-PDB-176L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "176L", "doi": "10.1006/jmbi.1995.0396", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/176L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PROTEIN FLEXIBILITY AND ADAPTABILITY SEEN IN 25 CRYSTAL FORMS OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/175L", "evidence_id": "EV-PDB-175L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "175L", "doi": "10.1006/jmbi.1995.0396", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/175L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PROTEIN FLEXIBILITY AND ADAPTABILITY SEEN IN 25 CRYSTAL FORMS OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/174L", "evidence_id": "EV-PDB-174L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "174L", "doi": "10.1006/jmbi.1995.0396", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/174L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PROTEIN FLEXIBILITY AND ADAPTABILITY SEEN IN 25 CRYSTAL FORMS OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/173L", "evidence_id": "EV-PDB-173L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "173L", "doi": "10.1006/jmbi.1995.0396", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/173L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PROTEIN FLEXIBILITY AND ADAPTABILITY SEEN IN 25 CRYSTAL FORMS OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/172L", "evidence_id": "EV-PDB-172L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "172L", "doi": "10.1006/jmbi.1995.0396", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/172L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PROTEIN FLEXIBILITY AND ADAPTABILITY SEEN IN 25 CRYSTAL FORMS OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/171L", "evidence_id": "EV-PDB-171L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "171L", "doi": "10.1006/jmbi.1995.0396", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/171L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PROTEIN FLEXIBILITY AND ADAPTABILITY SEEN IN 25 CRYSTAL FORMS OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/170L", "evidence_id": "EV-PDB-170L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "170L", "doi": "10.1006/jmbi.1995.0396", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/170L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PROTEIN FLEXIBILITY AND ADAPTABILITY SEEN IN 25 CRYSTAL FORMS OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/167L", "evidence_id": "EV-PDB-167L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "167L", "doi": "10.1006/jmbi.1995.0396", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/167L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PROTEIN FLEXIBILITY AND ADAPTABILITY SEEN IN 25 CRYSTAL FORMS OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/166L", "evidence_id": "EV-PDB-166L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "166L", "doi": "10.1006/jmbi.1994.0087", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/166L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTROL OF ENZYME ACTIVITY BY AN ENGINEERED DISULFIDE BOND" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/165L", "evidence_id": "EV-PDB-165L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "165L", "doi": "10.1006/jmbi.1994.0087", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/165L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTROL OF ENZYME ACTIVITY BY AN ENGINEERED DISULFIDE BOND" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "XE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C6H", "evidence_id": "EV-PDB-1C6H-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1C6H", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C6H" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/L99A IN THE PRESENCE OF 4 ATM XENON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AR", "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C6I", "evidence_id": "EV-PDB-1C6I-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1C6I", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C6I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/L99A IN THE PRESENCE OF 8 ATM ARGON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "KR" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C6J", "evidence_id": "EV-PDB-1C6J-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1C6J", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C6J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/L99A IN THE PRESENCE OF 8 ATM KRYPTON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "XE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C6K", "evidence_id": "EV-PDB-1C6K-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1C6K", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C6K" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/L99A IN THE PRESENCE OF 8 ATM XENON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C6L", "evidence_id": "EV-PDB-1C6L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1C6L", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C6L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/L99A/F153A IN THE PRESENCE OF 8 ATM ARGON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "KR" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C6M", "evidence_id": "EV-PDB-1C6M-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1C6M", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C6M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/L99A/F153A IN THE PRESENCE OF 8 ATM KRYPTON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "XE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C6N", "evidence_id": "EV-PDB-1C6N-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "1C6N", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C6N" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/L99A/F153A IN THE PRESENCE OF 8 ATM XENON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C6P", "evidence_id": "EV-PDB-1C6P-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1C6P", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C6P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A IN THE PRESENCE OF 8 ATM ARGON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "KR" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C6Q", "evidence_id": "EV-PDB-1C6Q-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1C6Q", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C6Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A IN THE PRESENCE OF 8 ATM KRYPTON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "XE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C6T", "evidence_id": "EV-PDB-1C6T-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1C6T", "doi": "10.1006/jmbi.2000.4063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C6T" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A IN THE PRESENCE OF 8 ATM XENON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CU0", "evidence_id": "EV-PDB-1CU0-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "1CU0", "doi": "10.1021/bi9915519", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CU0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT I78M" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CU3", "evidence_id": "EV-PDB-1CU3-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.12 }, "provenance": { "deposit_id": "1CU3", "doi": "10.1021/bi9915519", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CU3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT V87M" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CU5", "evidence_id": "EV-PDB-1CU5-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.05 }, "provenance": { "deposit_id": "1CU5", "doi": "10.1021/bi9915519", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CU5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT L91M" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CUP", "evidence_id": "EV-PDB-1CUP-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.89 }, "provenance": { "deposit_id": "1CUP", "doi": "10.1021/bi9915519", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CUP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "METHIONINE CORE MUTANT OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CUQ", "evidence_id": "EV-PDB-1CUQ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.05 }, "provenance": { "deposit_id": "1CUQ", "doi": "10.1021/bi9915519", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CUQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT V103M" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CV0", "evidence_id": "EV-PDB-1CV0-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.12 }, "provenance": { "deposit_id": "1CV0", "doi": "10.1021/bi9915519", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CV0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT F104M" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CV1", "evidence_id": "EV-PDB-1CV1-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1CV1", "doi": "10.1021/bi9915519", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CV1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT V111M" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CV5", "evidence_id": "EV-PDB-1CV5-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.87 }, "provenance": { "deposit_id": "1CV5", "doi": "10.1021/bi9915519", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CV5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT L133M" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CVK", "evidence_id": "EV-PDB-1CVK-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1CVK", "doi": "10.1021/bi9915519", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CVK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT L118A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1D2W", "evidence_id": "EV-PDB-1D2W-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.89 }, "provenance": { "deposit_id": "1D2W", "doi": "10.1006/jmbi.1999.3220", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1D2W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "N-TERMINAL DOMAIN CORE METHIONINE MUTATION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1D3F", "evidence_id": "EV-PDB-1D3F-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.05 }, "provenance": { "deposit_id": "1D3F", "doi": "10.1006/jmbi.1999.3220", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1D3F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "N-TERMINAL DOMAIN CORE METHIONINE MUTATION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1D3J", "evidence_id": "EV-PDB-1D3J-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.97 }, "provenance": { "deposit_id": "1D3J", "doi": "10.1006/jmbi.1999.3220", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1D3J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "N-TERMINAL DOMAIN CORE METHIONINE MUTATION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1D3M", "evidence_id": "EV-PDB-1D3M-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.12 }, "provenance": { "deposit_id": "1D3M", "doi": "10.1006/jmbi.1999.3220", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1D3M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "METHIONINE CORE MUTATION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1DYA", "evidence_id": "EV-PDB-1DYA-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1DYA", "doi": "10.1006/jmbi.1994.1016", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1DYA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DETERMINATION OF ALPHA-HELIX PROPENSITY WITHIN THE CONTEXT OF A FOLDED PROTEIN: SITES 44 AND 131 IN BACTERIOPHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1DYB", "evidence_id": "EV-PDB-1DYB-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "1DYB", "doi": "10.1006/jmbi.1994.1016", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1DYB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DETERMINATION OF ALPHA-HELIX PROPENSITY WITHIN THE CONTEXT OF A FOLDED PROTEIN: SITES 44 AND 131 IN BACTERIOPHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1DYC", "evidence_id": "EV-PDB-1DYC-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1DYC", "doi": "10.1006/jmbi.1994.1016", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1DYC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DETERMINATION OF ALPHA-HELIX PROPENSITY WITHIN THE CONTEXT OF A FOLDED PROTEIN: SITES 44 AND 131 IN BACTERIOPHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1DYD", "evidence_id": "EV-PDB-1DYD-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1DYD", "doi": "10.1006/jmbi.1994.1016", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1DYD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DETERMINATION OF ALPHA-HELIX PROPENSITY WITHIN THE CONTEXT OF A FOLDED PROTEIN: SITES 44 AND 131 IN BACTERIOPHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1DYE", "evidence_id": "EV-PDB-1DYE-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1DYE", "doi": "10.1006/jmbi.1994.1016", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1DYE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DETERMINATION OF ALPHA-HELIX PROPENSITY WITHIN THE CONTEXT OF A FOLDED PROTEIN: SITES 44 AND 131 IN BACTERIOPHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1DYF", "evidence_id": "EV-PDB-1DYF-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1DYF", "doi": "10.1006/jmbi.1994.1016", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1DYF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DETERMINATION OF ALPHA-HELIX PROPENSITY WITHIN THE CONTEXT OF A FOLDED PROTEIN: SITES 44 AND 131 IN BACTERIOPHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CO", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1EPY", "evidence_id": "EV-PDB-1EPY-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1EPY", "doi": "10.1093/protein/13.5.313", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1EPY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT, T21H/C54T/C97A/Q141H/T142H" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1G06", "evidence_id": "EV-PDB-1G06-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1G06", "doi": "10.1110/ps.02101", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1G06" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF T4 LYSOZYME MUTANT V149S" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1G07", "evidence_id": "EV-PDB-1G07-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1G07", "doi": "10.1110/ps.02101", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1G07" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF T4 LYSOZYME MUTANT V149C" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1G0G", "evidence_id": "EV-PDB-1G0G-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1G0G", "doi": "10.1110/ps.02101", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1G0G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF T4 LYSOZYME MUTANT T152A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1G0J", "evidence_id": "EV-PDB-1G0J-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1G0J", "doi": "10.1110/ps.02101", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1G0J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF T4 LYSOZYME MUTANT T152S" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1G0K", "evidence_id": "EV-PDB-1G0K-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1G0K", "doi": "10.1110/ps.02101", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1G0K" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF T4 LYSOZYME MUTANT T152C" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1G0L", "evidence_id": "EV-PDB-1G0L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1G0L", "doi": "10.1110/ps.02101", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1G0L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF T4 LYSOZYME MUTANT T152V" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1G0M", "evidence_id": "EV-PDB-1G0M-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1G0M", "doi": "10.1110/ps.02101", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1G0M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF T4 LYSOZYME MUTANT T152I" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1G0P", "evidence_id": "EV-PDB-1G0P-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1G0P", "doi": "10.1110/ps.02101", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1G0P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF T4 LYSOZYME MUTANT V149G" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1DYG", "evidence_id": "EV-PDB-1DYG-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1DYG", "doi": "10.1006/jmbi.1994.1016", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1DYG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DETERMINATION OF ALPHA-HELIX PROPENSITY WITHIN THE CONTEXT OF A FOLDED PROTEIN: SITES 44 AND 131 IN BACTERIOPHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1D9W", "evidence_id": "EV-PDB-1D9W-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.91 }, "provenance": { "deposit_id": "1D9W", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1D9W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "BACTERIOPHAGE T4 LYSOZYME MUTANT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1D3N", "evidence_id": "EV-PDB-1D3N-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1D3N", "doi": "10.1006/jmbi.1999.3220", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1D3N" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "METHIONINE CORE MUTATION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1D2Y", "evidence_id": "EV-PDB-1D2Y-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.06 }, "provenance": { "deposit_id": "1D2Y", "doi": "10.1006/jmbi.1999.3220", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1D2Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "N-TERMINAL DOMAIN CORE METHIONINE MUTATION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CX7", "evidence_id": "EV-PDB-1CX7-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.94 }, "provenance": { "deposit_id": "1CX7", "doi": "10.1021/bi9915519", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CX7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME METHIONINE CORE MUTANT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CX6", "evidence_id": "EV-PDB-1CX6-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.01 }, "provenance": { "deposit_id": "1CX6", "doi": "10.1006/jmbi.1999.3220", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CX6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME SUBSTITUTED WITH SELENOMETHIONINE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CV6", "evidence_id": "EV-PDB-1CV6-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1CV6", "doi": "10.1021/bi9915519", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CV6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT V149M" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CV4", "evidence_id": "EV-PDB-1CV4-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1CV4", "doi": "10.1021/bi9915519", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CV4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT L118M" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CV3", "evidence_id": "EV-PDB-1CV3-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1CV3", "doi": "10.1021/bi9915519", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CV3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT L121M" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CU6", "evidence_id": "EV-PDB-1CU6-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1CU6", "doi": "10.1021/bi9915519", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CU6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT L91A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CU2", "evidence_id": "EV-PDB-1CU2-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1CU2", "doi": "10.1021/bi9915519", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CU2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT L84M" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1CTW", "evidence_id": "EV-PDB-1CTW-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1CTW", "doi": "10.1021/bi9915519", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1CTW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT I78A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1G1V", "evidence_id": "EV-PDB-1G1V-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1G1V", "doi": "10.1110/ps.02101", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1G1V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/I58T" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1G1W", "evidence_id": "EV-PDB-1G1W-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1G1W", "doi": "10.1110/ps.02101", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1G1W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/Q105M" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.75, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JQU", "evidence_id": "EV-PDB-1JQU-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "1JQU", "doi": "10.1110/ps.39802", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JQU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Are Carboxy Terminii of Helices Coded by the Local Sequence or by Tertiary Structure Contacts" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -103.15 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JTM", "evidence_id": "EV-PDB-1JTM-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1JTM", "doi": "10.1006/jmbi.2001.5376", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JTM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Alternative Structures of a Sequence Extended T4 Lysozyme Show that the Highly Conserved Beta-Sheet has Weak Intrinsic Folding Propensity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -103.15 }, "construct": { "description": "LYSOZYME (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JTN", "evidence_id": "EV-PDB-1JTN-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "1JTN", "doi": "10.1006/jmbi.2001.5376", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JTN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Alternative Structures of a Sequence Extended T4 Lysozyme Show that the Highly Conserved Beta-Sheet Region has weak intrinsic Folding Propensity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1KS3", "evidence_id": "EV-PDB-1KS3-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.16 }, "provenance": { "deposit_id": "1KS3", "doi": "10.1016/S0301-4622(02)00290-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1KS3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "METHIONINE CORE MUTANT OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1KW7", "evidence_id": "EV-PDB-1KW7-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.89 }, "provenance": { "deposit_id": "1KW7", "doi": "10.1016/S0301-4622(02)00290-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1KW7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "METHIONINE CORE MUTANT OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1KY1", "evidence_id": "EV-PDB-1KY1-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.05 }, "provenance": { "deposit_id": "1KY1", "doi": "10.1016/S0301-4622(02)00290-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1KY1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "METHIONINE CORE MUTANT OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L00", "evidence_id": "EV-PDB-1L00-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1L00", "doi": "10.1002/prot.340150407", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L00" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PERTURBATION OF TRP 138 IN T4 LYSOZYME BY MUTATIONS AT GLN 105 USED TO CORRELATE CHANGES IN STRUCTURE, STABILITY, SOLVATION, AND SPECTROSCOPIC PROPERTIES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L01", "evidence_id": "EV-PDB-1L01-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L01", "doi": "10.1016/0022-2836(87)90126-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L01" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL STUDIES OF MUTANTS OF THE LYSOZYME OF BACTERIOPHAGE T4. THE TEMPERATURE-SENSITIVE MUTANT PROTEIN THR157 (RIGHT ARROW) ILE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L05", "evidence_id": "EV-PDB-1L05-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L05", "doi": "10.1038/330041a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L05" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L10", "evidence_id": "EV-PDB-1L10-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L10", "doi": "10.1016/0022-2836(87)90126-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L10" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL STUDIES OF MUTANTS OF THE LYSOZYME OF BACTERIOPHAGE T4. THE TEMPERATURE-SENSITIVE MUTANT PROTEIN THR157 (RIGHT ARROW) ILE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L11", "evidence_id": "EV-PDB-1L11-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L11", "doi": "10.1038/330041a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L11" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L12", "evidence_id": "EV-PDB-1L12-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L12", "doi": "10.1038/330041a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L12" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L13", "evidence_id": "EV-PDB-1L13-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L13", "doi": "10.1038/330041a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L13" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L14", "evidence_id": "EV-PDB-1L14-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L14", "doi": "10.1038/330041a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L14" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L15", "evidence_id": "EV-PDB-1L15-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L15", "doi": "10.1038/330041a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L15" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L16", "evidence_id": "EV-PDB-1L16-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L16", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L16" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL ANALYSIS OF THE TEMPERATURE-SENSITIVE MUTANT OF BACTERIOPHAGE T4 LYSOZYME, GLYCINE 156 (RIGHT ARROW) ASPARTIC ACID" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L17", "evidence_id": "EV-PDB-1L17-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L17", "doi": "10.1038/334406a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L17" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HYDROPHOBIC STABILIZATION IN T4 LYSOZYME DETERMINED DIRECTLY BY MULTIPLE SUBSTITUTIONS OF ILE 3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L19", "evidence_id": "EV-PDB-1L19-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L19", "doi": "10.1038/336651a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L19" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ENHANCED PROTEIN THERMOSTABILITY FROM DESIGNED MUTATIONS THAT INTERACT WITH ALPHA-HELIX DIPOLES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L20", "evidence_id": "EV-PDB-1L20-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1L20", "doi": "10.1038/336651a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L20" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ENHANCED PROTEIN THERMOSTABILITY FROM DESIGNED MUTATIONS THAT INTERACT WITH ALPHA-HELIX DIPOLES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L21", "evidence_id": "EV-PDB-1L21-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1L21", "doi": "10.1016/0022-2836(89)90299-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L21" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTRIBUTIONS OF LEFT-HANDED HELICAL RESIDUES TO THE STRUCTURE AND STABILITY OF BACTERIOPHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L22", "evidence_id": "EV-PDB-1L22-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L22", "doi": "10.1016/0022-2836(89)90299-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L22" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTRIBUTIONS OF LEFT-HANDED HELICAL RESIDUES TO THE STRUCTURE AND STABILITY OF BACTERIOPHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L23", "evidence_id": "EV-PDB-1L23-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L23", "doi": "10.1073/pnas.84.19.6663", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L23" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ENHANCED PROTEIN THERMOSTABILITY FROM SITE-DIRECTED MUTATIONS THAT DECREASE THE ENTROPY OF UNFOLDING" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L24", "evidence_id": "EV-PDB-1L24-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L24", "doi": "10.1073/pnas.84.19.6663", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L24" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ENHANCED PROTEIN THERMOSTABILITY FROM SITE-DIRECTED MUTATIONS THAT DECREASE THE ENTROPY OF UNFOLDING" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L26", "evidence_id": "EV-PDB-1L26-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L26", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L26" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "REPLACEMENTS OF PRO86 IN PHAGE T4 LYSOZYME EXTEND AN ALPHA-HELIX BUT DO NOT ALTER PROTEIN STABILITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L27", "evidence_id": "EV-PDB-1L27-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1L27", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L27" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "REPLACEMENTS OF PRO86 IN PHAGE T4 LYSOZYME EXTEND AN ALPHA-HELIX BUT DO NOT ALTER PROTEIN STABILITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L28", "evidence_id": "EV-PDB-1L28-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1L28", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L28" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "REPLACEMENTS OF PRO86 IN PHAGE T4 LYSOZYME EXTEND AN ALPHA-HELIX BUT DO NOT ALTER PROTEIN STABILITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L29", "evidence_id": "EV-PDB-1L29-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L29", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L29" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "REPLACEMENTS OF PRO86 IN PHAGE T4 LYSOZYME EXTEND AN ALPHA-HELIX BUT DO NOT ALTER PROTEIN STABILITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L30", "evidence_id": "EV-PDB-1L30-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L30", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L30" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "REPLACEMENTS OF PRO86 IN PHAGE T4 LYSOZYME EXTEND AN ALPHA-HELIX BUT DO NOT ALTER PROTEIN STABILITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L32", "evidence_id": "EV-PDB-1L32-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L32", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L32" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "REPLACEMENTS OF PRO86 IN PHAGE T4 LYSOZYME EXTEND AN ALPHA-HELIX BUT DO NOT ALTER PROTEIN STABILITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L33", "evidence_id": "EV-PDB-1L33-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L33", "doi": "10.1016/0022-2836(89)90299-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L33" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTRIBUTIONS OF LEFT-HANDED HELICAL RESIDUES TO THE STRUCTURE AND STABILITY OF BACTERIOPHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L34", "evidence_id": "EV-PDB-1L34-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1L34", "doi": "10.1021/bi00435a025", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L34" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HIGH-RESOLUTION STRUCTURE OF THE TEMPERATURE-SENSITIVE MUTANT OF PHAGE LYSOZYME, ARG 96 (RIGHT ARROW) HIS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L31", "evidence_id": "EV-PDB-1L31-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1L31", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L31" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "REPLACEMENTS OF PRO86 IN PHAGE T4 LYSOZYME EXTEND AN ALPHA-HELIX BUT DO NOT ALTER PROTEIN STABILITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L25", "evidence_id": "EV-PDB-1L25-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1L25", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L25" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "REPLACEMENTS OF PRO86 IN PHAGE T4 LYSOZYME EXTEND AN ALPHA-HELIX BUT DO NOT ALTER PROTEIN STABILITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L18", "evidence_id": "EV-PDB-1L18-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L18", "doi": "10.1038/334406a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L18" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HYDROPHOBIC STABILIZATION IN T4 LYSOZYME DETERMINED DIRECTLY BY MULTIPLE SUBSTITUTIONS OF ILE 3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L0K", "evidence_id": "EV-PDB-1L0K-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.02 }, "provenance": { "deposit_id": "1L0K", "doi": "10.1016/S0301-4622(02)00290-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L0K" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "METHIONINE CORE MUTANT OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L0J", "evidence_id": "EV-PDB-1L0J-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.98 }, "provenance": { "deposit_id": "1L0J", "doi": "10.1016/S0301-4622(02)00290-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L0J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "METHIONINE CORE MUTANT OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L09", "evidence_id": "EV-PDB-1L09-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L09", "doi": "10.1038/330041a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L09" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L08", "evidence_id": "EV-PDB-1L08-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L08", "doi": "10.1038/330041a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L08" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L07", "evidence_id": "EV-PDB-1L07-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L07", "doi": "10.1038/330041a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L07" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L06", "evidence_id": "EV-PDB-1L06-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L06", "doi": "10.1038/330041a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L06" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L04", "evidence_id": "EV-PDB-1L04-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L04", "doi": "10.1038/330041a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L04" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L03", "evidence_id": "EV-PDB-1L03-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L03", "doi": "10.1038/330041a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L03" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L02", "evidence_id": "EV-PDB-1L02-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L02", "doi": "10.1038/330041a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L02" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTRIBUTIONS OF HYDROGEN BONDS OF THR 157 TO THE THERMODYNAMIC STABILITY OF PHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1KY0", "evidence_id": "EV-PDB-1KY0-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.97 }, "provenance": { "deposit_id": "1KY0", "doi": "10.1016/S0301-4622(02)00290-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1KY0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "METHIONINE CORE MUTANT OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1KW5", "evidence_id": "EV-PDB-1KW5-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "1KW5", "doi": "10.1016/S0301-4622(02)00290-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1KW5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "METHIONINE CORE MUTANT OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1KNI", "evidence_id": "EV-PDB-1KNI-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1KNI", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1KNI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Stabilizing Disulfide Bridge Mutant of T4 Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1I6S", "evidence_id": "EV-PDB-1I6S-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1I6S", "doi": "10.1110/ps.02101", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1I6S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT C54T/C97A/N101A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1G0Q", "evidence_id": "EV-PDB-1G0Q-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1G0Q", "doi": "10.1110/ps.02101", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1G0Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF T4 LYSOZYME MUTANT V149I" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L35", "evidence_id": "EV-PDB-1L35-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1L35", "doi": "10.1021/bi00462a023", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L35" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURE OF A THERMOSTABLE DISULFIDE-BRIDGE MUTANT OF PHAGE T4 LYSOZYME SHOWS THAT AN ENGINEERED CROSSLINK IN A FLEXIBLE REGION DOES NOT INCREASE THE RIGIDITY OF THE FOLDED PROTEIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L36", "evidence_id": "EV-PDB-1L36-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L36", "doi": "10.1021/bi00222a001", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L36" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "TOWARD A SIMPLIFICATION OF THE PROTEIN FOLDING PROBLEM: A STABILIZING POLYALANINE ALPHA-HELIX ENGINEERED IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L37", "evidence_id": "EV-PDB-1L37-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1L37", "doi": "10.1021/bi00243a015", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L37" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTRIBUTIONS OF ENGINEERED SURFACE SALT BRIDGES TO THE STABILITY OF T4 LYSOZYME DETERMINED BY DIRECTED MUTAGENESIS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L38", "evidence_id": "EV-PDB-1L38-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1L38", "doi": "10.1021/bi00243a015", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L38" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTRIBUTIONS OF ENGINEERED SURFACE SALT BRIDGES TO THE STABILITY OF T4 LYSOZYME DETERMINED BY DIRECTED MUTAGENESIS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L39", "evidence_id": "EV-PDB-1L39-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1L39", "doi": "10.1021/bi00243a015", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L39" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTRIBUTIONS OF ENGINEERED SURFACE SALT BRIDGES TO THE STABILITY OF T4 LYSOZYME DETERMINED BY DIRECTED MUTAGENESIS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L40", "evidence_id": "EV-PDB-1L40-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1L40", "doi": "10.1021/bi00243a015", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L40" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTRIBUTIONS OF ENGINEERED SURFACE SALT BRIDGES TO THE STABILITY OF T4 LYSOZYME DETERMINED BY DIRECTED MUTAGENESIS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L41", "evidence_id": "EV-PDB-1L41-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "1L41", "doi": "10.1021/bi00243a015", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L41" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CONTRIBUTIONS OF ENGINEERED SURFACE SALT BRIDGES TO THE STABILITY OF T4 LYSOZYME DETERMINED BY DIRECTED MUTAGENESIS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L42", "evidence_id": "EV-PDB-1L42-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1L42", "doi": "10.1016/0022-2836(91)80181-S", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L42" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CUMULATIVE SITE-DIRECTED CHARGE-CHANGE REPLACEMENTS IN BACTERIOPHAGE T4 LYSOZYME SUGGEST THAT LONG-RANGE ELECTROSTATIC INTERACTIONS CONTRIBUTE LITTLE TO PROTEIN STABILITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L43", "evidence_id": "EV-PDB-1L43-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1L43", "doi": "10.1016/0022-2836(91)80181-S", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L43" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CUMULATIVE SITE-DIRECTED CHARGE-CHANGE REPLACEMENTS IN BACTERIOPHAGE T4 LYSOZYME SUGGEST THAT LONG-RANGE ELECTROSTATIC INTERACTIONS CONTRIBUTE LITTLE TO PROTEIN STABILITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L44", "evidence_id": "EV-PDB-1L44-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L44", "doi": "10.1016/0022-2836(91)80181-S", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L44" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CUMULATIVE SITE-DIRECTED CHARGE-CHANGE REPLACEMENTS IN BACTERIOPHAGE T4 LYSOZYME SUGGEST THAT LONG-RANGE ELECTROSTATIC INTERACTIONS CONTRIBUTE LITTLE TO PROTEIN STABILITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L45", "evidence_id": "EV-PDB-1L45-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L45", "doi": "10.1016/0022-2836(91)80181-S", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L45" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CUMULATIVE SITE-DIRECTED CHARGE-CHANGE REPLACEMENTS IN BACTERIOPHAGE T4 LYSOZYME SUGGEST THAT LONG-RANGE ELECTROSTATIC INTERACTIONS CONTRIBUTE LITTLE TO PROTEIN STABILITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L46", "evidence_id": "EV-PDB-1L46-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L46", "doi": "10.1016/0022-2836(91)80181-S", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L46" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CUMULATIVE SITE-DIRECTED CHARGE-CHANGE REPLACEMENTS IN BACTERIOPHAGE T4 LYSOZYME SUGGEST THAT LONG-RANGE ELECTROSTATIC INTERACTIONS CONTRIBUTE LITTLE TO PROTEIN STABILITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L47", "evidence_id": "EV-PDB-1L47-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L47", "doi": "10.1016/0022-2836(91)80181-S", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L47" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CUMULATIVE SITE-DIRECTED CHARGE-CHANGE REPLACEMENTS IN BACTERIOPHAGE T4 LYSOZYME SUGGEST THAT LONG-RANGE ELECTROSTATIC INTERACTIONS CONTRIBUTE LITTLE TO PROTEIN STABILITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L48", "evidence_id": "EV-PDB-1L48-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L48", "doi": "10.1016/0022-2836(91)80079-A", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L48" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL AND THERMODYNAMIC ANALYSIS OF THE PACKING OF TWO ALPHA-HELICES IN BACTERIOPHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L49", "evidence_id": "EV-PDB-1L49-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1L49", "doi": "10.1016/0022-2836(91)80079-A", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L49" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL AND THERMODYNAMIC ANALYSIS OF THE PACKING OF TWO ALPHA-HELICES IN BACTERIOPHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L50", "evidence_id": "EV-PDB-1L50-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1L50", "doi": "10.1016/0022-2836(91)80079-A", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L50" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL AND THERMODYNAMIC ANALYSIS OF THE PACKING OF TWO ALPHA-HELICES IN BACTERIOPHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L51", "evidence_id": "EV-PDB-1L51-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1L51", "doi": "10.1016/0022-2836(91)80079-A", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L51" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL AND THERMODYNAMIC ANALYSIS OF THE PACKING OF TWO ALPHA-HELICES IN BACTERIOPHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L52", "evidence_id": "EV-PDB-1L52-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L52", "doi": "10.1016/0022-2836(91)80079-A", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L52" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL AND THERMODYNAMIC ANALYSIS OF THE PACKING OF TWO ALPHA-HELICES IN BACTERIOPHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L53", "evidence_id": "EV-PDB-1L53-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1L53", "doi": "10.1016/0022-2836(91)80079-A", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L53" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL AND THERMODYNAMIC ANALYSIS OF THE PACKING OF TWO ALPHA-HELICES IN BACTERIOPHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L54", "evidence_id": "EV-PDB-1L54-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1L54", "doi": "10.1021/bi00113a006", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L54" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE STRUCTURAL AND THERMODYNAMIC CONSEQUENCES OF BURYING A CHARGED RESIDUE WITHIN THE HYDROPHOBIC CORE OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L55", "evidence_id": "EV-PDB-1L55-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1L55", "doi": "10.1021/bi00105a002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L55" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ANALYSIS OF THE INTERACTION BETWEEN CHARGED SIDE CHAINS AND THE ALPHA-HELIX DIPOLE USING DESIGNED THERMOSTABLE MUTANTS OF PHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L56", "evidence_id": "EV-PDB-1L56-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1L56", "doi": "10.1002/bip.360321103", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L56" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ANALYSIS OF THE INTERACTION BETWEEN CHARGED SIDE CHAINS AND THE ALPHA-HELIX DIPOLE USING DESIGNED THERMOSTABLE MUTANTS OF PHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L57", "evidence_id": "EV-PDB-1L57-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1L57", "doi": "10.1021/bi00105a002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L57" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ANALYSIS OF THE INTERACTION BETWEEN CHARGED SIDE CHAINS AND THE ALPHA-HELIX DIPOLE USING DESIGNED THERMOSTABLE MUTANTS OF PHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L58", "evidence_id": "EV-PDB-1L58-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "1L58", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L58" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ANALYSIS OF THE INTERACTION BETWEEN CHARGED SIDE CHAINS AND THE ALPHA-HELIX DIPOLE USING DESIGNED THERMOSTABLE MUTANTS OF PHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L59", "evidence_id": "EV-PDB-1L59-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "1L59", "doi": "10.1021/bi00105a002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L59" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ANALYSIS OF THE INTERACTION BETWEEN CHARGED SIDE CHAINS AND THE ALPHA-HELIX DIPOLE USING DESIGNED THERMOSTABLE MUTANTS OF PHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L60", "evidence_id": "EV-PDB-1L60-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L60", "doi": "10.1002/bip.360321103", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L60" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ANALYSIS OF THE INTERACTION BETWEEN CHARGED SIDE CHAINS AND THE ALPHA-HELIX DIPOLE USING DESIGNED THERMOSTABLE MUTANTS OF PHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L61", "evidence_id": "EV-PDB-1L61-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1L61", "doi": "10.1021/bi00105a002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L61" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ANALYSIS OF THE INTERACTION BETWEEN CHARGED SIDE CHAINS AND THE ALPHA-HELIX DIPOLE USING DESIGNED THERMOSTABLE MUTANTS OF PHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L62", "evidence_id": "EV-PDB-1L62-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L62", "doi": "10.1021/bi00105a002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L62" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ANALYSIS OF THE INTERACTION BETWEEN CHARGED SIDE CHAINS AND THE ALPHA-HELIX DIPOLE USING DESIGNED THERMOSTABLE MUTANTS OF PHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L63", "evidence_id": "EV-PDB-1L63-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "1L63", "doi": "10.1021/bi00105a002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L63" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ANALYSIS OF THE INTERACTION BETWEEN CHARGED SIDE CHAINS AND THE ALPHA-HELIX DIPOLE USING DESIGNED THERMOSTABLE MUTANTS OF PHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L64", "evidence_id": "EV-PDB-1L64-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1L64", "doi": "10.1073/pnas.89.9.3751", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L64" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "TOLERANCE OF T4 LYSOZYME TO MULTIPLE XAA (RIGHT ARROW) ALA SUBSTITUTIONS: A POLYALANINE ALPHA-HELIX CONTAINING TEN CONSECUTIVE ALANINES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L65", "evidence_id": "EV-PDB-1L65-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L65", "doi": "10.1073/pnas.89.9.3751", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L65" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "TOLERANCE OF T4 LYSOZYME TO MULTIPLE XAA (RIGHT ARROW) ALA SUBSTITUTIONS: A POLYALANINE ALPHA-HELIX CONTAINING TEN CONSECUTIVE ALANINES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L66", "evidence_id": "EV-PDB-1L66-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L66", "doi": "10.1073/pnas.89.9.3751", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L66" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "TOLERANCE OF T4 LYSOZYME TO MULTIPLE XAA (RIGHT ARROW) ALA SUBSTITUTIONS: A POLYALANINE ALPHA-HELIX CONTAINING TEN CONSECUTIVE ALANINES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L67", "evidence_id": "EV-PDB-1L67-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1L67", "doi": "10.1073/pnas.89.9.3751", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L67" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "TOLERANCE OF T4 LYSOZYME TO MULTIPLE XAA (RIGHT ARROW) ALA SUBSTITUTIONS: A POLYALANINE ALPHA-HELIX CONTAINING TEN CONSECUTIVE ALANINES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L68", "evidence_id": "EV-PDB-1L68-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L68", "doi": "10.1073/pnas.89.9.3751", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L68" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "TOLERANCE OF T4 LYSOZYME TO MULTIPLE XAA (RIGHT ARROW) ALA SUBSTITUTIONS: A POLYALANINE ALPHA-HELIX CONTAINING TEN CONSECUTIVE ALANINES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L69", "evidence_id": "EV-PDB-1L69-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1L69", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L69" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "MULTIPLE STABILIZING ALANINE REPLACEMENTS WITHIN ALPHA-HELIX 126-134 OF T4 LYSOZYME HAVE INDEPENDENT, ADDITIVE EFFECTS ON BOTH STRUCTURE AND STABILITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L70", "evidence_id": "EV-PDB-1L70-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1L70", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L70" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "MULTIPLE STABILIZING ALANINE REPLACEMENTS WITHIN ALPHA-HELIX 126-134 OF T4 LYSOZYME HAVE INDEPENDENT, ADDITIVE EFFECTS ON BOTH STRUCTURE AND STABILITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L71", "evidence_id": "EV-PDB-1L71-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1L71", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L71" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "MULTIPLE STABILIZING ALANINE REPLACEMENTS WITHIN ALPHA-HELIX 126-134 OF T4 LYSOZYME HAVE INDEPENDENT, ADDITIVE EFFECTS ON BOTH STRUCTURE AND STABILITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L72", "evidence_id": "EV-PDB-1L72-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1L72", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L72" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "MULTIPLE STABILIZING ALANINE REPLACEMENTS WITHIN ALPHA-HELIX 126-134 OF T4 LYSOZYME HAVE INDEPENDENT, ADDITIVE EFFECTS ON BOTH STRUCTURE AND STABILITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L73", "evidence_id": "EV-PDB-1L73-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.05 }, "provenance": { "deposit_id": "1L73", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L73" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "MULTIPLE STABILIZING ALANINE REPLACEMENTS WITHIN ALPHA-HELIX 126-134 OF T4 LYSOZYME HAVE INDEPENDENT, ADDITIVE EFFECTS ON BOTH STRUCTURE AND STABILITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L74", "evidence_id": "EV-PDB-1L74-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L74", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L74" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "MULTIPLE STABILIZING ALANINE REPLACEMENTS WITHIN ALPHA-HELIX 126-134 OF T4 LYSOZYME HAVE INDEPENDENT, ADDITIVE EFFECTS ON BOTH STRUCTURE AND STABILITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L75", "evidence_id": "EV-PDB-1L75-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1L75", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L75" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "MULTIPLE STABILIZING ALANINE REPLACEMENTS WITHIN ALPHA-HELIX 126-134 OF T4 LYSOZYME HAVE INDEPENDENT, ADDITIVE EFFECTS ON BOTH STRUCTURE AND STABILITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L76", "evidence_id": "EV-PDB-1L76-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1L76", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L76" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "TOLERANCE OF T4 LYSOZYME TO PROLINE SUBSTITUTIONS WITHIN THE LONG INTERDOMAIN ALPHA-HELIX ILLUSTRATES THE ADAPTABILITY OF PROTEINS TO POTENTIALLY DESTABILIZING LESIONS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L77", "evidence_id": "EV-PDB-1L77-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.05 }, "provenance": { "deposit_id": "1L77", "doi": "10.1016/0022-2836(92)90475-Y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L77" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DESIGN AND STRUCTURAL ANALYSIS OF ALTERNATIVE HYDROPHOBIC CORE PACKING ARRANGEMENTS IN BACTERIOPHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L79", "evidence_id": "EV-PDB-1L79-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1L79", "doi": "10.1016/0022-2836(92)90475-Y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L79" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DESIGN AND STRUCTURAL ANALYSIS OF ALTERNATIVE HYDROPHOBIC CORE PACKING ARRANGEMENTS IN BACTERIOPHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L80", "evidence_id": "EV-PDB-1L80-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1L80", "doi": "10.1016/0022-2836(92)90475-Y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L80" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DESIGN AND STRUCTURAL ANALYSIS OF ALTERNATIVE HYDROPHOBIC CORE PACKING ARRANGEMENTS IN BACTERIOPHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L81", "evidence_id": "EV-PDB-1L81-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1L81", "doi": "10.1016/0022-2836(92)90475-Y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L81" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DESIGN AND STRUCTURAL ANALYSIS OF ALTERNATIVE HYDROPHOBIC CORE PACKING ARRANGEMENTS IN BACTERIOPHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L82", "evidence_id": "EV-PDB-1L82-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1L82", "doi": "10.1016/0022-2836(92)90475-Y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L82" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DESIGN AND STRUCTURAL ANALYSIS OF ALTERNATIVE HYDROPHOBIC CORE PACKING ARRANGEMENTS IN BACTERIOPHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "BNZ", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L83", "evidence_id": "EV-PDB-1L83-1", "mappings": [ { "confidence": "high", "justification": "L99A cavity with buried benzene; representative for the benzene-bound state.", "rule": "curator_assignment", "state_id": "T4L-L99A-benzene", "who": "curator:draft (unreviewed)" } ], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L83", "doi": "10.1038/355371a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L83" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "A CAVITY-CONTAINING MUTANT OF T4 LYSOZYME IS STABILIZED BY BURIED BENZENE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "BNZ", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L84", "evidence_id": "EV-PDB-1L84-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1L84", "doi": "10.1038/355371a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L84" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "A CAVITY-CONTAINING MUTANT OF T4 LYSOZYME IS STABILIZED BY BURIED BENZENE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L85", "evidence_id": "EV-PDB-1L85-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1L85", "doi": "10.1006/jmbi.1993.1077", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L85" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SIMILAR HYDROPHOBIC REPLACEMENTS OF LEU 99 AND PHE 153 WITHIN THE CORE OF T4 LYSOZYME HAVE DIFFERENT STRUCTURAL AND THERMODYNAMIC CONSEQUENCES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L88", "evidence_id": "EV-PDB-1L88-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1L88", "doi": "10.1006/jmbi.1993.1077", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L88" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SIMILAR HYDROPHOBIC REPLACEMENTS OF LEU 99 AND PHE 153 WITHIN THE CORE OF T4 LYSOZYME HAVE DIFFERENT STRUCTURAL AND THERMODYNAMIC CONSEQUENCES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L90", "evidence_id": "EV-PDB-1L90-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "1L90", "doi": "10.1006/jmbi.1993.1077", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L90" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SIMILAR HYDROPHOBIC REPLACEMENTS OF LEU 99 AND PHE 153 WITHIN THE CORE OF T4 LYSOZYME HAVE DIFFERENT STRUCTURAL AND THERMODYNAMIC CONSEQUENCES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L91", "evidence_id": "EV-PDB-1L91-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1L91", "doi": "10.1006/jmbi.1993.1077", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L91" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SIMILAR HYDROPHOBIC REPLACEMENTS OF LEU 99 AND PHE 153 WITHIN THE CORE OF T4 LYSOZYME HAVE DIFFERENT STRUCTURAL AND THERMODYNAMIC CONSEQUENCES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L93", "evidence_id": "EV-PDB-1L93-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1L93", "doi": "10.1006/jmbi.1993.1077", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L93" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SIMILAR HYDROPHOBIC REPLACEMENTS OF LEU 99 AND PHE 153 WITHIN THE CORE OF T4 LYSOZYME HAVE DIFFERENT STRUCTURAL AND THERMODYNAMIC CONSEQUENCES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L94", "evidence_id": "EV-PDB-1L94-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1L94", "doi": "10.1006/jmbi.1993.1077", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L94" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SIMILAR HYDROPHOBIC REPLACEMENTS OF LEU 99 AND PHE 153 WITHIN THE CORE OF T4 LYSOZYME HAVE DIFFERENT STRUCTURAL AND THERMODYNAMIC CONSEQUENCES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L95", "evidence_id": "EV-PDB-1L95-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1L95", "doi": "10.1006/jmbi.1993.1077", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L95" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SIMILAR HYDROPHOBIC REPLACEMENTS OF LEU 99 AND PHE 153 WITHIN THE CORE OF T4 LYSOZYME HAVE DIFFERENT STRUCTURAL AND THERMODYNAMIC CONSEQUENCES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L97", "evidence_id": "EV-PDB-1L97-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1L97", "doi": "10.1016/0022-2836(92)90231-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L97" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURE OF A HINGE-BENDING BACTERIOPHAGE T4 LYSOZYME MUTANT, ILE3-> PRO" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L98", "evidence_id": "EV-PDB-1L98-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1L98", "doi": "10.1002/prot.340150407", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L98" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PERTURBATION OF TRP 138 IN T4 LYSOZYME BY MUTATIONS AT GLN 105 USED TO CORRELATE CHANGES IN STRUCTURE, STABILITY, SOLVATION, AND SPECTROSCOPIC PROPERTIES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "5AN", "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LGX", "evidence_id": "EV-PDB-1LGX-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1LGX", "doi": "10.1016/S0022-2836(02)00777-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LGX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme Mutant L99A/M102Q Bound by 3,5-difluoroaniline" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "IPH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LI2", "evidence_id": "EV-PDB-1LI2-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1LI2", "doi": "10.1016/S0022-2836(02)00777-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LI2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme Mutant L99A/M102Q Bound by Phenol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "3CH", "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LI3", "evidence_id": "EV-PDB-1LI3-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1LI3", "doi": "10.1016/S0022-2836(02)00777-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LI3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme mutant L99A/M102Q bound by 3-chlorophenol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "5MP", "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LI6", "evidence_id": "EV-PDB-1LI6-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1LI6", "doi": "10.1016/S0022-2836(02)00777-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LI6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme mutant L99A/M102Q bound by 5-methylpyrrole" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.8, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LLH", "evidence_id": "EV-PDB-1LLH-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1LLH", "doi": "10.1110/ps.39802", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LLH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ARE CARBOXY TERMINII OF HELICES CODED BY THE LOCAL SEQUENCE OR BY TERTIARY STRUCTURE CONTACTS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LPY", "evidence_id": "EV-PDB-1LPY-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "1LPY", "doi": "10.1016/S0301-4622(02)00290-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LPY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Multiple Methionine Substitutions in T4 Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LW9", "evidence_id": "EV-PDB-1LW9-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "1LW9", "doi": "10.1016/S0301-4622(02)00290-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LW9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Multiple methionine substitutions are tolerated in T4 lysozyme and have coupled effects on folding and stability" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED", "K", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -100.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LWG", "evidence_id": "EV-PDB-1LWG-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1LWG", "doi": "10.1016/S0301-4622(02)00290-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LWG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Multiple Methionine Substitutions are Tolerated in T4 Lysozyme and have Coupled Effects on Folding and Stability" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -100.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LWK", "evidence_id": "EV-PDB-1LWK-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1LWK", "doi": "10.1016/S0301-4622(02)00290-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LWK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Multiple Methionine Substitutions are Tolerated in T4 Lysozyme and have Coupled Effects on Folding and Stability" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LYE", "evidence_id": "EV-PDB-1LYE-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1LYE", "doi": "10.1021/bi00129a006", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LYE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DISSECTION OF HELIX CAPPING IN T4 LYSOZYME BY STRUCTURAL AND THERMODYNAMIC ANALYSIS OF SIX AMINO ACID SUBSTITUTIONS AT THR 59" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LYF", "evidence_id": "EV-PDB-1LYF-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1LYF", "doi": "10.1021/bi00129a006", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LYF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DISSECTION OF HELIX CAPPING IN T4 LYSOZYME BY STRUCTURAL AND THERMODYNAMIC ANALYSIS OF SIX AMINO ACID SUBSTITUTIONS AT THR 59" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LYG", "evidence_id": "EV-PDB-1LYG-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1LYG", "doi": "10.1021/bi00129a006", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LYG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DISSECTION OF HELIX CAPPING IN T4 LYSOZYME BY STRUCTURAL AND THERMODYNAMIC ANALYSIS OF SIX AMINO ACID SUBSTITUTIONS AT THR 59" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LYH", "evidence_id": "EV-PDB-1LYH-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1LYH", "doi": "10.1021/bi00129a006", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LYH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DISSECTION OF HELIX CAPPING IN T4 LYSOZYME BY STRUCTURAL AND THERMODYNAMIC ANALYSIS OF SIX AMINO ACID SUBSTITUTIONS AT THR 59" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LYI", "evidence_id": "EV-PDB-1LYI-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1LYI", "doi": "10.1021/bi00129a006", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LYI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DISSECTION OF HELIX CAPPING IN T4 LYSOZYME BY STRUCTURAL AND THERMODYNAMIC ANALYSIS OF SIX AMINO ACID SUBSTITUTIONS AT THR 59" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LYJ", "evidence_id": "EV-PDB-1LYJ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1LYJ", "doi": "10.1021/bi00129a006", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LYJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DISSECTION OF HELIX CAPPING IN T4 LYSOZYME BY STRUCTURAL AND THERMODYNAMIC ANALYSIS OF SIX AMINO ACID SUBSTITUTIONS AT THR 59" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED", "PYJ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1NHB", "evidence_id": "EV-PDB-1NHB-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1NHB", "doi": "10.1021/bi00027a007", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1NHB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Specificity of ligand binding in a buried non-polar cavity of t4 lysozyme: linkage of dynamics and structural plasticity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "2LP", "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1OV5", "evidence_id": "EV-PDB-1OV5-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1OV5", "doi": "10.1016/j.jmb.2004.02.015", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1OV5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme Cavity Mutant L99a/M102Q Bound With 2-Allylphenol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "LYL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1OV7", "evidence_id": "EV-PDB-1OV7-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1OV7", "doi": "10.1016/j.jmb.2004.02.015", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1OV7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme Cavity Mutant L99A/M102Q Bound with 2-Allyl-6-Methyl-Phenol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "2CM", "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1OVH", "evidence_id": "EV-PDB-1OVH-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "1OVH", "doi": "10.1016/j.jmb.2004.02.015", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1OVH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme Cavity Mutant L99A/M102Q Bound With 2-Chloro-6-Methyl-Aniline" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "FLM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1OVJ", "evidence_id": "EV-PDB-1OVJ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1OVJ", "doi": "10.1016/j.jmb.2004.02.015", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1OVJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme Cavity Mutant L99A/M102Q Bound with 3-Fluoro-2-Methyl_Aniline" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "NYL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1OVK", "evidence_id": "EV-PDB-1OVK-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1OVK", "doi": "10.1016/j.jmb.2004.02.015", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1OVK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme Cavity Mutant L99A/M102Q Bound with N-Allyl-Aniline" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "4FA", "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1OWZ", "evidence_id": "EV-PDB-1OWZ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1OWZ", "doi": "10.1016/j.jmb.2004.02.015", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1OWZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme Cavity Mutant L99A/M102Q Bound With 4-FluoroPhenEthyl Alcohol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -103.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1OYU", "evidence_id": "EV-PDB-1OYU-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "1OYU", "doi": "10.1073/pnas.1633549100", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1OYU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Long-Distance conformational changes in a protein engineered by modulated sequence duplication" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED", "K", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1P2L", "evidence_id": "EV-PDB-1P2L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.58 }, "provenance": { "deposit_id": "1P2L", "doi": "10.1016/S0022-2836(03)00856-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1P2L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme Core Repacking Mutant V87I/TA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1P2R", "evidence_id": "EV-PDB-1P2R-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.58 }, "provenance": { "deposit_id": "1P2R", "doi": "10.1016/S0022-2836(03)00856-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1P2R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME CORE REPACKING MUTANT I78V/TA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1P36", "evidence_id": "EV-PDB-1P36-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "1P36", "doi": "10.1016/S0022-2836(03)00856-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1P36" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYOSZYME CORE REPACKING MUTANT I100V/TA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1P37", "evidence_id": "EV-PDB-1P37-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.57 }, "provenance": { "deposit_id": "1P37", "doi": "10.1016/S0022-2836(03)00856-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1P37" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME CORE REPACKING BACK-REVERTANT L102M/CORE10" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED", "K", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1P3N", "evidence_id": "EV-PDB-1P3N-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "1P3N", "doi": "10.1016/S0022-2836(03)00856-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1P3N" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CORE REDESIGN BACK-REVERTANT I103V/CORE10" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1P46", "evidence_id": "EV-PDB-1P46-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.67 }, "provenance": { "deposit_id": "1P46", "doi": "10.1016/S0022-2836(03)00856-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1P46" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme core repacking mutant M106I/TA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -103.15 }, "construct": { "description": "PROTEIN (Lysozyme) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1P56", "evidence_id": "EV-PDB-1P56-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1P56", "doi": "10.1021/bi035702q", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1P56" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Duplication-extension of Helix A of T4 lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": -103.15 }, "construct": { "description": "Lysozyme (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1P5C", "evidence_id": "EV-PDB-1P5C-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "1P5C", "doi": "10.1021/bi035702q", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1P5C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Circular permutation of Helix A in T4 lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1P64", "evidence_id": "EV-PDB-1P64-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.62 }, "provenance": { "deposit_id": "1P64", "doi": "10.1016/S0022-2836(03)00856-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1P64" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME CORE REPACKING MUTANT L133F/TA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "PRY" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1OWY", "evidence_id": "EV-PDB-1OWY-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1OWY", "doi": "10.1016/j.jmb.2004.02.015", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1OWY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme Cavity Mutant L99A/M102Q Bound With 2-Propyl-Aniline" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LYD", "evidence_id": "EV-PDB-1LYD-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1LYD", "doi": "10.1093/protein/2.4.277", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LYD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF T4-LYSOZYME GENERATED FROM SYNTHETIC CODING DNA EXPRESSED IN ESCHERICHIA COLI" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1AN", "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LGW", "evidence_id": "EV-PDB-1LGW-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1LGW", "doi": "10.1016/S0022-2836(02)00777-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LGW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme Mutant L99A/M102Q Bound by 2-fluoroaniline" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LGU", "evidence_id": "EV-PDB-1LGU-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1LGU", "doi": "10.1016/S0022-2836(02)00777-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LGU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme Mutant L99A/M102Q" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L99", "evidence_id": "EV-PDB-1L99-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "1L99", "doi": "10.1002/prot.340150407", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L99" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PERTURBATION OF TRP 138 IN T4 LYSOZYME BY MUTATIONS AT GLN 105 USED TO CORRELATE CHANGES IN STRUCTURE, STABILITY, SOLVATION, AND SPECTROSCOPIC PROPERTIES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L96", "evidence_id": "EV-PDB-1L96-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1L96", "doi": "10.1016/0022-2836(92)90231-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L96" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURE OF A HINGE-BENDING BACTERIOPHAGE T4 LYSOZYME MUTANT, ILE3-> PRO" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L92", "evidence_id": "EV-PDB-1L92-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1L92", "doi": "10.1006/jmbi.1993.1077", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L92" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SIMILAR HYDROPHOBIC REPLACEMENTS OF LEU 99 AND PHE 153 WITHIN THE CORE OF T4 LYSOZYME HAVE DIFFERENT STRUCTURAL AND THERMODYNAMIC CONSEQUENCES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L89", "evidence_id": "EV-PDB-1L89-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1L89", "doi": "10.1006/jmbi.1993.1077", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L89" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SIMILAR HYDROPHOBIC REPLACEMENTS OF LEU 99 AND PHE 153 WITHIN THE CORE OF T4 LYSOZYME HAVE DIFFERENT STRUCTURAL AND THERMODYNAMIC CONSEQUENCES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L87", "evidence_id": "EV-PDB-1L87-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1L87", "doi": "10.1006/jmbi.1993.1077", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L87" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SIMILAR HYDROPHOBIC REPLACEMENTS OF LEU 99 AND PHE 153 WITHIN THE CORE OF T4 LYSOZYME HAVE DIFFERENT STRUCTURAL AND THERMODYNAMIC CONSEQUENCES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1L86", "evidence_id": "EV-PDB-1L86-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1L86", "doi": "10.1006/jmbi.1993.1077", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1L86" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SIMILAR HYDROPHOBIC REPLACEMENTS OF LEU 99 AND PHE 153 WITHIN THE CORE OF T4 LYSOZYME HAVE DIFFERENT STRUCTURAL AND THERMODYNAMIC CONSEQUENCES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED", "K", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1P6Y", "evidence_id": "EV-PDB-1P6Y-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.54 }, "provenance": { "deposit_id": "1P6Y", "doi": "10.1016/S0022-2836(03)00856-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1P6Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME CORE REPACKING MUTANT M120Y/TA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1P7S", "evidence_id": "EV-PDB-1P7S-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "1P7S", "doi": "10.1016/S0022-2836(03)00856-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1P7S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME CORE REPACKING MUTANT V103I/TA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1PQD", "evidence_id": "EV-PDB-1PQD-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "1PQD", "doi": "10.1016/S0022-2836(03)00856-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1PQD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME CORE REPACKING MUTANT CORE10/TA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1PQJ", "evidence_id": "EV-PDB-1PQJ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1PQJ", "doi": "10.1016/S0022-2836(03)00856-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1PQJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME CORE REPACKING MUTANT A111V/CORE10/TA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1PQK", "evidence_id": "EV-PDB-1PQK-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1PQK", "doi": "10.1016/S0022-2836(03)00856-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1PQK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Repacking of the Core of T4 Lysozyme by Automated Design" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED", "K", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1PQM", "evidence_id": "EV-PDB-1PQM-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.52 }, "provenance": { "deposit_id": "1PQM", "doi": "10.1016/S0022-2836(03)00856-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1PQM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme Core Repacking Mutant V149I/T152V/TA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1PQO", "evidence_id": "EV-PDB-1PQO-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "1PQO", "doi": "10.1016/S0022-2836(03)00856-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1PQO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme Core Repacking Mutant L118I/TA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QS5", "evidence_id": "EV-PDB-1QS5-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "1QS5", "doi": "10.1006/jmbi.1999.3300", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QS5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE INTRODUCTION OF STRAIN AND ITS EFFECTS ON THE STRUCTURE AND STABILITY OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QS9", "evidence_id": "EV-PDB-1QS9-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1QS9", "doi": "10.1006/jmbi.1999.3300", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QS9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE INTRODUCTION OF STRAIN AND ITS EFFECTS ON THE STRUCTURE AND STABILITY OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QSB", "evidence_id": "EV-PDB-1QSB-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1QSB", "doi": "10.1006/jmbi.1999.3300", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QSB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE INTRODUCTION OF STRAIN AND ITS EFFECTS ON THE STRUCTURE AND STABILITY OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QSQ", "evidence_id": "EV-PDB-1QSQ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1QSQ", "doi": "10.1021/bi9915519", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QSQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CAVITY CREATING MUTATION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "PROTEIN (T4 Lysozyme) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QT3", "evidence_id": "EV-PDB-1QT3-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1QT3", "doi": "10.1073/pnas.96.16.8949", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QT3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T26D MUTANT OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "PROTEIN (T4 LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QT4", "evidence_id": "EV-PDB-1QT4-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1QT4", "doi": "10.1073/pnas.96.16.8949", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QT4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T26Q MUTANT OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "PROTEIN (T4 LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QT5", "evidence_id": "EV-PDB-1QT5-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1QT5", "doi": "10.1073/pnas.96.16.8949", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QT5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "D20E MUTANT STRUCTURE OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "PROTEIN (T4 LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QT7", "evidence_id": "EV-PDB-1QT7-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1QT7", "doi": "10.1073/pnas.96.16.8949", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QT7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "E11N Mutant of T4 Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "PROTEIN (T4 LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QT8", "evidence_id": "EV-PDB-1QT8-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1QT8", "doi": "10.1073/pnas.96.16.8949", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QT8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T26H Mutant of T4 Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QTB", "evidence_id": "EV-PDB-1QTB-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1QTB", "doi": "10.1006/jmbi.1999.3300", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QTB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE INTRODUCTION OF STRAIN AND ITS EFFECTS ON THE STRUCTURE AND STABILITY OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QTC", "evidence_id": "EV-PDB-1QTC-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "1QTC", "doi": "10.1006/jmbi.1999.3300", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QTC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE INTRODUCTION OF STRAIN AND ITS EFFECTS ON THE STRUCTURE AND STABILITY OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QTD", "evidence_id": "EV-PDB-1QTD-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "1QTD", "doi": "10.1006/jmbi.1999.3300", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QTD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE INTRODUCTION OF STRAIN AND ITS EFFECTS ON THE STRUCTURE AND STABILITY OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QTH", "evidence_id": "EV-PDB-1QTH-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1QTH", "doi": "10.1006/jmbi.1999.3300", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QTH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE INTRODUCTION OF STRAIN AND ITS EFFECTS ON THE STRUCTURE AND STABILITY OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -198.15 }, "construct": { "description": "PROTEIN (T4 LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QTV", "evidence_id": "EV-PDB-1QTV-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "1QTV", "doi": "10.1073/pnas.96.16.8949", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QTV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T26E APO STRUCTURE OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "PROTEIN (T4 LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QTZ", "evidence_id": "EV-PDB-1QTZ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1QTZ", "doi": "10.1073/pnas.96.16.8949", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QTZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "D20C MUTANT OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HEZ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QUD", "evidence_id": "EV-PDB-1QUD-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "1QUD", "doi": "10.1006/jmbi.1999.3102", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QUD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "L99G MUTANT OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QUG", "evidence_id": "EV-PDB-1QUG-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1QUG", "doi": "10.1006/jmbi.1999.3102", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QUG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "E108V MUTANT OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HEZ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QUH", "evidence_id": "EV-PDB-1QUH-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1QUH", "doi": "10.1006/jmbi.1999.3102", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QUH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "L99G/E108V MUTANT OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QUO", "evidence_id": "EV-PDB-1QUO-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1QUO", "doi": "10.1006/jmbi.1999.3102", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QUO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "L99A/E108V MUTANT OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1SSW", "evidence_id": "EV-PDB-1SSW-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.13 }, "provenance": { "deposit_id": "1SSW", "doi": "10.1110/ps.04875504", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1SSW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of phage T4 lysozyme mutant Y24A/Y25A/T26A/I27A/C54T/C97A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "RB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1SWY", "evidence_id": "EV-PDB-1SWY-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.06 }, "provenance": { "deposit_id": "1SWY", "doi": "10.1107/S0907444904017020", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1SWY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure Determination" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "PO4", "RB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1SWZ", "evidence_id": "EV-PDB-1SWZ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.06 }, "provenance": { "deposit_id": "1SWZ", "doi": "10.1107/S0907444904017020", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1SWZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure determination by direct methods" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1T6H", "evidence_id": "EV-PDB-1T6H-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.01 }, "provenance": { "deposit_id": "1T6H", "doi": "10.1038/nbt1013", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1T6H" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure T4 Lysozyme incorporating an unnatural amino acid p-iodo-L-phenylalanine at position 153" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GAI", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1T8A", "evidence_id": "EV-PDB-1T8A-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1T8A", "doi": "10.1073/pnas.0404482101", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1T8A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "USE OF SEQUENCE DUPLICATION TO ENGINEER A LIGAND-TRIGGERED LONG-DISTANCE MOLECULAR SWITCH IN T4 Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1T8F", "evidence_id": "EV-PDB-1T8F-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.15 }, "provenance": { "deposit_id": "1T8F", "doi": "10.1110/ps.04875504", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1T8F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of phage T4 lysozyme mutant R14A/K16A/I17A/K19A/T21A/E22A/C54T/C97A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1T8G", "evidence_id": "EV-PDB-1T8G-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1T8G", "doi": "10.1110/ps.04875504", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1T8G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of phage T4 lysozyme mutant L32A/L33A/T34A/C54T/C97A/E108V" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1T97", "evidence_id": "EV-PDB-1T97-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "1T97", "doi": "10.1073/pnas.0404482101", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1T97" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Use of sequence duplication to engineer a ligand-triggered long-distance molecular switch in T4 Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1TLA", "evidence_id": "EV-PDB-1TLA-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1TLA", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1TLA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HYDROPHOBIC CORE REPACKING AND AROMATIC-AROMATIC INTERACTION IN THE THERMOSTABLE MUTANT OF T4 LYSOZYME SER 117 (RIGHT ARROW) PHE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CAQ", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -99.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1XEP", "evidence_id": "EV-PDB-1XEP-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "1XEP", "doi": "10.1021/jm0491187", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1XEP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Catechol in complex with T4 lysozyme L99A/M102Q" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "R1F" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1ZUR", "evidence_id": "EV-PDB-1ZUR-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "1ZUR", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1ZUR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of spin labeled T4 Lysozyme (V131R1F)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AZI", "CL", "HED", "R1B" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1ZWN", "evidence_id": "EV-PDB-1ZWN-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1ZWN", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1ZWN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of spin labeled T4 Lysozyme (V131R1B)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/201L", "evidence_id": "EV-PDB-201L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "201L", "doi": "10.1038/361561a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/201L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HOW AMINO-ACID INSERTIONS ARE ALLOWED IN AN ALPHA-HELIX OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/209L", "evidence_id": "EV-PDB-209L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "209L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/209L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PROTEIN STRUCTURE PLASTICITY EXEMPLIFIED BY INSERTION AND DELETION MUTANTS IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/210L", "evidence_id": "EV-PDB-210L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.89 }, "provenance": { "deposit_id": "210L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/210L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PROTEIN STRUCTURE PLASTICITY EXEMPLIFIED BY INSERTION AND DELETION MUTANTS IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/206L", "evidence_id": "EV-PDB-206L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "206L", "doi": "10.1021/bi00093a013", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/206L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/205L", "evidence_id": "EV-PDB-205L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "205L", "doi": "10.1038/361561a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/205L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HOW AMINO-ACID INSERTIONS ARE ALLOWED IN AN ALPHA-HELIX OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/200L", "evidence_id": "EV-PDB-200L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "200L", "doi": "10.1006/jmbi.1996.0338", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/200L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THERMODYNAMIC AND STRUCTURAL COMPENSATION IN \"SIZE-SWITCH\" CORE-REPACKING VARIANTS OF T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AZI", "CL", "HED", "MTN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1ZYT", "evidence_id": "EV-PDB-1ZYT-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1ZYT", "doi": "10.1002/pro.96", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1ZYT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of spin labeled T4 Lysozyme (A82R1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "RB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1SX7", "evidence_id": "EV-PDB-1SX7-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.06 }, "provenance": { "deposit_id": "1SX7", "doi": "10.1107/S0907444904017020", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1SX7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure determination by direct methods" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "RB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1SX2", "evidence_id": "EV-PDB-1SX2-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.06 }, "provenance": { "deposit_id": "1SX2", "doi": "10.1107/S0907444904017020", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1SX2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Use of a Halide Binding Site to Bypass the 1000-atom Limit to Structure Determination by Direct Methods" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1SSY", "evidence_id": "EV-PDB-1SSY-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "1SSY", "doi": "10.1110/ps.04875504", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1SSY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of phage T4 lysozyme mutant G28A/I29A/G30A/C54T/C97A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "PROTEIN (T4 LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QT6", "evidence_id": "EV-PDB-1QT6-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1QT6", "doi": "10.1073/pnas.96.16.8949", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QT6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "E11H Mutant of T4 Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1PQI", "evidence_id": "EV-PDB-1PQI-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.57 }, "provenance": { "deposit_id": "1PQI", "doi": "10.1016/S0022-2836(03)00856-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1PQI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME CORE REPACKING MUTANT I118L/CORE7/TA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/212L", "evidence_id": "EV-PDB-212L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.76 }, "provenance": { "deposit_id": "212L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/212L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PROTEIN STRUCTURE PLASTICITY EXEMPLIFIED BY INSERTION AND DELETION MUTANTS IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/213L", "evidence_id": "EV-PDB-213L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.13 }, "provenance": { "deposit_id": "213L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/213L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PROTEIN STRUCTURE PLASTICITY EXEMPLIFIED BY INSERTION AND DELETION MUTANTS IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/214L", "evidence_id": "EV-PDB-214L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.89 }, "provenance": { "deposit_id": "214L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/214L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PROTEIN STRUCTURE PLASTICITY EXEMPLIFIED BY INSERTION AND DELETION MUTANTS IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/215L", "evidence_id": "EV-PDB-215L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.96 }, "provenance": { "deposit_id": "215L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/215L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PROTEIN STRUCTURE PLASTICITY EXEMPLIFIED BY INSERTION AND DELETION MUTANTS IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/216L", "evidence_id": "EV-PDB-216L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "216L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/216L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/217L", "evidence_id": "EV-PDB-217L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "217L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/217L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/218L", "evidence_id": "EV-PDB-218L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.05 }, "provenance": { "deposit_id": "218L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/218L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PROTEIN STRUCTURE PLASTICITY EXEMPLIFIED BY INSERTION AND DELETION MUTANTS IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/219L", "evidence_id": "EV-PDB-219L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.66 }, "provenance": { "deposit_id": "219L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/219L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PROTEIN STRUCTURE PLASTICITY EXEMPLIFIED BY INSERTION AND DELETION MUTANTS IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "BNZ", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/220L", "evidence_id": "EV-PDB-220L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "220L", "doi": "10.1006/jmbi.1997.1606", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/220L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GENERATING LIGAND BINDING SITES IN T4 LYSOZYME USING DEFICIENCY-CREATING SUBSTITUTIONS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/221L", "evidence_id": "EV-PDB-221L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "221L", "doi": "10.1021/bi00093a013", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/221L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE ENERGETIC COST AND THE STRUCTURAL CONSEQUENCES OF BURYING A HYDROXYL GROUP WITHIN THE CORE OF A PROTEIN DETERMINED FROM ALA TO SER AND VAL TO THR SUBSTITUTIONS IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/222L", "evidence_id": "EV-PDB-222L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "222L", "doi": "10.1006/jmbi.1997.1606", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/222L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GENERATING LIGAND BINDING SITES IN T4 LYSOZYME USING DEFICIENCY-CREATING SUBSTITUTIONS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "BNZ", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/223L", "evidence_id": "EV-PDB-223L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "223L", "doi": "10.1006/jmbi.1997.1606", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/223L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GENERATING LIGAND BINDING SITES IN T4 LYSOZYME USING DEFICIENCY-CREATING SUBSTITUTIONS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/224L", "evidence_id": "EV-PDB-224L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "224L", "doi": "10.1021/bi00093a013", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/224L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE ENERGETIC COST AND THE STRUCTURAL CONSEQUENCES OF BURYING A HYDROXYL GROUP WITHIN THE CORE OF A PROTEIN DETERMINED FROM ALA TO SER AND VAL TO THR SUBSTITUTIONS IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "PXY" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/225L", "evidence_id": "EV-PDB-225L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "225L", "doi": "10.1006/jmbi.1997.1606", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/225L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GENERATING LIGAND BINDING SITES IN T4 LYSOZYME USING DEFICIENCY-CREATING SUBSTITUTIONS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/226L", "evidence_id": "EV-PDB-226L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "226L", "doi": "10.1006/jmbi.1997.1606", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/226L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GENERATING LIGAND BINDING SITES IN T4 LYSOZYME USING DEFICIENCY-CREATING SUBSTITUTIONS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "BNZ", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/227L", "evidence_id": "EV-PDB-227L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "227L", "doi": "10.1006/jmbi.1997.1606", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/227L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GENERATING LIGAND BINDING SITES IN T4 LYSOZYME USING DEFICIENCY-CREATING SUBSTITUTIONS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/228L", "evidence_id": "EV-PDB-228L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "228L", "doi": "10.1006/jmbi.1997.1606", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/228L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GENERATING LIGAND BINDING SITES IN T4 LYSOZYME USING DEFICIENCY-CREATING SUBSTITUTIONS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "GAI" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/229L", "evidence_id": "EV-PDB-229L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "229L", "doi": "10.1006/jmbi.1997.1606", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/229L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GENERATING LIGAND BINDING SITES IN T4 LYSOZYME USING DEFICIENCY-CREATING SUBSTITUTIONS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/230L", "evidence_id": "EV-PDB-230L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "230L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/230L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT M6L" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/231L", "evidence_id": "EV-PDB-231L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "231L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/231L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT M106K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/232L", "evidence_id": "EV-PDB-232L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.73 }, "provenance": { "deposit_id": "232L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/232L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT M120K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/233L", "evidence_id": "EV-PDB-233L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "233L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/233L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT M120L" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/234L", "evidence_id": "EV-PDB-234L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "234L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/234L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 LYSOZYME MUTANT M106L" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/235L", "evidence_id": "EV-PDB-235L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "235L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/235L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/236L", "evidence_id": "EV-PDB-236L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "236L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/236L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/237L", "evidence_id": "EV-PDB-237L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "237L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/237L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/240L", "evidence_id": "EV-PDB-240L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "240L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/240L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/241L", "evidence_id": "EV-PDB-241L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "241L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/241L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/242L", "evidence_id": "EV-PDB-242L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "242L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/242L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/243L", "evidence_id": "EV-PDB-243L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "243L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/243L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/244L", "evidence_id": "EV-PDB-244L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "244L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/244L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/245L", "evidence_id": "EV-PDB-245L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "245L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/245L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/247L", "evidence_id": "EV-PDB-247L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "247L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/247L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/248L", "evidence_id": "EV-PDB-248L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "248L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/248L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/249L", "evidence_id": "EV-PDB-249L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "249L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/249L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/250L", "evidence_id": "EV-PDB-250L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "250L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/250L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/251L", "evidence_id": "EV-PDB-251L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "251L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/251L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/252L", "evidence_id": "EV-PDB-252L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "252L", "doi": "10.1006/jmbi.1997.1606", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/252L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GENERATING LIGAND BINDING SITES IN T4 LYSOZYME USING DEFICIENCY-CREATING SUBSTITUTIONS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/253L", "evidence_id": "EV-PDB-253L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "253L", "doi": "10.1073/pnas.92.2.452", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/253L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/254L", "evidence_id": "EV-PDB-254L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "254L", "doi": "10.1073/pnas.92.2.452", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/254L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/255L", "evidence_id": "EV-PDB-255L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "255L", "doi": "10.1073/pnas.92.2.452", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/255L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HYDROLASE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/256L", "evidence_id": "EV-PDB-256L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "256L", "doi": "10.1038/348263a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/256L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "BACTERIOPHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/257L", "evidence_id": "EV-PDB-257L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "257L", "doi": "10.1093/protein/13.5.313", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/257L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "AN ADAPTABLE METAL-BINDING SITE ENGINEERED INTO T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/258L", "evidence_id": "EV-PDB-258L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "258L", "doi": "10.1093/protein/13.5.313", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/258L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "AN ADAPTABLE METAL-BINDING SITE ENGINEERED INTO T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/259L", "evidence_id": "EV-PDB-259L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.92 }, "provenance": { "deposit_id": "259L", "doi": "10.1093/protein/13.5.313", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/259L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "AN ADAPTABLE METAL-BINDING SITE ENGINEERED INTO T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NI" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/260L", "evidence_id": "EV-PDB-260L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "260L", "doi": "10.1093/protein/13.5.313", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/260L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "AN ADAPTABLE METAL-BINDING SITE ENGINEERED INTO T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/246L", "evidence_id": "EV-PDB-246L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "246L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/246L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/239L", "evidence_id": "EV-PDB-239L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "239L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/239L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/238L", "evidence_id": "EV-PDB-238L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "238L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/238L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE RESPONSE OF T4 LYSOZYME TO LARGE-TO-SMALL SUBSTITUTIONS WITHIN THE CORE AND ITS RELATION TO THE HYDROPHOBIC EFFECT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/211L", "evidence_id": "EV-PDB-211L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "211L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/211L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PROTEIN STRUCTURE PLASTICITY EXEMPLIFIED BY INSERTION AND DELETION MUTANTS IN T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/261L", "evidence_id": "EV-PDB-261L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "261L", "doi": "10.1073/pnas.96.11.6078", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/261L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL CHARACTERISATION OF AN ENGINEERED TANDEM REPEAT CONTRASTS THE IMPORTANCE OF CONTEXT AND SEQUENCE IN PROTEIN FOLDING" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2B72", "evidence_id": "EV-PDB-2B72-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "2B72", "doi": "10.1073/pnas.0508224102", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2B72" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme mutant L99A at 100 MPa" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2B73", "evidence_id": "EV-PDB-2B73-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.15 }, "provenance": { "deposit_id": "2B73", "doi": "10.1073/pnas.0508224102", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2B73" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme mutant L99A at 100 MPa" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2LZM", "evidence_id": "EV-PDB-2LZM-1", "mappings": [ { "confidence": "high", "justification": "Wild-type structure at 1.7 Å; representative for the wild-type state.", "rule": "curator_assignment", "state_id": "T4L-WT", "who": "curator:draft (unreviewed)" } ], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "2LZM", "doi": "10.1016/0022-2836(87)90636-X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2LZM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURE OF BACTERIOPHAGE T4 LYSOZYME REFINED AT 1.7 ANGSTROMS RESOLUTION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2OE4", "evidence_id": "EV-PDB-2OE4-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "2OE4", "doi": "10.1073/pnas.0508224102", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2OE4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High Pressure Psuedo Wild Type T4 Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "PO4", "YAN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Lysozyme (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2OTY", "evidence_id": "EV-PDB-2OTY-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.83 }, "provenance": { "deposit_id": "2OTY", "doi": "10.1016/j.jmb.2007.06.002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2OTY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "1,2-dichlorobenzene in complex with T4 Lysozyme L99A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1MR", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Lysozyme (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2OTZ", "evidence_id": "EV-PDB-2OTZ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.07 }, "provenance": { "deposit_id": "2OTZ", "doi": "10.1016/j.jmb.2007.06.002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2OTZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "N-methylaniline in complex with T4 Lysozyme L99A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MR3", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Lysozyme (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2OU0", "evidence_id": "EV-PDB-2OU0-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.94 }, "provenance": { "deposit_id": "2OU0", "doi": "10.1016/j.jmb.2007.06.002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2OU0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "1-methylpyrrole in complex with T4 Lysozyme L99A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "263", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Lysozyme (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2RB2", "evidence_id": "EV-PDB-2RB2-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.463 }, "provenance": { "deposit_id": "2RB2", "doi": "10.1016/j.jmb.2008.01.049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2RB2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "3-methylbenzylazide in complex with T4 lysozyme L99A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "261", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Lysozyme (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2RB1", "evidence_id": "EV-PDB-2RB1-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "2RB1", "doi": "10.1016/j.jmb.2008.01.049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2RB1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "2-ethoxyphenol in complex with T4 lysozyme L99A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "260", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Lysozyme (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2RB0", "evidence_id": "EV-PDB-2RB0-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.84 }, "provenance": { "deposit_id": "2RB0", "doi": "10.1016/j.jmb.2008.01.049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2RB0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "2,6-difluorobenzylbromide complex with T4 lysozyme L99A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "259", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Lysozyme (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2RAZ", "evidence_id": "EV-PDB-2RAZ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.641 }, "provenance": { "deposit_id": "2RAZ", "doi": "10.1016/j.jmb.2008.01.049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2RAZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "4-(methylthio)nitrobenzene in complex with T4 lysozyme L99A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "258", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Lysozyme (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2RAY", "evidence_id": "EV-PDB-2RAY-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.798 }, "provenance": { "deposit_id": "2RAY", "doi": "10.1016/j.jmb.2008.01.049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2RAY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "beta-chlorophenetole in complex with T4 lysozyme L99A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Transcription factor ETV6,Endolysin (chains B,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2QB0", "evidence_id": "EV-PDB-2QB0-2", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.56 }, "provenance": { "deposit_id": "2QB0", "doi": "10.1110/ps.073074207", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2QB0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the 2TEL crystallization module fused to T4 lysozyme with an Ala-Gly-Pro linker." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NH4", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme (chains C,F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2QAR", "evidence_id": "EV-PDB-2QAR-3", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "2QAR", "doi": "10.1110/ps.073074207", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2QAR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the 2TEL crystallization module fused to T4 lysozyme with a helical linker." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED", "MTN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2Q9E", "evidence_id": "EV-PDB-2Q9E-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "2Q9E", "doi": "10.1110/ps.073174008", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2Q9E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of spin-labeled T4 lysozyme mutant S44R1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "MTN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2Q9D", "evidence_id": "EV-PDB-2Q9D-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "2Q9D", "doi": "10.1110/ps.073174008", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2Q9D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of spin-labeled T4 lysozyme mutant A41R1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MTN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2OU9", "evidence_id": "EV-PDB-2OU9-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "2OU9", "doi": "10.1110/ps.062739107", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2OU9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Spin-labeled T4 Lysozyme Mutant T115R1/R119A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "MTN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2OU8", "evidence_id": "EV-PDB-2OU8-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2OU8", "doi": "10.1110/ps.062739107", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2OU8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Spin-labeled T4 Lysozyme Mutant T115R1 at Room Temperature" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2OEA", "evidence_id": "EV-PDB-2OEA-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.01 }, "provenance": { "deposit_id": "2OEA", "doi": "10.1016/j.jmb.2006.12.021", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2OEA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High-pressure structure of pseudo-WT T4 Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2OE9", "evidence_id": "EV-PDB-2OE9-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.01 }, "provenance": { "deposit_id": "2OE9", "doi": "10.1016/j.jmb.2006.12.021", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2OE9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High-pressure structure of pseudo-WT T4 Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2OE7", "evidence_id": "EV-PDB-2OE7-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "2OE7", "doi": "10.1016/j.jmb.2006.12.021", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2OE7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High-Pressure T4 Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2O7A", "evidence_id": "EV-PDB-2O7A-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.84 }, "provenance": { "deposit_id": "2O7A", "doi": "10.1110/ps.062628607", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2O7A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme C-terminal fragment" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2O79", "evidence_id": "EV-PDB-2O79-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2O79", "doi": "10.1110/ps.062628607", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2O79" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme with C-terminal extension" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2O4W", "evidence_id": "EV-PDB-2O4W-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "2O4W", "doi": "10.1110/ps.062628607", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2O4W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme circular permutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MTN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2NTH", "evidence_id": "EV-PDB-2NTH-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2NTH", "doi": "10.1110/ps.062739107", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2NTH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Spin-labeled T4 Lysozyme Mutant L118R1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "R7A" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2NTG", "evidence_id": "EV-PDB-2NTG-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "2NTG", "doi": "10.1110/ps.062739107", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2NTG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Spin-labeled T4 Lysozyme Mutant T115R7" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2LCB", "evidence_id": "EV-PDB-2LCB-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2LCB", "doi": "10.1038/nature10349", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2LCB" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution Structure of a Minor and Transiently Formed State of a T4 Lysozyme Mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": 33.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2LC9", "evidence_id": "EV-PDB-2LC9-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "2LC9", "doi": "10.1038/nature10349", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2LC9" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution Structure of a Minor and Transiently Formed State of a T4 Lysozyme Mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2L78", "evidence_id": "EV-PDB-2L78-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2L78", "doi": "10.1016/0022-2836(92)90475-Y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2L78" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DESIGN AND STRUCTURAL ANALYSIS OF ALTERNATIVE HYDROPHOBIC CORE PACKING ARRANGEMENTS IN BACTERIOPHAGE T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MTN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2IGC", "evidence_id": "EV-PDB-2IGC-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "2IGC", "doi": "10.1110/ps.062739107", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2IGC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Spin labeled T4 Lysozyme Mutant T115R1A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "TRS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -73.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2HUM", "evidence_id": "EV-PDB-2HUM-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.35 }, "provenance": { "deposit_id": "2HUM", "doi": "10.1073/pnas.0607674103", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2HUM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of T4 Lysozyme D72C synthetic dimer" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -73.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2HUL", "evidence_id": "EV-PDB-2HUL-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2HUL", "doi": "10.1073/pnas.0607674103", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2HUL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of T4 Lysozyme S44C synthetic dimer" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2HUK", "evidence_id": "EV-PDB-2HUK-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2HUK", "doi": "10.1073/pnas.0607674103", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2HUK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of T4 Lysozyme V131C synthetic dimer" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "MGX" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2F47", "evidence_id": "EV-PDB-2F47-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "2F47", "doi": "10.1110/ps.052020606", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2F47" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Xray crystal structure of T4 lysozyme mutant L20/R63A liganded to methylguanidinium" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "EGD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2F32", "evidence_id": "EV-PDB-2F32-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2F32", "doi": "10.1110/ps.052020606", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2F32" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Xray crystal structure of lysozyme mutant L20/R63A liganded to ethylguanidinium" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GAI", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2F2Q", "evidence_id": "EV-PDB-2F2Q-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "2F2Q", "doi": "10.1110/ps.052020606", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2F2Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High resolution crystal structure of T4 lysozyme mutant L20R63/A liganded to guanidinium ion" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AZI", "CL", "HED", "MTN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2CUU", "evidence_id": "EV-PDB-2CUU-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "2CUU", "doi": "10.1002/pro.96", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2CUU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of spin labeled T4 Lysozyme (V131R1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.8, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Lysozyme (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2B7X", "evidence_id": "EV-PDB-2B7X-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "2B7X", "doi": "10.1110/ps.052018006", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2B7X" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Sequential reorganization of beta-sheet topology by insertion of a single strand" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2B75", "evidence_id": "EV-PDB-2B75-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "2B75", "doi": "10.1073/pnas.0508224102", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2B75" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme mutant L99A at 150 MPa" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2B74", "evidence_id": "EV-PDB-2B74-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "2B74", "doi": "10.1073/pnas.0508224102", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2B74" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme mutant L99A at 100 MPa" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2B70", "evidence_id": "EV-PDB-2B70-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "2B70", "doi": "10.1073/pnas.0508224102", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2B70" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme mutant L99A at ambient pressure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2B6Z", "evidence_id": "EV-PDB-2B6Z-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "2B6Z", "doi": "10.1073/pnas.0508224102", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2B6Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme mutant L99A at ambient pressure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2B6Y", "evidence_id": "EV-PDB-2B6Y-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "2B6Y", "doi": "10.1073/pnas.0508224102", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2B6Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme mutant L99A at ambient pressure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2B6X", "evidence_id": "EV-PDB-2B6X-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.107 }, "provenance": { "deposit_id": "2B6X", "doi": "10.1073/pnas.0508224102", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2B6X" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme mutant L99A at 200 MPa" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2B6W", "evidence_id": "EV-PDB-2B6W-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "2B6W", "doi": "10.1073/pnas.0508224102", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2B6W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme mutant L99A at 200 MPa" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2B6T", "evidence_id": "EV-PDB-2B6T-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "2B6T", "doi": "10.1016/j.jmb.2006.12.021", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2B6T" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme mutant L99A at 200 MPa" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AZI", "CL", "HED", "R7A" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2A4T", "evidence_id": "EV-PDB-2A4T-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "2A4T", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2A4T" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of spin labeled T4 Lysozyme (V131R7)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "B3P", "CL", "EFK", "MOO", "MTE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Mitochondrial amidoxime-reducing component 1,Endolysin (chains D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/29AJ", "evidence_id": "EV-PDB-29AJ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.63 }, "provenance": { "deposit_id": "29AJ", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/29AJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of the human mARC1 M187K variant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/262L", "evidence_id": "EV-PDB-262L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "262L", "doi": "10.1073/pnas.96.11.6078", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/262L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL CHARACTERISATION OF AN ENGINEERED TANDEM REPEAT CONTRASTS THE IMPORTANCE OF CONTEXT AND SEQUENCE IN PROTEIN FOLDING" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "264", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2RBN", "evidence_id": "EV-PDB-2RBN-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.29 }, "provenance": { "deposit_id": "2RBN", "doi": "10.1016/j.jmb.2008.01.049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2RBN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "N-phenylglycinonitrile in complex with T4 lysozyme L99A/M102Q" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "263", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2RBQ", "evidence_id": "EV-PDB-2RBQ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.633 }, "provenance": { "deposit_id": "2RBQ", "doi": "10.1016/j.jmb.2008.01.049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2RBQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "3-methylbenzylazide in complex with T4 L99A/M102Q" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "268", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2RBR", "evidence_id": "EV-PDB-2RBR-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.433 }, "provenance": { "deposit_id": "2RBR", "doi": "10.1016/j.jmb.2008.01.049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2RBR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "2-phenoxyethanol in complex with T4 lysozyme L99A/M102Q" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "269", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2RBS", "evidence_id": "EV-PDB-2RBS-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.557 }, "provenance": { "deposit_id": "2RBS", "doi": "10.1016/j.jmb.2008.01.049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2RBS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "(r)(+)-3-chloro-1-phenyl-1-propanol in complex with T4 lysozyme L99A/M102Q" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "12P", "ACM", "BU1", "CAU", "CLR", "PLM", "SO4", "branched: alpha-D-glucopyranose-(1-4)-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.75, "salt_mM": null, "temperature_c": -195.15 }, "construct": { "description": "beta-2-adrenergic receptor/T4-lysozyme chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2RH1", "evidence_id": "EV-PDB-2RH1-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "2RH1", "doi": "10.1126/science.1150577", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2RH1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High resolution crystal structure of human B2-adrenergic G protein-coupled receptor." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3C7W", "evidence_id": "EV-PDB-3C7W-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.77 }, "provenance": { "deposit_id": "3C7W", "doi": "10.1002/pro.94", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3C7W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Contributions of all 20 amino acids at site 96 to the stability and structure of T4 lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3C7Y", "evidence_id": "EV-PDB-3C7Y-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "3C7Y", "doi": "10.1002/pro.94", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3C7Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mutant R96A OF T4 lysozyme in wildtype background at 298K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3C7Z", "evidence_id": "EV-PDB-3C7Z-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.67 }, "provenance": { "deposit_id": "3C7Z", "doi": "10.1002/pro.94", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3C7Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme mutant D89A/R96H at room temperature" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3C80", "evidence_id": "EV-PDB-3C80-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.99 }, "provenance": { "deposit_id": "3C80", "doi": "10.1002/pro.94", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3C80" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme mutant R96Y at room temperature" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3C81", "evidence_id": "EV-PDB-3C81-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "3C81", "doi": "10.1002/pro.94", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3C81" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mutant K85A of T4 lysozyme in wildtype background at room temperature" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3C82", "evidence_id": "EV-PDB-3C82-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.68 }, "provenance": { "deposit_id": "3C82", "doi": "10.1002/pro.94", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3C82" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Bacteriophage lysozyme T4 lysozyme mutant K85A/R96H" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3C83", "evidence_id": "EV-PDB-3C83-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.84 }, "provenance": { "deposit_id": "3C83", "doi": "10.1002/pro.94", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3C83" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Bacteriophage T4 lysozyme mutant D89A in wildtype background at room temperature" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3C8Q", "evidence_id": "EV-PDB-3C8Q-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.64 }, "provenance": { "deposit_id": "3C8Q", "doi": "10.1002/pro.94", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3C8Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Contribution of all 20 amino acids at site 96 to the stability and structure of T4 lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3C8R", "evidence_id": "EV-PDB-3C8R-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "3C8R", "doi": "10.1002/pro.94", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3C8R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Contributions of all 20 amino acids at site 96 to stability and structure of T4 lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3C8S", "evidence_id": "EV-PDB-3C8S-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.68 }, "provenance": { "deposit_id": "3C8S", "doi": "10.1002/pro.94", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3C8S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Contributions of all 20 amino acids at site 96 to the stability and structure of T4 lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HEZ", "MPD", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3CDO", "evidence_id": "EV-PDB-3CDO-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.87 }, "provenance": { "deposit_id": "3CDO", "doi": "10.1002/pro.94", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3CDO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Bacteriophage T4 lysozyme mutant R96V in wildtype background at low temperature" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3CDQ", "evidence_id": "EV-PDB-3CDQ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.68 }, "provenance": { "deposit_id": "3CDQ", "doi": "10.1002/pro.94", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3CDQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Contributions of all 20 amino acids at site 96 to the stability and structure of T4 lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3CDR", "evidence_id": "EV-PDB-3CDR-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "3CDR", "doi": "10.1002/pro.94", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3CDR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "R96Q Mutant of wildtype phage T4 lysozyme at 298 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3CDT", "evidence_id": "EV-PDB-3CDT-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.63 }, "provenance": { "deposit_id": "3CDT", "doi": "10.1002/pro.94", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3CDT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Contributions of all 20 amino acids at site 96 to the stability and structure of T4 lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CLR", "OLC", "TIM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -196.15 }, "construct": { "description": "Beta-2 adrenergic receptor/T4-lysozyme chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3D4S", "evidence_id": "EV-PDB-3D4S-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "3D4S", "doi": "10.1016/j.str.2008.05.001", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3D4S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Cholesterol bound form of human beta2 adrenergic receptor." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AZI", "BME", "CL", "EPE", "GOL", "HED", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DKE", "evidence_id": "EV-PDB-3DKE-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "3DKE", "doi": "10.1073/pnas.0806307105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DKE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Polar and non-polar cavities in phage T4 lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "HED", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DMV", "evidence_id": "EV-PDB-3DMV-1", "mappings": [ { "confidence": "high", "justification": "Ligand-free L99A cavity mutant; representative for the cavity apo state.", "rule": "curator_assignment", "state_id": "T4L-L99A-apo", "who": "curator:draft (unreviewed)" } ], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "3DMV", "doi": "10.1016/j.jmb.2008.10.086", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DMV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Free of ligand binding in the hydrophobic cavity of T4 lysozyme L99A mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED", "HFB", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DMZ", "evidence_id": "EV-PDB-3DMZ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "3DMZ", "doi": "10.1016/j.jmb.2008.10.086", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DMZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hexafluorobenzene binding in the hydrophobic cavity of T4 lysozyme L99A mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BCF", "CL", "HED", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DN1", "evidence_id": "EV-PDB-3DN1-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "3DN1", "doi": "10.1016/j.jmb.2008.10.086", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DN1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Chloropentafluorobenzene binding in the hydrophobic cavity of T4 lysozyme L99A mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED", "IBF", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DN3", "evidence_id": "EV-PDB-3DN3-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "3DN3", "doi": "10.1016/j.jmb.2008.10.086", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DN3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Iodopentafluorobenzene binding in the hydrophobic cavity of T4 lysozyme L99A mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED", "PIH", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DN4", "evidence_id": "EV-PDB-3DN4-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "3DN4", "doi": "10.1016/j.jmb.2008.10.086", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DN4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Iodobenzene binding in the hydrophobic cavity of T4 lysozyme L99A mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4", "STE", "ZMA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Human Adenosine A2A receptor/T4 lysozyme chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3EML", "evidence_id": "EV-PDB-3EML-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "3EML", "doi": "10.1126/science.1164772", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3EML" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The 2.6 A Crystal Structure of a Human A2A Adenosine Receptor bound to ZM241385." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED", "K", "NA", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.3, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3F8V", "evidence_id": "EV-PDB-3F8V-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.08 }, "provenance": { "deposit_id": "3F8V", "doi": "10.1002/pro.93", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3F8V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Evaulaution at Atomic Resolution of the Role of Strain in Destabilizing the Temperature Sensitive T4 Lysozyme Mutant Arg96-->His" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "K", "NA", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3F9L", "evidence_id": "EV-PDB-3F9L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.19 }, "provenance": { "deposit_id": "3F9L", "doi": "10.1002/pro.93", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3F9L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Evaulaution at Atomic Resolution of the Role of Strain in Destabilizing the Temperature Sensitive T4 Lysozyme Mutant Arg96-->His" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "HED", "K", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3FA0", "evidence_id": "EV-PDB-3FA0-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.09 }, "provenance": { "deposit_id": "3FA0", "doi": "10.1002/pro.93", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3FA0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Evaulaution at Atomic Resolution of the Role of Strain in Destabilizing the Temperature Sensitive T4 Lysozyme Mutant Arg96-->His" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3FAD", "evidence_id": "EV-PDB-3FAD-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "3FAD", "doi": "10.1002/pro.93", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3FAD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Evaulaution at Atomic Resolution of the Role of Strain in Destabilizing the Temperature Sensitive T4 Lysozyme Mutant Arg96-->His" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "IPA", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3FI5", "evidence_id": "EV-PDB-3FI5-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.53 }, "provenance": { "deposit_id": "3FI5", "doi": "10.1002/pro.94", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3FI5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of T4 Lysozyme Mutant R96W" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AZI", "CL", "HED", "MTN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 17.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3G3V", "evidence_id": "EV-PDB-3G3V-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "3G3V", "doi": "10.1002/pro.96", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3G3V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of spin labeled T4 Lysozyme (V131R1) at 291 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AZI", "CL", "HED", "MTN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": 17.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3G3W", "evidence_id": "EV-PDB-3G3W-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "3G3W", "doi": "10.1002/pro.96", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3G3W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of spin labeled T4 Lysozyme (T151R1) at 291 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CO3", "SO4", "TAM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3GUI", "evidence_id": "EV-PDB-3GUI-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "3GUI", "doi": "10.1021/bi900685j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3GUI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme M102E/L99A mutant with buried charge in apolar cavity--Apo structure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "BNZ", "CO3", "EPE", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3GUJ", "evidence_id": "EV-PDB-3GUJ-1", "mappings": [ { "confidence": "high", "justification": "Title names L99A and benzene (BNZ) is bound in the cavity.", "rule": "t4l-l99a-benzene", "state_id": "T4L-L99A-benzene", "who": "rule:t4l-l99a-benzene" } ], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "3GUJ", "doi": "10.1021/bi900685j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3GUJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme M102E/L99A mutant with buried charge in apolar cavity--Benzene binding" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CA", "CL", "MBN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3GUK", "evidence_id": "EV-PDB-3GUK-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "3GUK", "doi": "10.1021/bi900685j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3GUK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme M102E/L99A mutant with buried charge in apolar cavity--Toluene binding" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CA", "CL", "PYJ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3GUL", "evidence_id": "EV-PDB-3GUL-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.07 }, "provenance": { "deposit_id": "3GUL", "doi": "10.1021/bi900685j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3GUL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme M102E/L99A mutant with buried charge in apolar cavity--ethylbenzene binding" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CA", "CL", "PXY" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3GUM", "evidence_id": "EV-PDB-3GUM-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.24 }, "provenance": { "deposit_id": "3GUM", "doi": "10.1021/bi900685j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3GUM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme M102E/L99A mutant with buried charge in apolar cavity--p-xylene binding" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ANL", "CA", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3GUN", "evidence_id": "EV-PDB-3GUN-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "3GUN", "doi": "10.1021/bi900685j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3GUN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme M102E/L99A mutant with buried charge in apolar cavity--aniline binding" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AZI", "CL", "HED", "MTN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3G3X", "evidence_id": "EV-PDB-3G3X-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "3G3X", "doi": "10.1002/pro.96", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3G3X" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of spin labeled T4 Lysozyme (T151R1) at 100 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "HED", "PIH", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DNA", "evidence_id": "EV-PDB-3DNA-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "3DNA", "doi": "10.1016/j.jmb.2008.10.086", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DNA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Iodobenzene binding in the hydrophobic cavity of T4 lysozyme L99A mutant (seleno version)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "HED", "IBF", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DN8", "evidence_id": "EV-PDB-3DN8-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "3DN8", "doi": "10.1016/j.jmb.2008.10.086", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DN8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Iodopentafluorobenzene binding in the hydrophobic cavity of T4 lysozyme L99A mutant (seleno version)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "F3B", "HED", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DN6", "evidence_id": "EV-PDB-3DN6-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "3DN6", "doi": "10.1016/j.jmb.2008.10.086", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DN6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "1,3,5-trifluoro-2,4,6-trichlorobenzene binding in the hydrophobic cavity of T4 lysozyme L99A mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BBF", "HED", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DN2", "evidence_id": "EV-PDB-3DN2-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "3DN2", "doi": "10.1016/j.jmb.2008.10.086", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DN2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Bromopentafluorobenzene binding in the hydrophobic cavity of T4 lysozyme L99A mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "F5B", "HED", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DN0", "evidence_id": "EV-PDB-3DN0-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "3DN0", "doi": "10.1016/j.jmb.2008.10.086", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DN0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Pentafluorobenzene binding in the hydrophobic cavity of T4 lysozyme L99A mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BNZ", "CL", "HED", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3DMX", "evidence_id": "EV-PDB-3DMX-1", "mappings": [ { "confidence": "high", "justification": "Title names L99A and benzene (BNZ) is bound in the cavity.", "rule": "t4l-l99a-benzene", "state_id": "T4L-L99A-benzene", "who": "rule:t4l-l99a-benzene" } ], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "3DMX", "doi": "10.1016/j.jmb.2008.10.086", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3DMX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Benzene binding in the hydrophobic cavity of T4 lysozyme L99A mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3CDV", "evidence_id": "EV-PDB-3CDV-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.73 }, "provenance": { "deposit_id": "3CDV", "doi": "10.1002/pro.94", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3CDV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Contributions of all 20 amino acids at site 96 to the stability and structure of T4 lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "266", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2RBP", "evidence_id": "EV-PDB-2RBP-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.467 }, "provenance": { "deposit_id": "2RBP", "doi": "10.1016/j.jmb.2008.01.049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2RBP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "2-(n-propylthio)ethanol in complex with T4 lysozyme L99A/M102Q" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "265", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2RBO", "evidence_id": "EV-PDB-2RBO-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.29 }, "provenance": { "deposit_id": "2RBO", "doi": "10.1016/j.jmb.2008.01.049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2RBO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "2-nitrothiophene in complex with T4 lysozyme L99A/M102Q" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "CL", "IPH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3GUO", "evidence_id": "EV-PDB-3GUO-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.16 }, "provenance": { "deposit_id": "3GUO", "doi": "10.1021/bi900685j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3GUO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme M102E/L99A mutant with buried charge in apolar cavity--phenol binding" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "0PY", "CL", "CO3", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3GUP", "evidence_id": "EV-PDB-3GUP-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "3GUP", "doi": "10.1021/bi900685j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3GUP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme M102E/L99A mutant with buried charge in apolar cavity--pyridine binding" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "B20", "HED", "NA", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3HH3", "evidence_id": "EV-PDB-3HH3-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "3HH3", "doi": "10.1002/anie.200903390", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3HH3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "New azaborine compounds bind to the T4 lysozyme L99A cavity - 1,2-dihydro-1,2-azaborine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BNZ", "HED", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3HH4", "evidence_id": "EV-PDB-3HH4-1", "mappings": [ { "confidence": "high", "justification": "Title names L99A and benzene (BNZ) is bound in the cavity.", "rule": "t4l-l99a-benzene", "state_id": "T4L-L99A-benzene", "who": "rule:t4l-l99a-benzene" } ], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "3HH4", "doi": "10.1002/anie.200903390", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3HH4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "New azaborine compounds bind to the T4 lysozyme L99A cavity - Benzene as control" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "B24", "HED", "NA", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3HH5", "evidence_id": "EV-PDB-3HH5-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "3HH5", "doi": "10.1002/anie.200903390", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3HH5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "New azaborine compounds bind to the T4 lysozyme L99A cavity - 1-ethyl-2-hydro-1,2-azaborine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "JZ0", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3HT6", "evidence_id": "EV-PDB-3HT6-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.59 }, "provenance": { "deposit_id": "3HT6", "doi": "10.1016/j.jmb.2009.09.049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3HT6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "2-methylphenol in complex with T4 lysozyme L99A/M102Q" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "JZ2", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3HT8", "evidence_id": "EV-PDB-3HT8-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "3HT8", "doi": "10.1016/j.jmb.2009.09.049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3HT8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "5-chloro-2-methylphenol in complex with T4 lysozyme L99A/M102Q" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "JZ3", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3HT9", "evidence_id": "EV-PDB-3HT9-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.02 }, "provenance": { "deposit_id": "3HT9", "doi": "10.1016/j.jmb.2009.09.049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3HT9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "2-methoxyphenol in complex with T4 lysozyme L99A/M102Q" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "JZ5", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3HTD", "evidence_id": "EV-PDB-3HTD-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "3HTD", "doi": "10.1016/j.jmb.2009.09.049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3HTD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "(Z)-Thiophene-2-carboxaldoxime in complex with T4 lysozyme L99A/M102Q" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "261", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3HU8", "evidence_id": "EV-PDB-3HU8-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "3HU8", "doi": "10.1016/j.jmb.2009.09.049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3HU8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "2-ethoxyphenol in complex with T4 lysozyme L99A/M102Q" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "JZ9", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3HUA", "evidence_id": "EV-PDB-3HUA-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "3HUA", "doi": "10.1016/j.jmb.2009.09.049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3HUA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "4,5,6,7-tetrahydroindole in complex with T4 lysozyme L99A/M102Q" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "J0Z", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3HUK", "evidence_id": "EV-PDB-3HUK-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.29 }, "provenance": { "deposit_id": "3HUK", "doi": "10.1016/j.jmb.2009.09.049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3HUK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Benzylacetate in complex with T4 lysozyme L99A/M102Q" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AZI", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3HWL", "evidence_id": "EV-PDB-3HWL-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "3HWL", "doi": "10.1073/pnas.0912009106", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3HWL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of T4 lysozyme with the unnatural amino acid p-Acetyl-L-Phenylalanine incorporated at position 131" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Lysozyme (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3JR6", "evidence_id": "EV-PDB-3JR6-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "3JR6", "doi": "10.1110/ps.052018006", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3JR6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Sequential reorganization of beta-sheet topology by insertion of a single strand" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HEZ", "K", "V1A" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3K2R", "evidence_id": "EV-PDB-3K2R-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "3K2R", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3K2R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Spin Labeled T4 Lysozyme Mutant K65V1/R76V1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AZI", "BME", "CL", "HED", "RXR" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3L2X", "evidence_id": "EV-PDB-3L2X-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "3L2X", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3L2X" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Spin Labeled T4 Lysozyme Mutant 115-119RX" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3L64", "evidence_id": "EV-PDB-3L64-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "3L64", "doi": "10.1006/jmbi.1994.1016", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3L64" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme S44E/WT*" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3LZM", "evidence_id": "EV-PDB-3LZM-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "3LZM", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3LZM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL STUDIES OF MUTANTS OF T4 LYSOZYME THAT ALTER HYDROPHOBIC STABILIZATION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CLR", "JRZ", "OLA", "OLC", "PGE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Beta-2 adrenergic receptor, Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3NY8", "evidence_id": "EV-PDB-3NY8-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.84 }, "provenance": { "deposit_id": "3NY8", "doi": "10.1021/ja105108q", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3NY8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the human beta2 adrenergic receptor in complex with the inverse agonist ICI 118,551" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CLR", "JSZ", "OLC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Beta-2 adrenergic receptor, Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3NY9", "evidence_id": "EV-PDB-3NY9-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.84 }, "provenance": { "deposit_id": "3NY9", "doi": "10.1021/ja105108q", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3NY9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the human beta2 adrenergic receptor in complex with a novel inverse agonist" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CLR", "JTZ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Beta-2 adrenergic receptor, Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3NYA", "evidence_id": "EV-PDB-3NYA-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.16 }, "provenance": { "deposit_id": "3NYA", "doi": "10.1021/ja105108q", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3NYA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the human beta2 adrenergic receptor in complex with the neutral antagonist alprenolol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ITD", "OLA", "OLC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "C-X-C chemokine receptor type 4, Lysozyme Chimera (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3ODU", "evidence_id": "EV-PDB-3ODU-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "3ODU", "doi": "10.1126/science.1194396", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3ODU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The 2.5 A structure of the CXCR4 chemokine receptor in complex with small molecule antagonist IT1t" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "C-X-C chemokine receptor type 4, Lysozyme Chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3OE0", "evidence_id": "EV-PDB-3OE0-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.9 }, "provenance": { "deposit_id": "3OE0", "doi": "10.1126/science.1194396", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3OE0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the CXCR4 chemokine receptor in complex with a cyclic peptide antagonist CVX15" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "ITD", "OLC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "C-X-C chemokine receptor type 4, Lysozyme Chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3OE6", "evidence_id": "EV-PDB-3OE6-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "3OE6", "doi": "10.1126/science.1194396", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3OE6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the CXCR4 chemokine receptor in complex with a small molecule antagonist IT1t in I222 spacegroup" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ITD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "C-X-C chemokine receptor type 4, Lysozyme Chimera (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3OE8", "evidence_id": "EV-PDB-3OE8-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "3OE8", "doi": "10.1126/science.1194396", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3OE8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the CXCR4 chemokine receptor in complex with a small molecule antagonist IT1t in P1 spacegroup" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ITD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "C-X-C chemokine receptor type 4, Lysozyme Chimera (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3OE9", "evidence_id": "EV-PDB-3OE9-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "3OE9", "doi": "10.1126/science.1194396", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3OE9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the chemokine CXCR4 receptor in complex with a small molecule antagonist IT1t in P1 spacegroup" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "P0G" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -195.15 }, "construct": { "description": "Beta-2 adrenergic receptor, Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3P0G", "evidence_id": "EV-PDB-3P0G-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.5 }, "provenance": { "deposit_id": "3P0G", "doi": "10.1038/nature09648", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3P0G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of a nanobody-stabilized active state of the beta2 adrenoceptor" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ETQ", "branched: alpha-D-glucopyranose-(1-4)-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "D(3) dopamine receptor, Lysozyme chimera (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3PBL", "evidence_id": "EV-PDB-3PBL-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.89 }, "provenance": { "deposit_id": "3PBL", "doi": "10.1126/science.1197410", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3PBL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the human dopamine D3 receptor in complex with eticlopride" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CLR", "ERC", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Fusion protein Beta-2 adrenergic receptor/Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3PDS", "evidence_id": "EV-PDB-3PDS-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.5 }, "provenance": { "deposit_id": "3PDS", "doi": "10.1038/nature09665", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3PDS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Irreversible Agonist-Beta2 Adrenoceptor Complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "OLC", "UKA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Adenosine receptor A2a,lysozyme chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3QAK", "evidence_id": "EV-PDB-3QAK-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.71 }, "provenance": { "deposit_id": "3QAK", "doi": "10.1126/science.1202793", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3QAK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Agonist bound structure of the human adenosine A2a receptor" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "IPA", "MPD", "MRD", "PO4", "TRS", "branched: vancosamine-(1-2)-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -180.15 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3RUN", "evidence_id": "EV-PDB-3RUN-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "3RUN", "doi": "10.1021/ja208755j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3RUN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "New strategy to analyze structures of glycopeptide antibiotic-target complexes" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "5EH", "D7V", "OLC", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Histamine H1 receptor, Lysozyme chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3RZE", "evidence_id": "EV-PDB-3RZE-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "3RZE", "doi": "10.1038/nature10236", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3RZE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the human histamine H1 receptor in complex with doxepin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "MG", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SB5", "evidence_id": "EV-PDB-3SB5-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.46 }, "provenance": { "deposit_id": "3SB5", "doi": "10.1002/pro.727", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SB5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Zn-mediated Trimer of T4 Lysozyme R125C/E128C by Synthetic Symmetrization" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SB8", "evidence_id": "EV-PDB-3SB8-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.65 }, "provenance": { "deposit_id": "3SB8", "doi": "10.1002/pro.727", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SB8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Cu-mediated Dimer of T4 Lysozyme D61H/K65H by Synthetic Symmetrization" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CU", "FMT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SB9", "evidence_id": "EV-PDB-3SB9-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.45 }, "provenance": { "deposit_id": "3SB9", "doi": "10.1002/pro.727", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SB9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Cu-mediated Dimer of T4 Lysozyme R76H/R80H by Synthetic Symmetrization" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B,C,D,E,F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SBA", "evidence_id": "EV-PDB-3SBA-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.75 }, "provenance": { "deposit_id": "3SBA", "doi": "10.1002/pro.727", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SBA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Zn-mediated Hexamer of T4 Lysozyme R76H/R80H by Synthetic Symmetrization" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SBB", "evidence_id": "EV-PDB-3SBB-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.434 }, "provenance": { "deposit_id": "3SBB", "doi": "10.1002/pro.727", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SBB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Disulphide-mediated Tetramer of T4 Lysozyme R76C/R80C by Synthetic Symmetrization" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "P0G" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -195.15 }, "construct": { "description": "Endolysin,Beta-2 adrenergic receptor (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SN6", "evidence_id": "EV-PDB-3SN6-4", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "3SN6", "doi": "10.1038/nature10361", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SN6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the beta2 adrenergic receptor-Gs protein complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BGC", "CL", "QNB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -195.15 }, "construct": { "description": "Human M2 muscarinic acetylcholine, receptor T4 lysozyme fusion protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3UON", "evidence_id": "EV-PDB-3UON-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "3UON", "doi": "10.1038/nature10753", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3UON" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the human M2 muscarinic acetylcholine receptor bound to an antagonist" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ML5", "NAG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Sphingosine 1-phosphate receptor 1, Lysozyme chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3V2W", "evidence_id": "EV-PDB-3V2W-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.35 }, "provenance": { "deposit_id": "3V2W", "doi": "10.1126/science.1215904", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3V2W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of a Lipid G protein-Coupled Receptor at 3.35A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ML5", "NAG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Sphingosine 1-phosphate receptor 1, Lysozyme chimera (E.C.3.2.1.17) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3V2Y", "evidence_id": "EV-PDB-3V2Y-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "3V2Y", "doi": "10.1126/science.1215904", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3V2Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of a Lipid G protein-Coupled Receptor at 2.80A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CU", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SB7", "evidence_id": "EV-PDB-3SB7-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "3SB7", "doi": "10.1002/pro.727", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SB7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Cu-mediated Trimer of T4 Lysozyme D61H/K65H/R76H/R80H by Synthetic Symmetrization" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SB6", "evidence_id": "EV-PDB-3SB6-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "3SB6", "doi": "10.1002/pro.727", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SB6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Cu-mediated Dimer of T4 Lysozyme D61H/K65H/R76H/R80H by Synthetic Symmetrization" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "J1Z", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3HUQ", "evidence_id": "EV-PDB-3HUQ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "3HUQ", "doi": "10.1016/j.jmb.2009.09.049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3HUQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Thieno[3,2-b]thiophene in complex with T4 lysozyme L99A/M102Q" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NBE", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3HU9", "evidence_id": "EV-PDB-3HU9-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.46 }, "provenance": { "deposit_id": "3HU9", "doi": "10.1016/j.jmb.2009.09.049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3HU9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Nitrosobenzene in complex with T4 lysozyme L99A/M102Q" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "JZ7", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3HTG", "evidence_id": "EV-PDB-3HTG-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.26 }, "provenance": { "deposit_id": "3HTG", "doi": "10.1016/j.jmb.2009.09.049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3HTG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "2-ethoxy-3,4-dihydro-2h-pyran in complex with T4 lysozyme L99A/M102Q" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "JZ6", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3HTF", "evidence_id": "EV-PDB-3HTF-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "3HTF", "doi": "10.1016/j.jmb.2009.09.049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3HTF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "4-chloro-1h-pyrazole in complex with T4 lysozyme L99A/M102Q" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "JZ4", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3HTB", "evidence_id": "EV-PDB-3HTB-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.81 }, "provenance": { "deposit_id": "3HTB", "doi": "10.1016/j.jmb.2009.09.049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3HTB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "2-propylphenol in complex with T4 lysozyme L99A/M102Q" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "JZ1", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3HT7", "evidence_id": "EV-PDB-3HT7-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "3HT7", "doi": "10.1016/j.jmb.2009.09.049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3HT7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "2-ethylphenol in complex with T4 lysozyme L99A/M102Q" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED", "PO4", "PYJ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3HH6", "evidence_id": "EV-PDB-3HH6-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "3HH6", "doi": "10.1002/anie.200903390", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3HH6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "New azaborine compounds bind to the T4 lysozyme L99A cavity -ethylbenzene as control" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "BME", "HED", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4E97", "evidence_id": "EV-PDB-4E97-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "4E97", "doi": "10.1073/pnas.1208076109", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4E97" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A/M102H with 2-Mercaptoethanol Bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "0R0", "ACT", "BME", "HED", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4EKR", "evidence_id": "EV-PDB-4EKR-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.49 }, "provenance": { "deposit_id": "4EKR", "doi": "10.1073/pnas.1208076109", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4EKR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A/M102H with 2-Cyanophenol Bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "2LP", "ACT", "BME", "HED", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4I7M", "evidence_id": "EV-PDB-4I7M-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.48 }, "provenance": { "deposit_id": "4I7M", "doi": "10.1021/jm301823g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4I7M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A/M102H with 2-allylphenol bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1WV", "NA", "P0G" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -195.15 }, "construct": { "description": "Lysozyme, Beta-2 adrenergic receptor (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LDE", "evidence_id": "EV-PDB-4LDE-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.79 }, "provenance": { "deposit_id": "4LDE", "doi": "10.1038/nature12572", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LDE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of beta2 adrenoceptor bound to BI167107 and an engineered nanobody" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1WV", "NA", "XQC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -195.15 }, "construct": { "description": "Lysozyme, Beta-2 adrenergic receptor (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LDL", "evidence_id": "EV-PDB-4LDL-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "4LDL", "doi": "10.1038/nature12572", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LDL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of beta2 adrenoceptor bound to hydroxybenzylisoproterenol and an engineered nanobody" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LZM", "evidence_id": "EV-PDB-4LZM-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "4LZM", "doi": "10.1002/prot.340100103", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LZM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "COMPARISON OF THE CRYSTAL STRUCTURE OF BACTERIOPHAGE T4 LYSOZYME AT LOW, MEDIUM, AND HIGH IONIC STRENGTHS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Sterol uptake control protein 2, Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4N9N", "evidence_id": "EV-PDB-4N9N-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.9 }, "provenance": { "deposit_id": "4N9N", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4N9N" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Saccharomyces cerevisiae Upc2 Transcription Factor fused with T4 Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "35V", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.8, "salt_mM": null, "temperature_c": -195.15 }, "construct": { "description": "Beta-2 adrenergic receptor (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4QKX", "evidence_id": "EV-PDB-4QKX-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.3 }, "provenance": { "deposit_id": "4QKX", "doi": "10.1073/pnas.1410415111", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4QKX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of beta2 adrenoceptor bound to a covalent agonist and an engineered nanobody" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EPE", "GOL", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4S0W", "evidence_id": "EV-PDB-4S0W-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.117 }, "provenance": { "deposit_id": "4S0W", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4S0W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Wild type T4 lysozyme structure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EPE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4W51", "evidence_id": "EV-PDB-4W51-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "4W51", "doi": "10.1073/pnas.1500806112", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4W51" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A with No Ligand Bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BNZ", "EPE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4W52", "evidence_id": "EV-PDB-4W52-1", "mappings": [ { "confidence": "high", "justification": "Title names L99A and benzene (BNZ) is bound in the cavity.", "rule": "t4l-l99a-benzene", "state_id": "T4L-L99A-benzene", "who": "rule:t4l-l99a-benzene" } ], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5001 }, "provenance": { "deposit_id": "4W52", "doi": "10.1073/pnas.1500806112", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4W52" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A with Benzene Bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EPE", "MBN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4W53", "evidence_id": "EV-PDB-4W53-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.56 }, "provenance": { "deposit_id": "4W53", "doi": "10.1073/pnas.1500806112", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4W53" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A with Toluene Bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EPE", "PYJ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4W54", "evidence_id": "EV-PDB-4W54-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7901 }, "provenance": { "deposit_id": "4W54", "doi": "10.1073/pnas.1500806112", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4W54" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A with Ethylbenzene Bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "3H0", "EPE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4W55", "evidence_id": "EV-PDB-4W55-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6401 }, "provenance": { "deposit_id": "4W55", "doi": "10.1073/pnas.1500806112", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4W55" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A with n-Propylbenzene Bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "3GY", "EPE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4W56", "evidence_id": "EV-PDB-4W56-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.63 }, "provenance": { "deposit_id": "4W56", "doi": "10.1073/pnas.1500806112", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4W56" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A with sec-Butylbenzene Bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EPE", "N4B" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4W57", "evidence_id": "EV-PDB-4W57-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6801 }, "provenance": { "deposit_id": "4W57", "doi": "10.1073/pnas.1500806112", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4W57" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A with n-Butylbenzene Bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "3H2", "EPE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4W58", "evidence_id": "EV-PDB-4W58-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "4W58", "doi": "10.1073/pnas.1500806112", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4W58" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A with n-Pentylbenzene Bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "3GZ", "EPE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4W59", "evidence_id": "EV-PDB-4W59-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.39 }, "provenance": { "deposit_id": "4W59", "doi": "10.1073/pnas.1500806112", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4W59" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A with n-Hexylbenzene Bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "0HK" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.1, "salt_mM": null, "temperature_c": -193.15 }, "construct": { "description": "Muscarinic acetylcholine receptor M3,Endolysin,Muscarinic acetylcholine receptor M3 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4U14", "evidence_id": "EV-PDB-4U14-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.57 }, "provenance": { "deposit_id": "4U14", "doi": "10.1016/j.str.2014.08.022", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4U14" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the M3 muscarinic acetylcholine receptor bound to the antagonist tiotropium crystallized with disulfide-stabilized T4 lysozyme (dsT4L)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "TRIM5/cyclophilin A fusion protein/T4 Lysozyme chimera (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4TN3", "evidence_id": "EV-PDB-4TN3-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1989 }, "provenance": { "deposit_id": "4TN3", "doi": "10.1073/pnas.1402448111", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4TN3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the BBox-Coiled-coil region of Rhesus Trim5alpha" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "C-X-C chemokine receptor type 4/Endolysin chimeric protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4RWS", "evidence_id": "EV-PDB-4RWS-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "4RWS", "doi": "10.1126/science.1261064", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4RWS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of CXCR4 and viral chemokine antagonist vMIP-II complex (PSI Community Target)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1PE", "2YB", "DMS", "OLC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Free fatty acid receptor 1,Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4PHU", "evidence_id": "EV-PDB-4PHU-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.332 }, "provenance": { "deposit_id": "4PHU", "doi": "10.1038/nature13494", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4PHU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Human GPR40 bound to allosteric agonist TAK-875" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "2U8", "MES", "OLA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -73.15 }, "construct": { "description": "Metabotropic glutamate receptor 5, Lysozyme, Metabotropic glutamate receptor 5 chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4OO9", "evidence_id": "EV-PDB-4OO9-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "4OO9", "doi": "10.1038/nature13396", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4OO9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the human class C GPCR metabotropic glutamate receptor 5 transmembrane domain in complex with the negative allosteric modulator mavoglurant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1WV", "ALE", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -195.15 }, "construct": { "description": "Lysozyme, Beta-2 adrenergic receptor (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LDO", "evidence_id": "EV-PDB-4LDO-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "4LDO", "doi": "10.1038/nature12572", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LDO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of beta2 adrenoceptor bound to adrenaline and an engineered nanobody" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1PE", "1Q5", "OLA", "OLC", "PGW", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -73.15 }, "construct": { "description": "Corticotropin-releasing factor receptor 1, T4-Lysozyme chimeric construct (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4K5Y", "evidence_id": "EV-PDB-4K5Y-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.977 }, "provenance": { "deposit_id": "4K5Y", "doi": "10.1038/nature12357", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4K5Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of human corticotropin-releasing factor receptor 1 (CRF1R) in complex with the antagonist CP-376395" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Oxysterol-binding protein homolog 3,Endolysin,Oxysterol-binding protein homolog 3 (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4IAP", "evidence_id": "EV-PDB-4IAP-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "4IAP", "doi": "10.1016/j.str.2013.05.007", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4IAP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of PH domain of Osh3 from Saccharomyces cerevisiae" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1DW", "ACT", "BME", "HED", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4I7T", "evidence_id": "EV-PDB-4I7T-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "4I7T", "doi": "10.1021/jm301823g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4I7T" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A/M102H with 2-bromo-5-hydroxybenzaldehyde bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1DV", "ACT", "BME", "HED", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4I7S", "evidence_id": "EV-PDB-4I7S-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.69 }, "provenance": { "deposit_id": "4I7S", "doi": "10.1021/jm301823g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4I7S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A/M102H with 3-trifluoromethyl-5-methyl pyrazole bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1DU", "ACT", "BME", "HED", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4I7R", "evidence_id": "EV-PDB-4I7R-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.52 }, "provenance": { "deposit_id": "4I7R", "doi": "10.1021/jm301823g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4I7R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A/M102H with 2-(pyrazolo-1-yl) ethanol bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1DQ", "ACT", "BME", "HED", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4I7Q", "evidence_id": "EV-PDB-4I7Q-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.58 }, "provenance": { "deposit_id": "4I7Q", "doi": "10.1021/jm301823g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4I7Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A/M102H with 4-trifluoromethylimidazole bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "BME", "ES3", "HED", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4I7P", "evidence_id": "EV-PDB-4I7P-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "4I7P", "doi": "10.1021/jm301823g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4I7P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A/M102H with 4-bromoimidazole bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1DH", "ACT", "BME", "HED", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4I7O", "evidence_id": "EV-PDB-4I7O-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.73 }, "provenance": { "deposit_id": "4I7O", "doi": "10.1021/jm301823g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4I7O" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A/M102H with 2-amino-5-chlorothiazole bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1DJ", "ACT", "BME", "HED", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4I7N", "evidence_id": "EV-PDB-4I7N-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.58 }, "provenance": { "deposit_id": "4I7N", "doi": "10.1021/jm301823g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4I7N" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A/M102H with 1-phenyl-2-propyn-1-ol bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "BME", "HED", "IPH", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4I7L", "evidence_id": "EV-PDB-4I7L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.52 }, "provenance": { "deposit_id": "4I7L", "doi": "10.1021/jm301823g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4I7L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A/M102H with phenol bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "BME", "HED", "MBN", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4I7K", "evidence_id": "EV-PDB-4I7K-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.72 }, "provenance": { "deposit_id": "4I7K", "doi": "10.1021/jm301823g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4I7K" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A/M102H with toluene bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "BME", "BNZ", "HED", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4I7J", "evidence_id": "EV-PDB-4I7J-1", "mappings": [ { "confidence": "high", "justification": "Title names L99A and benzene (BNZ) is bound in the cavity.", "rule": "t4l-l99a-benzene", "state_id": "T4L-L99A-benzene", "who": "rule:t4l-l99a-benzene" } ], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.67 }, "provenance": { "deposit_id": "4I7J", "doi": "10.1021/jm301823g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4I7J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A/M102H with benzene bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Sec-independent protein translocase protein TatC, Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4HTT", "evidence_id": "EV-PDB-4HTT-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 6.8 }, "provenance": { "deposit_id": "4HTT", "doi": "10.1016/j.str.2013.03.004", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4HTT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Twin Arginine Translocase Receptor- TatC in DDM" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EPE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Neurotensin receptor type 1, lysozyme chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4GRV", "evidence_id": "EV-PDB-4GRV-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.802 }, "provenance": { "deposit_id": "4GRV", "doi": "10.1038/nature11558", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4GRV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The crystal structure of the neurotensin receptor NTS1 in complex with neurotensin (8-13)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CAU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4GBR", "evidence_id": "EV-PDB-4GBR-2", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.993 }, "provenance": { "deposit_id": "4GBR", "doi": "10.1371/journal.pone.0046039", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4GBR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "N-Terminal T4 Lysozyme Fusion Facilitates Crystallization of a G Protein Coupled Receptor" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Pesticin, Lysozyme Chimera (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4EXM", "evidence_id": "EV-PDB-4EXM-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "4EXM", "doi": "10.1073/pnas.1203472109", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4EXM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The crystal structure of an engineered phage lysin containing the binding domain of pesticin and the killing domain of T4-lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Pesticin, Lysozyme Chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4EPI", "evidence_id": "EV-PDB-4EPI-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.74 }, "provenance": { "deposit_id": "4EPI", "doi": "10.1073/pnas.1203472109", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4EPI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The crystal structure of pesticin-T4 lysozyme hybrid stabilized by engineered disulfide bonds" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "0R1", "ACT", "BME", "HED", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4EKS", "evidence_id": "EV-PDB-4EKS-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.64 }, "provenance": { "deposit_id": "4EKS", "doi": "10.1073/pnas.1208076109", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4EKS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A/M102H with Isoxazole Bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "BME", "HED", "NPO", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4EKQ", "evidence_id": "EV-PDB-4EKQ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.54 }, "provenance": { "deposit_id": "4EKQ", "doi": "10.1073/pnas.1208076109", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4EKQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A/M102H with 4-Nitrophenol Bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "BME", "HED", "NBZ", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4EKP", "evidence_id": "EV-PDB-4EKP-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.64 }, "provenance": { "deposit_id": "4EKP", "doi": "10.1073/pnas.1208076109", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4EKP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A/M102H with Nitrobenzene Bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EJ4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -195.15 }, "construct": { "description": "Delta-type opioid receptor, Lysozyme chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4EJ4", "evidence_id": "EV-PDB-4EJ4-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.4 }, "provenance": { "deposit_id": "4EJ4", "doi": "10.1038/nature11111", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4EJ4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the delta opioid receptor bound to naltrindole" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1PE", "BF0", "CL", "CLR", "MPG", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -195.15 }, "construct": { "description": "Mu-type opioid receptor, lysozyme chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4DKL", "evidence_id": "EV-PDB-4DKL-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "4DKL", "doi": "10.1038/nature10954", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4DKL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the mu-opioid receptor bound to a morphinan antagonist" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CIT", "JDC", "OLC", "PEG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Kappa-type opioid receptor, Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4DJH", "evidence_id": "EV-PDB-4DJH-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.9 }, "provenance": { "deposit_id": "4DJH", "doi": "10.1038/nature10939", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4DJH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the human kappa opioid receptor in complex with JDTic" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "0HK", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -195.15 }, "construct": { "description": "Muscarinic acetylcholine receptor M3, Lysozyme (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4DAJ", "evidence_id": "EV-PDB-4DAJ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.4 }, "provenance": { "deposit_id": "4DAJ", "doi": "10.1038/nature10867", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4DAJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the M3 Muscarinic Acetylcholine Receptor" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "PESTICIN, LYSOZYME (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4ARJ", "evidence_id": "EV-PDB-4ARJ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.593 }, "provenance": { "deposit_id": "4ARJ", "doi": "10.1074/JBC.M112.362913", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4ARJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of a pesticin (translocation and receptor binding domain) from Y. pestis and T4-lysozyme chimera" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "OLC", "VPX" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -180.15 }, "construct": { "description": "Proteinase-activated receptor 1, Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3VW7", "evidence_id": "EV-PDB-3VW7-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "3VW7", "doi": "10.1038/nature11701", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3VW7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of human protease-activated receptor 1 (PAR1) bound with antagonist vorapaxar at 2.2 angstrom" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ANP", "MG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Dynein heavy chain lysozyme chimera (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4W8F", "evidence_id": "EV-PDB-4W8F-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.541 }, "provenance": { "deposit_id": "4W8F", "doi": "10.1016/j.cell.2014.10.018", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4W8F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the dynein motor domain in the AMPPNP-bound state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ATP" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Phosphatidylinositol 4-kinase type 2-beta,Endolysin,Phosphatidylinositol 4-kinase type 2-beta (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4WTV", "evidence_id": "EV-PDB-4WTV-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "4WTV", "doi": "10.1107/S1399004715009505", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4WTV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the phosphatidylinositol 4-kinase IIbeta" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1PE", "EPE", "FLC", "PEG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Neurotensin receptor type 1, Endolysin chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4XEE", "evidence_id": "EV-PDB-4XEE-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.9 }, "provenance": { "deposit_id": "4XEE", "doi": "10.1038/ncomms8895", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4XEE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of active-like neurotensin receptor" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CIT", "EPE", "GOL", "PEG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Neurotensin receptor type 1, Endolysin chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4XES", "evidence_id": "EV-PDB-4XES-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "4XES", "doi": "10.1038/ncomms8895", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4XES" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of active-like neurotensin receptor" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Oxygen-regulated invasion protein OrgB,Endolysin (chains C,F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4YX7", "evidence_id": "EV-PDB-4YX7-3", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0007 }, "provenance": { "deposit_id": "4YX7", "doi": "10.1038/ncomms8125", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4YX7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Complex of SpaO(SPOA1,2) and OrgB(APAR)::T4lysozyme fusion protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Oxygen-regulated invasion protein OrgB,Endolysin (chains C,F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4YXA", "evidence_id": "EV-PDB-4YXA-3", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.35 }, "provenance": { "deposit_id": "4YXA", "doi": "10.1038/ncomms8125", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4YXA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Complex of SpaO(SPOA1,2 SeMet) and OrgB(APAR)::T4lysozyme fusion protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Chimera protein of human Rhodopsin, mouse S-arrestin, and T4 Endolysin (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4ZWJ", "evidence_id": "EV-PDB-4ZWJ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.302 }, "provenance": { "deposit_id": "4ZWJ", "doi": "10.1038/nature14656", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4ZWJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of rhodopsin bound to arrestin by femtosecond X-ray laser" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin,Claudin-4 (chains A,C,E,G)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5B2G", "evidence_id": "EV-PDB-5B2G-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.5 }, "provenance": { "deposit_id": "5B2G", "doi": "10.1038/srep33632", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5B2G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of human claudin-4 in complex with C-terminal fragment of Clostridium perfringens enterotoxin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "51D", "MES", "OLA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -73.15 }, "construct": { "description": "Metabotropic glutamate receptor 5,Endolysin,Metabotropic glutamate receptor 5 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5CGC", "evidence_id": "EV-PDB-5CGC-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.101 }, "provenance": { "deposit_id": "5CGC", "doi": "10.1021/acs.jmedchem.5b00892", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5CGC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the human class C GPCR metabotropic glutamate receptor 5 transmembrane domain in complex with the negative allosteric modulator 3-chloro-4-fluoro-5-[6-(1H-pyrazol-1-yl)pyrimidin-4-yl]benzonitrile" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "51E", "OLA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -73.15 }, "construct": { "description": "Metabotropic glutamate receptor 5,Endolysin,Metabotropic glutamate receptor 5 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5CGD", "evidence_id": "EV-PDB-5CGD-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.603 }, "provenance": { "deposit_id": "5CGD", "doi": "10.1021/acs.jmedchem.5b00892", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5CGD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the human class C GPCR metabotropic glutamate receptor 5 transmembrane domain in complex with the negative allosteric modulator 3-chloro-5-[6-(5-fluoropyridin-2-yl)pyrimidin-4-yl]benzonitrile - (HTL14242)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "0HK", "EDO", "GOL", "PGE", "Y01" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -195.15 }, "construct": { "description": "Muscarinic acetylcholine receptor M1,Endolysin,Muscarinic acetylcholine receptor M1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5CXV", "evidence_id": "EV-PDB-5CXV-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "5CXV", "doi": "10.1038/nature17188", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5CXV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the human M1 muscarinic acetylcholine receptor bound to antagonist Tiotropium" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "12P", "ACM", "BU1", "CAU", "CLR", "PLM", "SO4", "branched: alpha-D-glucopyranose-(1-4)-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Beta-2 adrenergic receptor,Endolysin,Beta-2 adrenergic receptor (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5D5A", "evidence_id": "EV-PDB-5D5A-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4826 }, "provenance": { "deposit_id": "5D5A", "doi": "10.1107/S2059798315021683", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5D5A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "In meso in situ serial X-ray crystallography structure of the Beta2-adrenergic receptor at 100 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACM", "BU1", "CAU", "CLR", "PLM", "SO4", "branched: alpha-D-glucopyranose-(1-4)-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Beta-2 adrenergic receptor,Endolysin,Beta-2 adrenergic receptor (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5D5B", "evidence_id": "EV-PDB-5D5B-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.8 }, "provenance": { "deposit_id": "5D5B", "doi": "10.1107/S2059798315021683", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5D5B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "In meso X-ray crystallography structure of the Beta2-adrenergic receptor at 100 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "12P", "ACM", "BU1", "CAU", "CLR", "PLM", "SO4", "branched: alpha-D-glucopyranose-(1-4)-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Beta-2 adrenergic receptor,Endolysin,Beta-2 adrenergic receptor (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5D6L", "evidence_id": "EV-PDB-5D6L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "5D6L", "doi": "10.1038/nprot.2017.057", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5D6L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "beta2AR-T4L - CIM" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin,Rhodopsin,S-arrestin (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5DGY", "evidence_id": "EV-PDB-5DGY-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 7.7 }, "provenance": { "deposit_id": "5DGY", "doi": "10.1038/sdata.2016.21", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5DGY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of rhodopsin bound to visual arrestin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "0HK", "EDT", "OLA", "OLC", "P6G", "PG6" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Muscarinic acetylcholine receptor M4,Endolysin,Endolysin,Muscarinic acetylcholine receptor M4 (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5DSG", "evidence_id": "EV-PDB-5DSG-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "5DSG", "doi": "10.1038/nature17188", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5DSG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the M4 muscarinic acetylcholine receptor (M4-mT4L) bound to tiotropium" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "5MV", "OLA", "PE5", "TLA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Glucagon receptor,Endolysin,Glucagon receptor (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5EE7", "evidence_id": "EV-PDB-5EE7-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "5EE7", "doi": "10.1038/nature17414", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5EE7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the human glucagon receptor (GCGR) in complex with the antagonist MK-0893" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Phosphatidylinositol 4-kinase type 2-alpha,Endolysin,Phosphatidylinositol 4-kinase type 2-alpha (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5EUT", "evidence_id": "EV-PDB-5EUT-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.802 }, "provenance": { "deposit_id": "5EUT", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5EUT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of phosphatidyl inositol 4-kinase II alpha in the apo state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EYC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -196.15 }, "construct": { "description": "Endolysin,Immunoglobulin G-binding protein A,Endolysin (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5EWX", "evidence_id": "EV-PDB-5EWX-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "5EWX", "doi": "10.1038/ncomms11031", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5EWX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Fusion protein of T4 lysozyme and B4 domain of protein A from staphylococcal aureus with chemical cross-linker EY-CBS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HED", "MTN", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "ENDOLYSIN (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5G27", "evidence_id": "EV-PDB-5G27-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.61 }, "provenance": { "deposit_id": "5G27", "doi": "10.1021/JACS.6B05507", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5G27" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at Room Temperature" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endothelin Receptor Subtype-B (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5GLH", "evidence_id": "EV-PDB-5GLH-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "5GLH", "doi": "10.1038/nature19319", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5GLH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Human endothelin receptor type-B in complex with ET-1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NI" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "mutated and truncated T4 lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5I14", "evidence_id": "EV-PDB-5I14-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.745 }, "provenance": { "deposit_id": "5I14", "doi": "10.1002/pro.3162", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5I14" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Truncated and mutated T4 lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AZI", "BME", "CL", "K", "MTN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5JDT", "evidence_id": "EV-PDB-5JDT-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.0 }, "provenance": { "deposit_id": "5JDT", "doi": "10.1021/jacs.6b05507", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5JDT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MPD", "NA", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Superkiller protein 7,Endolysin (chains K)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5JEA", "evidence_id": "EV-PDB-5JEA-11", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.65 }, "provenance": { "deposit_id": "5JEA", "doi": "10.1016/j.molcel.2016.05.028", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5JEA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of a cytoplasmic 11-subunit RNA exosome complex including Ski7, bound to RNA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "K", "PO4", "V1A" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5JGN", "evidence_id": "EV-PDB-5JGN-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.534 }, "provenance": { "deposit_id": "5JGN", "doi": "10.1021/acs.biochem.6b00608", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5JGN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Spin-Labeled T4 Lysozyme Construct I9V1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HEZ", "K", "PO4", "V1A" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5JGR", "evidence_id": "EV-PDB-5JGR-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.46 }, "provenance": { "deposit_id": "5JGR", "doi": "10.1021/acs.biochem.6b00608", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5JGR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Spin-Labeled T4 Lysozyme Construct K43V1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "K", "PO4", "V1A" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5JGU", "evidence_id": "EV-PDB-5JGU-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.468 }, "provenance": { "deposit_id": "5JGU", "doi": "10.1021/acs.biochem.6b00608", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5JGU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Spin-Labeled T4 Lysozyme Construct R119V1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HEZ", "K", "V1A" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5JGV", "evidence_id": "EV-PDB-5JGV-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.732 }, "provenance": { "deposit_id": "5JGV", "doi": "10.1021/acs.biochem.6b00608", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5JGV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Spin-Labeled T4 Lysozyme Construct A73V1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "K", "PO4", "V1A" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5JGX", "evidence_id": "EV-PDB-5JGX-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.533 }, "provenance": { "deposit_id": "5JGX", "doi": "10.1021/acs.biochem.6b00608", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5JGX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Spin-Labeled T4 Lysozyme Construct V131V1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HEZ", "K", "PO4", "V1A" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5JGZ", "evidence_id": "EV-PDB-5JGZ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.534 }, "provenance": { "deposit_id": "5JGZ", "doi": "10.1021/acs.biochem.6b00608", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5JGZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Spin-Labeled T4 Lysozyme Construct T151V1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CAU", "CLR" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -193.15 }, "construct": { "description": "Endolysin,Beta-2 adrenergic receptor (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5JQH", "evidence_id": "EV-PDB-5JQH-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "5JQH", "doi": "10.1038/nature18636", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5JQH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of beta2 adrenoceptor bound to carazolol and inactive-state stabilizing nanobody, Nb60" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "6OQ", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5JWS", "evidence_id": "EV-PDB-5JWS-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "5JWS", "doi": "10.1021/jacs.6b06566", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5JWS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A with 1-Hydro-2-ethyl-1,2-azaborine Bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BNZ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5JWT", "evidence_id": "EV-PDB-5JWT-1", "mappings": [ { "confidence": "high", "justification": "Title names L99A and benzene (BNZ) is bound in the cavity.", "rule": "t4l-l99a-benzene", "state_id": "T4L-L99A-benzene", "who": "rule:t4l-l99a-benzene" } ], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.41 }, "provenance": { "deposit_id": "5JWT", "doi": "10.1021/jacs.6b06566", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5JWT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A/M102Q with Benzene Bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "6OQ", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5JWW", "evidence_id": "EV-PDB-5JWW-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.47 }, "provenance": { "deposit_id": "5JWW", "doi": "10.1021/jacs.6b06566", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5JWW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A/M102Q with 1-Hydro-2-ethyl-1,2-azaborine Bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HEZ", "K", "V1A" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KGR", "evidence_id": "EV-PDB-5KGR-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.473 }, "provenance": { "deposit_id": "5KGR", "doi": "10.1021/acs.biochem.6b00608", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KGR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Spin-Labeled T4 Lysozyme Construct I9V1/V131V1 (30 days)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KHZ", "evidence_id": "EV-PDB-5KHZ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.49 }, "provenance": { "deposit_id": "5KHZ", "doi": "10.1021/acs.biochem.7b00022", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KHZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PSEUDO T4 LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KI2", "evidence_id": "EV-PDB-5KI2-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "5KI2", "doi": "10.1021/acs.biochem.7b00022", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KI2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PSEUDO T4 LYSOZYME MUTANT - Y18PHE-METHYL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KI3", "evidence_id": "EV-PDB-5KI3-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "5KI3", "doi": "10.1021/acs.biochem.7b00022", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KI3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PSEUDO T4 LYSOZYME MUTANT - Y18PHE-BR" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KI8", "evidence_id": "EV-PDB-5KI8-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "5KI8", "doi": "10.1021/acs.biochem.7b00022", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KI8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PSEUDO T4 LYSOZYME MUTANT - Y88PHE-BR" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KIM", "evidence_id": "EV-PDB-5KIM-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "5KIM", "doi": "10.1021/acs.biochem.7b00022", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KIM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PSEUDO T4 LYSOZYME MUTANT - Y88PHE-I" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "HED", "K", "PO4", "RXR" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5LWO", "evidence_id": "EV-PDB-5LWO-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.183 }, "provenance": { "deposit_id": "5LWO", "doi": "10.1021/acs.jpclett.6b02971", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5LWO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Spin-labelled T4 lysozyme mutant L115C-R119C-R1 at 100K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "6XQ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Free fatty acid receptor 1,Lysozyme,Free fatty acid receptor 1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KW2", "evidence_id": "EV-PDB-5KW2-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.76 }, "provenance": { "deposit_id": "5KW2", "doi": "10.1038/s41467-017-01240-w", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KW2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The extra-helical binding site of GPR40 and the structural basis for allosteric agonism and incretin stimulation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KIO", "evidence_id": "EV-PDB-5KIO-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.63 }, "provenance": { "deposit_id": "5KIO", "doi": "10.1021/acs.biochem.7b00022", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KIO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PSEUDO T4 LYSOZYME MUTANT - Y18PHE-I" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KII", "evidence_id": "EV-PDB-5KII-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.56 }, "provenance": { "deposit_id": "5KII", "doi": "10.1021/acs.biochem.7b00022", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KII" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PSEUDO T4 LYSOZYME MUTANT - Y88PHE-METHYL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KIG", "evidence_id": "EV-PDB-5KIG-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "5KIG", "doi": "10.1021/acs.biochem.7b00022", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KIG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PSEUDO T4 LYSOZYME MUTANT - Y88F" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KI1", "evidence_id": "EV-PDB-5KI1-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.46 }, "provenance": { "deposit_id": "5KI1", "doi": "10.1021/acs.biochem.7b00022", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KI1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PSEUDO T4 LYSOZYME MUTANT - Y18F" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PYJ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5JWV", "evidence_id": "EV-PDB-5JWV-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "5JWV", "doi": "10.1021/jacs.6b06566", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5JWV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A/M102Q with Ethylbenzene Bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "B20", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5JWU", "evidence_id": "EV-PDB-5JWU-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5JWU", "doi": "10.1021/jacs.6b06566", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5JWU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A/M102Q with 1,2-Dihydro-1,2-azaborine Bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "OLA", "OLC", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.3, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endothelin Receptor Subtype-B (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5GLI", "evidence_id": "EV-PDB-5GLI-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "5GLI", "doi": "10.1038/nature19319", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5GLI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Human endothelin receptor type-B in the ligand-free form" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Flagellar assembly protein H,Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4YXC", "evidence_id": "EV-PDB-4YXC-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "4YXC", "doi": "10.1038/ncomms8125", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4YXC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Complex of FliM(SPOA)::FliN fusion protein and FliH(APAR)::T4lysozyme fusion protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5LZM", "evidence_id": "EV-PDB-5LZM-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "5LZM", "doi": "10.1002/prot.340100103", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5LZM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "COMPARISON OF THE CRYSTAL STRUCTURE OF BACTERIOPHAGE T4 LYSOZYME AT LOW, MEDIUM, AND HIGH IONIC STRENGTHS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "8TZ", "NA", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme,Proteinase-activated receptor 2,Soluble cytochrome b562,Proteinase-activated receptor 2 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5NDD", "evidence_id": "EV-PDB-5NDD-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.801 }, "provenance": { "deposit_id": "5NDD", "doi": "10.1038/nature22309", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5NDD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of a thermostabilised human protease-activated receptor-2 (PAR2) in complex with AZ8838 at 2.8 angstrom resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "8UN", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme,Proteinase-activated receptor 2,Soluble cytochrome b562,Proteinase-activated receptor 2 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5NDZ", "evidence_id": "EV-PDB-5NDZ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.6 }, "provenance": { "deposit_id": "5NDZ", "doi": "10.1038/nature22309", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5NDZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of a thermostabilised human protease-activated receptor-2 (PAR2) in complex with AZ3451 at 3.6 angstrom resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "PEG", "TCE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -183.15 }, "construct": { "description": "Neurotensin receptor type 1,Endolysin,Neurotensin receptor type 1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5T04", "evidence_id": "EV-PDB-5T04-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.3 }, "provenance": { "deposit_id": "5T04", "doi": "10.1038/srep38564", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5T04" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURE OF CONSTITUTIVELY ACTIVE NEUROTENSIN RECEPTOR" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "73R", "OLC", "SO4", "VT5", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.1, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Chimera protein of CC chemokine receptor type 2 isoform B and T4-lysozyme,Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5T1A", "evidence_id": "EV-PDB-5T1A-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.806 }, "provenance": { "deposit_id": "5T1A", "doi": "10.1038/nature20605", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5T1A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of CC Chemokine Receptor 2 with Orthosteric and Allosteric Antagonists" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1PE", "MK6", "MLI", "NA", "OLC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Free fatty acid receptor 1,Endolysin,Free fatty acid receptor 1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5TZR", "evidence_id": "EV-PDB-5TZR-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "5TZR", "doi": "10.1038/nsmb.3417", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5TZR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GPR40 in complex with partial agonist MK-8666" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "7OS", "MK6", "OLC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Free fatty acid receptor 1,Endolysin,Free fatty acid receptor 1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5TZY", "evidence_id": "EV-PDB-5TZY-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.22 }, "provenance": { "deposit_id": "5TZY", "doi": "10.1038/nsmb.3417", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5TZY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "GPR40 in complex with AgoPAM AP8 and partial agonist MK-8666" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5V7D", "evidence_id": "EV-PDB-5V7D-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "5V7D", "doi": "10.1021/acs.biochem.8b00603", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5V7D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme Y18Ymbr" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5V7E", "evidence_id": "EV-PDB-5V7E-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.36 }, "provenance": { "deposit_id": "5V7E", "doi": "10.1021/acs.biochem.8b00603", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5V7E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme Y18Ymcl" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HED" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5V7F", "evidence_id": "EV-PDB-5V7F-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "5V7F", "doi": "10.1021/acs.biochem.8b00603", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5V7F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme Y18Ymi" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "8Z7" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme,DCN1-like protein 1 chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5V83", "evidence_id": "EV-PDB-5V83-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.002 }, "provenance": { "deposit_id": "5V83", "doi": "10.1038/nchembio.2386", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5V83" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of DCN1 bound to NAcM-HIT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "8ZA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme,DCN1-like protein 1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5V86", "evidence_id": "EV-PDB-5V86-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.374 }, "provenance": { "deposit_id": "5V86", "doi": "10.1038/nchembio.2386", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5V86" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of DCN1 bound to NAcM-OPT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "8ZD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme,DCN1-like protein 1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5V88", "evidence_id": "EV-PDB-5V88-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.601 }, "provenance": { "deposit_id": "5V88", "doi": "10.1038/nchembio.2386", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5V88" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of DCN1 bound to NAcM-COV" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme, ESX-1 secretion-associated protein EspG1 chimera (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5VBA", "evidence_id": "EV-PDB-5VBA-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.27 }, "provenance": { "deposit_id": "5VBA", "doi": "10.1016/j.jmb.2018.11.003", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5VBA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of EspG1 chaperone from the type VII (ESX-1) secretion system determined with the assistance of N-terminal T4 lysozyme fusion" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "97Y", "OLA", "OLC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -196.15 }, "construct": { "description": "Glucagon-like peptide 1 receptor,Endolysin chimera (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5VEW", "evidence_id": "EV-PDB-5VEW-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "5VEW", "doi": "10.1038/nature22378", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5VEW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the human GLP-1 receptor complex with PF-06372222" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "97V" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -196.15 }, "construct": { "description": "Glucagon-like peptide 1 receptor, Endolysin chimera (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5VEX", "evidence_id": "EV-PDB-5VEX-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "5VEX", "doi": "10.1038/nature22378", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5VEX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the human GLP-1 receptor complex with NNC0640" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.2, "salt_mM": null, "temperature_c": -193.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5VNQ", "evidence_id": "EV-PDB-5VNQ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "5VNQ", "doi": "10.1002/pro.3231", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5VNQ" }, "reader": null, "source_kind": "deposit", "technique": "neutron", "title": "Neutron crystallographic structure of perdeuterated T4 lysozyme cysteine-free pseudo-wild type at cryogenic temperature" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "HED", "NA", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5VNR", "evidence_id": "EV-PDB-5VNR-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.631 }, "provenance": { "deposit_id": "5VNR", "doi": "10.1002/pro.3231", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5VNR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of perdeuterated T4 lysozyme cysteine-free pseudo-wild type at cryogenic temperature" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "Endolysin,Rhodopsin,S-arrestin (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5W0P", "evidence_id": "EV-PDB-5W0P-2", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.013 }, "provenance": { "deposit_id": "5W0P", "doi": "10.1016/j.cell.2017.07.002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5W0P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of rhodopsin bound to visual arrestin determined by X-ray free electron laser" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "Endolysin,Rhodopsin,S-arrestin (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5W0P", "evidence_id": "EV-PDB-5W0P-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.013 }, "provenance": { "deposit_id": "5W0P", "doi": "10.1016/j.cell.2017.07.002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5W0P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of rhodopsin bound to visual arrestin determined by X-ray free electron laser" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "OLC", "UKA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Human A2a adenosine receptor T4L chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5WF5", "evidence_id": "EV-PDB-5WF5-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "5WF5", "doi": "10.1016/j.str.2017.12.013", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5WF5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Agonist bound human A2a adenosine receptor with D52N mutation at 2.60 A resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "OLC", "UKA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Human A2a adenosine receptor T4L chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5WF6", "evidence_id": "EV-PDB-5WF6-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.9 }, "provenance": { "deposit_id": "5WF6", "doi": "10.1016/j.str.2017.12.013", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5WF6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Agonist bound human A2a adenosine receptor with S91A mutation at 2.90 A resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "97V", "NAG", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Glucagon receptor,Endolysin,Glucagon receptor (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5XEZ", "evidence_id": "EV-PDB-5XEZ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "5XEZ", "doi": "10.1038/nature22363", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5XEZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Full-length glucagon class B G protein-coupled receptor" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "97V", "NAG", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Glucagon receptor,Endolysin,Glucagon receptor (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5XF1", "evidence_id": "EV-PDB-5XF1-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.19 }, "provenance": { "deposit_id": "5XF1", "doi": "10.1038/nature22363", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5XF1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the Full-length glucagon class B G protein-coupled receptor" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "HEZ", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5XPF", "evidence_id": "EV-PDB-5XPF-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.04 }, "provenance": { "deposit_id": "5XPF", "doi": "10.1002/pro.3230", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5XPF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High-resolution X-ray structure of the T26H mutant of T4 lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K86", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endothelin B receptor,Endolysin,Endothelin B receptor (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5XPR", "evidence_id": "EV-PDB-5XPR-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.6 }, "provenance": { "deposit_id": "5XPR", "doi": "10.1038/nsmb.3450", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5XPR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Human endothelin receptor type-B in complex with antagonist bosentan" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "OLC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysophosphatidic acid receptor 6a,Endolysin,Lysophosphatidic acid receptor 6a (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5XSZ", "evidence_id": "EV-PDB-5XSZ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "5XSZ", "doi": "10.1038/nature23448", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5XSZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of zebrafish lysophosphatidic acid receptor LPA6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "2PE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin/Membrane-anchored lipid-binding protein LAM6 fusion protein (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5YQR", "evidence_id": "EV-PDB-5YQR-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.402 }, "provenance": { "deposit_id": "5YQR", "doi": "10.1073/pnas.1719709115", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5YQR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the PH-like domain of Lam6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "OLC", "PO4", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Glucagon receptor,Endolysin,Glucagon receptor (chains R)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5YQZ", "evidence_id": "EV-PDB-5YQZ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "5YQZ", "doi": "10.1038/nature25153", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5YQZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the glucagon receptor in complex with a glucagon analogue" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "9AF" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Neuropeptide Y receptor type 1,T4 Lysozyme,Neuropeptide Y receptor type 1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5ZBH", "evidence_id": "EV-PDB-5ZBH-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "5ZBH", "doi": "10.1038/s41586-018-0046-x", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5ZBH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The Crystal Structure of Human Neuropeptide Y Y1 Receptor with BMS-193885" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "9AO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Neuropeptide Y receptor type 1,T4 Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5ZBQ", "evidence_id": "EV-PDB-5ZBQ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "5ZBQ", "doi": "10.1038/s41586-018-0046-x", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5ZBQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The Crystal Structure of human neuropeptide Y Y1 receptor with UR-MK299" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "9EC", "CIT", "P6G", "PG4", "branched: alpha-D-glucopyranose-(1-4)-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Muscarinic acetylcholine receptor M3,Endolysin,Endolysin,Muscarinic acetylcholine receptor M3 (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5ZHP", "evidence_id": "EV-PDB-5ZHP-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "5ZHP", "doi": "10.1073/pnas.1813988115", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5ZHP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "M3 muscarinic acetylcholine receptor in complex with a selective antagonist" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "9EU", "OLC", "SO4", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Platelet-activating factor receptor,Endolysin,Endolysin,Platelet-activating factor receptor (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5ZKQ", "evidence_id": "EV-PDB-5ZKQ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.9 }, "provenance": { "deposit_id": "5ZKQ", "doi": "10.1038/s41594-018-0068-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5ZKQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the human platelet-activating factor receptor in complex with ABT-491" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "IHP", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "COP9 signalosome complex subunit 2,Endolysin (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6A73", "evidence_id": "EV-PDB-6A73-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.447 }, "provenance": { "deposit_id": "6A73", "doi": "10.1073/pnas.1911998117", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6A73" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Complex structure of CSN2 with IP6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -193.15 }, "construct": { "description": "Endolysin,Autophagy-related protein 2 (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6A9E", "evidence_id": "EV-PDB-6A9E-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.205 }, "provenance": { "deposit_id": "6A9E", "doi": "10.1038/s41594-019-0203-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6A9E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the N-terminal domain of Atg2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PEE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -193.15 }, "construct": { "description": "Endolysin,Autophagy-related protein 2 (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6A9J", "evidence_id": "EV-PDB-6A9J-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "6A9J", "doi": "10.1038/s41594-019-0203-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6A9J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the PE-bound N-terminal domain of Atg2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DOJ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin, DCN1-like protein 1 chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6BG3", "evidence_id": "EV-PDB-6BG3-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.05 }, "provenance": { "deposit_id": "6BG3", "doi": "10.1021/acs.jmedchem.7b01277", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6BG3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl acetate bound to DCN1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DQD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin, DCN1-like protein 1 chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6BG5", "evidence_id": "EV-PDB-6BG5-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "6BG5", "doi": "10.1021/acs.jmedchem.7b01277", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6BG5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of 1-(benzo[d][1,3]dioxol-5-ylmethyl)-1-(1-propylpiperidin-4-yl)-3-(3-(trifluoromethyl)phenyl)urea bound to DCN1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "8NU", "OLA", "PEG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "D(2) dopamine receptor, endolysin chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6CM4", "evidence_id": "EV-PDB-6CM4-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.867 }, "provenance": { "deposit_id": "6CM4", "doi": "10.1038/nature25758", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6CM4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the D2 Dopamine Receptor Bound to the Atypical Antipsychotic Drug Risperidone" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FSY", "OLA", "PGE", "PGO", "SIN", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Prostaglandin D2 receptor 2, Endolysin chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D26", "evidence_id": "EV-PDB-6D26-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.798 }, "provenance": { "deposit_id": "6D26", "doi": "10.1016/j.molcel.2018.08.009", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D26" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the prostaglandin D2 receptor CRTH2 with fevipiprant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "GMP", "GOL", "GTP", "MG", "POP" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Fusion protein of Endolysin,Response receiver sensor diguanylate cyclase, GAF domain-containing (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D9M", "evidence_id": "EV-PDB-6D9M-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "6D9M", "doi": "10.7554/eLife.43959", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D9M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4-Lysozyme fusion to Geobacter GGDEF" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "D7W", "MES", "OLA", "OLC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Metabotropic glutamate receptor 5,Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6FFH", "evidence_id": "EV-PDB-6FFH-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.65 }, "provenance": { "deposit_id": "6FFH", "doi": "10.1021/acs.jmedchem.7b01722", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6FFH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of mGluR5 in complex with Fenobam at 2.65 A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "D8B", "MES", "OLA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Metabotropic glutamate receptor 5,Endolysin,Metabotropic glutamate receptor 5 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6FFI", "evidence_id": "EV-PDB-6FFI-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "6FFI", "doi": "10.1021/acs.jmedchem.7b01722", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6FFI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of mGluR5 in complex with MMPEP at 2.2 A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "B3P", "MOO", "MTV", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Mitochondrial amidoxime-reducing component 1,Endolysin,Mitochondrial amidoxime-reducing component 1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6FW2", "evidence_id": "EV-PDB-6FW2-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.78 }, "provenance": { "deposit_id": "6FW2", "doi": "10.1073/pnas.1808576115", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6FW2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of human mARC1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.16, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin,Calcium uptake protein 2, mitochondrial (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6IIH", "evidence_id": "EV-PDB-6IIH-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.958 }, "provenance": { "deposit_id": "6IIH", "doi": "10.15252/embr.201847488", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6IIH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "crystal structure of mitochondrial calcium uptake 2(MICU2)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GBQ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Substance-P receptor,Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6J20", "evidence_id": "EV-PDB-6J20-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "6J20", "doi": "10.1038/s41467-019-08568-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6J20" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the human NK1 substance P receptor" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GBQ", "OLC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Substance-P receptor,Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6J21", "evidence_id": "EV-PDB-6J21-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "6J21", "doi": "10.1038/s41467-019-08568-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6J21" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the human NK1 substance P receptor" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FT4", "MES", "OLA", "PEG", "PGE", "PGO", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Prostaglandin D2 receptor 2, Endolysin chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D27", "evidence_id": "EV-PDB-6D27-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.738 }, "provenance": { "deposit_id": "6D27", "doi": "10.1016/j.molcel.2018.08.009", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D27" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the prostaglandin D2 receptor CRTH2 with CAY10471" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5XPE", "evidence_id": "EV-PDB-5XPE-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.648 }, "provenance": { "deposit_id": "5XPE", "doi": "10.1002/pro.3230", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5XPE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Neutron structure of the T26H mutant of T4 lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CLR", "K87", "OLC", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endothelin B receptor,Endolysin,Endothelin B receptor (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5X93", "evidence_id": "EV-PDB-5X93-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "5X93", "doi": "10.1038/nsmb.3450", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5X93" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Human endothelin receptor type-B in complex with antagonist K-8794" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "8VS", "ACM", "BU1", "CAU", "CLR", "EPE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -195.15 }, "construct": { "description": "Chimera protein of Beta-2 adrenergic receptor and Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5X7D", "evidence_id": "EV-PDB-5X7D-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.703 }, "provenance": { "deposit_id": "5X7D", "doi": "10.1038/nature23652", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5X7D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of beta2 adrenoceptor bound to carazolol and an intracellular allosteric antagonist" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "D2U", "OLC", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endothelin B receptor,Endolysin,Endothelin B receptor (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6K1Q", "evidence_id": "EV-PDB-6K1Q-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "6K1Q", "doi": "10.1038/s42003-019-0482-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6K1Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Human endothelin receptor type-B in complex with inverse agonist IRL2500" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -170.15 }, "construct": { "description": "Engineered T4 lysozyme (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6K69", "evidence_id": "EV-PDB-6K69-2", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.401 }, "provenance": { "deposit_id": "6K69", "doi": "10.1073/pnas.1910080116", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6K69" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Application of anti-helix antibodies in protein structure determination (9213-3LRH)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "97Y", "OLC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -193.15 }, "construct": { "description": "Glucagon-like peptide 1 receptor,Endolysin,Glucagon-like peptide 1 receptor (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6KJV", "evidence_id": "EV-PDB-6KJV-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "6KJV", "doi": "10.1107/S2052252519013496", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6KJV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of thermal-stabilised(M9) human GLP-1 receptor transmembrane domain" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "97Y" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -193.15 }, "construct": { "description": "Glucagon-like peptide 1 receptor,Endolysin,Glucagon-like peptide 1 receptor (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6KK1", "evidence_id": "EV-PDB-6KK1-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "6KK1", "doi": "10.1107/S2052252519013496", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6KK1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of thermal-stabilised(M8) human GLP-1 receptor transmembrane domain" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "97Y" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -193.15 }, "construct": { "description": "Glucagon-like peptide 1 receptor,Endolysin,Glucagon-like peptide 1 receptor (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6KK7", "evidence_id": "EV-PDB-6KK7-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "6KK7", "doi": "10.1107/S2052252519013496", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6KK7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of thermal-stabilised(M6) human GLP-1 receptor transmembrane domain" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6LZM", "evidence_id": "EV-PDB-6LZM-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "6LZM", "doi": "10.1002/prot.340100103", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6LZM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "COMPARISON OF THE CRYSTAL STRUCTURE OF BACTERIOPHAGE T4 LYSOZYME AT LOW, MEDIUM, AND HIGH IONIC STRENGTHS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "J9P", "OLA", "OLC", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Prostaglandin E2 receptor EP3 subtype, Endolysin chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6M9T", "evidence_id": "EV-PDB-6M9T-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "6M9T", "doi": "10.1038/s41589-018-0160-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6M9T" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of EP3 receptor bound to misoprostol-FA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HTO", "K5Y", "MG", "NI", "OLA", "OLC", "P33" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -196.15 }, "construct": { "description": "Endolysin, Beta-2 adrenergic receptor chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6MXT", "evidence_id": "EV-PDB-6MXT-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.95934213525 }, "provenance": { "deposit_id": "6MXT", "doi": "10.1038/s41589-018-0145-x", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6MXT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of human beta2 adrenergic receptor bound to salmeterol and Nb71" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin,Transcription intermediary factor 1-beta (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QAJ", "evidence_id": "EV-PDB-6QAJ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.901 }, "provenance": { "deposit_id": "6QAJ", "doi": "10.1073/pnas.1901318116", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QAJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the tripartite motif of KAP1/TRIM28" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6U0B", "evidence_id": "EV-PDB-6U0B-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.951 }, "provenance": { "deposit_id": "6U0B", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6U0B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Neutron crystal structure of wtT4LD" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin,CB1 cannabinoid receptor-interacting protein 1 fusion (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6WSK", "evidence_id": "EV-PDB-6WSK-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "6WSK", "doi": "10.1016/j.jbc.2021.101099", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6WSK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of the Cannabinoid Receptor 1 Interacting Protein 1a (CRIP1a)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "CL", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "T4Lnano,Endolysin,Calmodulin,Endolysin,Calmodulin-1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6XYR", "evidence_id": "EV-PDB-6XYR-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.079 }, "provenance": { "deposit_id": "6XYR", "doi": "10.1016/j.str.2021.09.002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6XYR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the T4Lnano fusion protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EPE", "OLA", "OLC", "PGE", "PO4", "QJT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Muscarinic acetylcholine receptor M1,Endolysin,Muscarinic acetylcholine receptor M1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6ZFZ", "evidence_id": "EV-PDB-6ZFZ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.17 }, "provenance": { "deposit_id": "6ZFZ", "doi": "10.1016/j.cell.2021.11.001", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6ZFZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of M1-StaR-T4L in complex with 77-LH-28-1 at 2.17A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "OLA", "PGE", "PO4", "QK8" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Muscarinic acetylcholine receptor M1,Endolysin,Muscarinic acetylcholine receptor M1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6ZG4", "evidence_id": "EV-PDB-6ZG4-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.33 }, "provenance": { "deposit_id": "6ZG4", "doi": "10.1016/j.cell.2021.11.001", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6ZG4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of M1-StaR-T4L in complex with HTL0009936 at 2.35A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EPE", "OLA", "PO4", "QK2" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Muscarinic acetylcholine receptor M1,Endolysin,Muscarinic acetylcholine receptor M1 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6ZG9", "evidence_id": "EV-PDB-6ZG9-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "6ZG9", "doi": "10.1016/j.cell.2021.11.001", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6ZG9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of M1-StaR-T4L in complex with GSK1034702 at 2.5A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Vpr protein fused to T4 lysozyme (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6ZX9", "evidence_id": "EV-PDB-6ZX9-3", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5197288426 }, "provenance": { "deposit_id": "6ZX9", "doi": "10.1371/journal.ppat.1009775", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6ZX9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of SIV Vpr,fused to T4 lysozyme, isolated from moustached monkey, bound to human DDB1 and human DCAF1 (amino acid residues 1046-1396)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7DWS", "evidence_id": "EV-PDB-7DWS-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "7DWS", "doi": "10.1016/j.biomaterials.2021.120895", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7DWS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The structure of T4 Lysozyme I3C/C54T/R125C/E128C complex with Zinc ions" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1OE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Fusion protein of Cholecystokinin receptor type A and Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7F8U", "evidence_id": "EV-PDB-7F8U-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "7F8U", "doi": "10.1038/s41589-021-00866-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7F8U" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the cholecystokinin receptor CCKAR in complex with lintitript" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Cholecystokinin receptor type A,Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7F8X", "evidence_id": "EV-PDB-7F8X-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "7F8X", "doi": "10.1038/s41589-021-00866-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7F8X" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the cholecystokinin receptor CCKAR in complex with NN9056" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1OZ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "fusion protein of Cholecystokinin receptor type A and Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7F8Y", "evidence_id": "EV-PDB-7F8Y-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "7F8Y", "doi": "10.1038/s41589-021-00866-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7F8Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the cholecystokinin receptor CCKAR in complex with devazepide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "TRS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 4.85 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7L37", "evidence_id": "EV-PDB-7L37-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.439 }, "provenance": { "deposit_id": "7L37", "doi": "10.1039/d1sc02751d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7L37" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A - Apo - RT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "TRS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7L38", "evidence_id": "EV-PDB-7L38-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.33 }, "provenance": { "deposit_id": "7L38", "doi": "10.1039/d1sc02751d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7L38" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A - Apo - cryo" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "MBN", "TRS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 4.85 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7L39", "evidence_id": "EV-PDB-7L39-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "7L39", "doi": "10.1039/d1sc02751d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7L39" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A - toluene - RT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MBN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7L3A", "evidence_id": "EV-PDB-7L3A-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.11 }, "provenance": { "deposit_id": "7L3A", "doi": "10.1039/d1sc02751d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7L3A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A - toluene - cryo" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "PIH", "TRS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 4.85 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7L3B", "evidence_id": "EV-PDB-7L3B-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.27 }, "provenance": { "deposit_id": "7L3B", "doi": "10.1039/d1sc02751d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7L3B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A - iodobenzene - RT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "OXE", "TRS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 4.85 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7L3C", "evidence_id": "EV-PDB-7L3C-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.31 }, "provenance": { "deposit_id": "7L3C", "doi": "10.1039/d1sc02751d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7L3C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A - o-xylene - RT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "TRS", "XQJ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 4.85 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7L3D", "evidence_id": "EV-PDB-7L3D-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "7L3D", "doi": "10.1039/d1sc02751d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7L3D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A - 3-iodotoluene - RT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "TRS", "XQJ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7L3E", "evidence_id": "EV-PDB-7L3E-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.13 }, "provenance": { "deposit_id": "7L3E", "doi": "10.1039/d1sc02751d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7L3E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A - 3-iodotoluene - cryo" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "TRS", "XQM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 4.85 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7L3F", "evidence_id": "EV-PDB-7L3F-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.49 }, "provenance": { "deposit_id": "7L3F", "doi": "10.1039/d1sc02751d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7L3F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A - 4-iodotoluene - RT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CA", "TRS", "XQM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7L3G", "evidence_id": "EV-PDB-7L3G-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.27 }, "provenance": { "deposit_id": "7L3G", "doi": "10.1039/d1sc02751d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7L3G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A - 4-iodotoluene - cryo" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "PYJ", "TRS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 4.85 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7L3H", "evidence_id": "EV-PDB-7L3H-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.39 }, "provenance": { "deposit_id": "7L3H", "doi": "10.1039/d1sc02751d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7L3H" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A - ethylbenzene - RT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "3H0", "CL", "TRS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 4.85 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7L3I", "evidence_id": "EV-PDB-7L3I-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.46 }, "provenance": { "deposit_id": "7L3I", "doi": "10.1039/d1sc02751d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7L3I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A - propylbenzene - RT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "J0Z", "TRS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 4.85 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7L3J", "evidence_id": "EV-PDB-7L3J-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.49 }, "provenance": { "deposit_id": "7L3J", "doi": "10.1039/d1sc02751d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7L3J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A - benzylacetate - RT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "CL", "J0Z", "TRS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7L3K", "evidence_id": "EV-PDB-7L3K-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.11 }, "provenance": { "deposit_id": "7L3K", "doi": "10.1039/d1sc02751d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7L3K" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A - benzylacetate - cryo" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "TRS", "Y7V" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LOA", "evidence_id": "EV-PDB-7LOA-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.07 }, "provenance": { "deposit_id": "7LOA", "doi": "10.1073/pnas.2106195118", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LOA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme mutant L99A in complex with 3-fluoroiodobenzene" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "TRS", "ZNV" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LOB", "evidence_id": "EV-PDB-7LOB-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "7LOB", "doi": "10.1073/pnas.2106195118", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LOB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme mutant L99A in complex with 1-fluoro-2-[(prop-2-en-1-yl)oxy]benzene" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "TRS", "Y87" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LOC", "evidence_id": "EV-PDB-7LOC-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.16 }, "provenance": { "deposit_id": "7LOC", "doi": "10.1073/pnas.2106195118", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LOC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme mutant L99A in complex with 1-bromanyl-4-fluoranyl-benzene" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "TRS", "Y8D" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LOD", "evidence_id": "EV-PDB-7LOD-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.02 }, "provenance": { "deposit_id": "7LOD", "doi": "10.1073/pnas.2106195118", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LOD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "TRS", "Y8G" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LOF", "evidence_id": "EV-PDB-7LOF-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.05 }, "provenance": { "deposit_id": "7LOF", "doi": "10.1073/pnas.2106195118", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LOF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme mutant L99A in complex with 2-butylthiophene" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EPE", "Y8M" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LOJ", "evidence_id": "EV-PDB-7LOJ-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "7LOJ", "doi": "10.1073/pnas.2106195118", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LOJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme mutant L99A in complex with 4-(3-phenylpropyl)aniline" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "TRS", "YGG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LX6", "evidence_id": "EV-PDB-7LX6-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.05 }, "provenance": { "deposit_id": "7LX6", "doi": "10.1073/pnas.2106195118", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LX6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme mutant L99A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "TRS", "YGJ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LX7", "evidence_id": "EV-PDB-7LX7-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.05 }, "provenance": { "deposit_id": "7LX7", "doi": "10.1073/pnas.2106195118", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LX7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme mutant L99A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "TRS", "YGV" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LX8", "evidence_id": "EV-PDB-7LX8-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.03 }, "provenance": { "deposit_id": "7LX8", "doi": "10.1073/pnas.2106195118", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LX8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme mutant L99A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "TRS", "YGM" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LX9", "evidence_id": "EV-PDB-7LX9-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.19 }, "provenance": { "deposit_id": "7LX9", "doi": "10.1073/pnas.2106195118", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LX9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme mutant L99A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "T4 LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LZM", "evidence_id": "EV-PDB-7LZM-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "7LZM", "doi": "10.1002/prot.340100103", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LZM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "COMPARISON OF THE CRYSTAL STRUCTURE OF BACTERIOPHAGE T4 LYSOZYME AT LOW, MEDIUM, AND HIGH IONIC STRENGTHS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ATP", "MG", "ZG7" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Fusion protein of Dynein and Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7MI3", "evidence_id": "EV-PDB-7MI3-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.5 }, "provenance": { "deposit_id": "7MI3", "doi": "10.1016/j.chembiol.2021.04.024", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7MI3" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Signal subtracted reconstruction of AAA2, AAA3, and AAA4 domains of dynein in the presence of a pyrazolo-pyrimidinone-based compound, Model 4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BME", "TRS", "Y84" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LOE", "evidence_id": "EV-PDB-7LOE-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.01 }, "provenance": { "deposit_id": "7LOE", "doi": "10.1073/pnas.2106195118", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LOE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6U0F", "evidence_id": "EV-PDB-6U0F-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.053 }, "provenance": { "deposit_id": "6U0F", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6U0F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Neutron crystal structure of T4L L99AE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6U0C", "evidence_id": "EV-PDB-6U0C-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "6U0C", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6U0C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Neutron crystal structure of wtT4LE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "E3R" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Cannabinoid receptor 2,Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6KPC", "evidence_id": "EV-PDB-6KPC-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "6KPC", "doi": "10.1016/j.cell.2020.01.008", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6KPC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of an agonist bound GPCR" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Fusion protein of Dynein and Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7MI8", "evidence_id": "EV-PDB-7MI8-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.7 }, "provenance": { "deposit_id": "7MI8", "doi": "10.1016/j.chembiol.2021.04.024", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7MI8" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Signal subtracted reconstruction of AAA5 and AAA6 domains of dynein in the presence of a pyrazolo-pyrimidinone-based compound, Model 5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "4YI" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Metabotropic glutamate receptor 5,Endolysin,Metabotropic glutamate receptor 5 (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7P2L", "evidence_id": "EV-PDB-7P2L-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.54 }, "provenance": { "deposit_id": "7P2L", "doi": "10.1016/j.celrep.2021.109648", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7P2L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "thermostabilised 7TM domain of human mGlu5 receptor bound to photoswitchable ligand alloswitch-1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein, Endolysin chimera (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7RX9", "evidence_id": "EV-PDB-7RX9-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.22 }, "provenance": { "deposit_id": "7RX9", "doi": "10.1038/s41594-022-00804-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7RX9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of autoinhibited P-Rex1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "fusion protein of Sterol uptake control protein 2 and Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7XB5", "evidence_id": "EV-PDB-7XB5-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.44 }, "provenance": { "deposit_id": "7XB5", "doi": "10.1038/s41589-022-01117-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7XB5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the ligand-binding domain of S. cerevisiae Upc2 in fusion with T4 lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GJ6", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -193.15 }, "construct": { "description": "Endolysin,Beta-2 adrenergic receptor (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7XK9", "evidence_id": "EV-PDB-7XK9-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.4 }, "provenance": { "deposit_id": "7XK9", "doi": "10.1038/s41467-023-37808-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7XK9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of human beta2 adrenergic receptor bound to constrained isoproterenol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "G1I", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -193.15 }, "construct": { "description": "Endolysin,Beta-2 adrenergic receptor (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7XKA", "evidence_id": "EV-PDB-7XKA-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "7XKA", "doi": "10.1038/s41467-023-37808-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7XKA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of human beta2 adrenergic receptor bound to constrained epinephrine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin,Transcription intermediary factor 1-beta,Isoform 2 of Transcription intermediary factor 1-beta (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7Z36", "evidence_id": "EV-PDB-7Z36-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "7Z36", "doi": "10.15252/embj.2022111179", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7Z36" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the KAP1 tripartite motif in complex with the ZNF93 KRAB domain" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "L6A" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Phosphatidylinositol 4-kinase type 2-beta,Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8A5X", "evidence_id": "EV-PDB-8A5X-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "8A5X", "doi": "10.1016/j.bmcl.2022.129010", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8A5X" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of phosphatidyl inositol 4-kinase II beta in complex with MM1373" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "Y00" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Endolysin,Endolysin,Beta-1 adrenergic receptor chimera (chains R)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8DCR", "evidence_id": "EV-PDB-8DCR-5", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "8DCR", "doi": "10.1038/s41467-022-31823-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8DCR" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of dobutamine-bound beta1-adrenergic receptor in complex with heterotrimeric Gs-protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "P32" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Endolysin,Endolysin,Beta-1 adrenergic receptor chimera (chains R)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8DCS", "evidence_id": "EV-PDB-8DCS-5", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "8DCS", "doi": "10.1038/s41467-022-31823-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8DCS" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of cyanopindolol-bound beta1-adrenergic receptor in complex with heterotrimeric Gs-protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HXA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Free fatty acid receptor 1 (chains R)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8EIT", "evidence_id": "EV-PDB-8EIT-5", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "8EIT", "doi": "10.1073/pnas.2219569120", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8EIT" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of FFAR1-Gq complex bound to DHA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CGZ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Endolysin,Alpha-1A adrenergic receptor (chains R)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8THK", "evidence_id": "EV-PDB-8THK-5", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "8THK", "doi": "10.1038/s41467-023-40524-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8THK" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of A61603-bound alpha-1A-adrenergic receptor in complex with heterotrimeric Gq-protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ALE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Endolysin,Alpha-1A adrenergic receptor (chains R)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8THL", "evidence_id": "EV-PDB-8THL-5", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "8THL", "doi": "10.1038/s41467-023-40524-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8THL" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of epinephrine-bound alpha-1A-adrenergic receptor in complex with heterotrimeric Gq-protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NGI" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Endolysin,Adenosine receptor A2a (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8UGW", "evidence_id": "EV-PDB-8UGW-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.9 }, "provenance": { "deposit_id": "8UGW", "doi": "10.1038/s41557-024-01719-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8UGW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Computational design of highly signaling active membrane receptors through de novo solvent-mediated allosteric networks" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1AE2", "AV0" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -193.15 }, "construct": { "description": "Beta-2 adrenergic receptor,Endolysin (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8W1V", "evidence_id": "EV-PDB-8W1V-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "8W1V", "doi": "10.1021/acs.jmedchem.4c00578", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8W1V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The beta2 adrenergic receptor bound to a bitopic ligand" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1LYQ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Endolysin,Sphingosine 1-phosphate receptor 1 (chains R)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8YIC", "evidence_id": "EV-PDB-8YIC-4", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.47 }, "provenance": { "deposit_id": "8YIC", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8YIC" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "SAR247799-bound S1PR1-Gi protein complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "T4L (chains A)", "labels": [] }, "data_format": "mmCIF/IHM", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9A08", "evidence_id": "EV-PDB-9A08-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "9A08", "doi": "10.1038/s41467-020-19023-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9A08" }, "reader": null, "source_kind": "deposit", "technique": "integrative", "title": "Structures of multiple states of the T4 lysozyme resolved by FRET with kinetics for free enzyme state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ALE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Endolysin,Alpha-2A adrenergic receptor (chains R)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9CBL", "evidence_id": "EV-PDB-9CBL-4", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "9CBL", "doi": "10.1038/s12276-024-01296-x", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9CBL" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of epinephrine-bound alpha-2A-adrenergic receptor in complex with heterotrimeric Gi-protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CZX" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Endolysin,Alpha-2A adrenergic receptor (chains R)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9CBM", "evidence_id": "EV-PDB-9CBM-4", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.2 }, "provenance": { "deposit_id": "9CBM", "doi": "10.1038/s12276-024-01296-x", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9CBM" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of dexmedetomidine-bound alpha-2A-adrenergic receptor in complex with heterotrimeric Gi-protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "4YI", "OLA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Metabotropic glutamate receptor 5,Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9HC0", "evidence_id": "EV-PDB-9HC0-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.33 }, "provenance": { "deposit_id": "9HC0", "doi": "10.1002/pro.70104", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9HC0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Dark structure of the human metabotropic glutamate receptor 5 transmembrane domain bound to photoswitchable ligand alloswitch-1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1IVA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Phosphatidylinositol 4-kinase type 2-beta,Endolysin (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9HHM", "evidence_id": "EV-PDB-9HHM-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.25 }, "provenance": { "deposit_id": "9HHM", "doi": "10.1016/j.bmc.2026.118666", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9HHM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of phosphatidyl inositol 4-kinase II beta in complex with HH5129" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1SY" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.65, "salt_mM": null, "temperature_c": -193.15 }, "construct": { "description": "Endolysin,Stimulator of interferon genes (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9Q1F", "evidence_id": "EV-PDB-9Q1F-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.65 }, "provenance": { "deposit_id": "9Q1F", "doi": "10.1101/2025.09.04.674280", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9Q1F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Choanoflagellate Salpingoeca macrocollata STING" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "12P", "A1JHU", "CLR", "EDO", "GOL", "OLC", "PLM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Beta-2 adrenergic receptor,Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RKH", "evidence_id": "EV-PDB-9RKH-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "9RKH", "doi": "10.1002/anie.202517995", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RKH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Dark structure of beta-2 Adrenergic receptor with photoazolol in Dark state recorded at LCLS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "12P", "1PE", "A1JHU", "ACM", "CLR", "EDO", "GOL", "OLC", "PLM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Beta-2 adrenergic receptor,Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RKI", "evidence_id": "EV-PDB-9RKI-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "9RKI", "doi": "10.1002/anie.202517995", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RKI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mixed model refinement of beta-2 Adrenergic receptor with photoazolol in dark state and Light state, 17 nanoseconds after light activation, recorded at LCLS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BER" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Beta-2 adrenergic receptor,Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9W3F", "evidence_id": "EV-PDB-9W3F-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.04 }, "provenance": { "deposit_id": "9W3F", "doi": "10.1038/s41421-026-00892-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9W3F" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the human beta2-adrenergic receptor in complex with a novel antagonist" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "12P", "1PE", "A1JHU", "ACM", "CLR", "EDO", "GOL", "OLC", "PLM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Beta-2 adrenergic receptor,Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RKG", "evidence_id": "EV-PDB-9RKG-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.45 }, "provenance": { "deposit_id": "9RKG", "doi": "10.1002/anie.202517995", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RKG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mixed model refinement of beta-2 Adrenergic receptor with photoazolol in dark state and Light state, 10 seconds after light activation, recorded at SwissFEL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "12P", "1PE", "A1JHU", "CLR", "EDO", "GOL", "OLC", "PLM", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Beta-2 adrenergic receptor,Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RKF", "evidence_id": "EV-PDB-9RKF-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.45 }, "provenance": { "deposit_id": "9RKF", "doi": "10.1002/anie.202517995", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RKF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Dark structure of beta-2 Adrenergic receptor with photoazolol in Dark state recorded at SwissFEL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "OLA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Metabotropic glutamate receptor 5,Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9HC3", "evidence_id": "EV-PDB-9HC3-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.9 }, "provenance": { "deposit_id": "9HC3", "doi": "10.1002/pro.70104", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9HC3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Apo-state structure of the human metabotropic glutamate receptor 5 transmembrane domain freeze-trapped after light activation of photoswitchable ligand alloswitch-1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "B20", "BME", "HED", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7SJ6", "evidence_id": "EV-PDB-7SJ6-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.72 }, "provenance": { "deposit_id": "7SJ6", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7SJ6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "T4 Lysozyme L99A/M102H with 1,2-Azaborine bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ATP", "MG", "ZG7" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Fusion protein of Dynein and Endolysin (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7MI6", "evidence_id": "EV-PDB-7MI6-1", "mappings": [], "molecule_id": "P00720", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.9 }, "provenance": { "deposit_id": "7MI6", "doi": "10.1016/j.chembiol.2021.04.024", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7MI6" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Yeast dynein motor domain in the presence of a pyrazolo-pyrimidinone-based compound, Model 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 5.5, "salt_mM": null, "temperature_c": 33.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=17603", "evidence_id": "EV-BMRB-17603", "mappings": [], "molecule_id": "P00720", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr17603", "doi": "10.13018/BMR17603", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=17603" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Solution Structure of a Minor and Transiently Formed State of a T4 Lysozyme Mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 5.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 13C chemical shifts, 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=17604", "evidence_id": "EV-BMRB-17604", "mappings": [], "molecule_id": "P00720", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr17604", "doi": "10.13018/BMR17604", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=17604" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Solution Structure of a Minor and Transiently Formed State of a T4 Lysozyme Mutant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 5.6, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "BMRB data: 15N chemical shifts, 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=915", "evidence_id": "EV-BMRB-915", "mappings": [], "molecule_id": "P00720", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr915", "doi": "10.13018/BMR915", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=915" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Assignment of the Backbone 1H and 15N NMR Resonances of Bacteriophage T4 Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_silico", "ions": [], "ligands": [], "notes": "Simulation; temperature is the thermostat setting.", "ph": null, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "start 1P36; Amber Parm99", "labels": [] }, "data_format": "trajectory", "data_level": "processed", "data_link": "https://mmb.mddbr.eu/#/id/A00WI/overview", "evidence_id": "EV-MDDB-A00WI", "mappings": [], "molecule_id": "P00720", "observable": { "type": "trajectory", "uncertainty": null, "unit": "ns", "value": 10.0 }, "provenance": { "deposit_id": "A00WI", "doi": "10.1016/j.str.2010.07.013", "licence": "This trajectory dataset is released under a Creative Commons Attribution 4.0 International Public License", "retrieved": "2026-10-19", "source": "MDDB", "url": "https://mmb.mddbr.eu/#/id/A00WI/overview" }, "reader": null, "source_kind": "computed", "technique": "md", "title": "MoDEL 1P36" } ], "models": [ { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-2LZM-1" ], "file": "models/P00720/T4L-WT.cif", "format": "mmCIF", "model_id": "T4L-WT-cif", "molecule_id": "P00720", "provenance": { "deposit_id": "2LZM", "doi": "10.1016/0022-2836(87)90636-X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/2LZM.cif" }, "state_id": "T4L-WT" }, { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-2LZM-1" ], "file": "models/P00720/T4L-WT.pdb", "format": "PDB", "model_id": "T4L-WT-pdb", "molecule_id": "P00720", "provenance": { "deposit_id": "2LZM", "doi": "10.1016/0022-2836(87)90636-X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/2LZM.pdb" }, "state_id": "T4L-WT" }, { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-3DMV-1" ], "file": "models/P00720/T4L-L99A-apo.cif", "format": "mmCIF", "model_id": "T4L-L99A-apo-cif", "molecule_id": "P00720", "provenance": { "deposit_id": "3DMV", "doi": "10.1016/j.jmb.2008.10.086", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/3DMV.cif" }, "state_id": "T4L-L99A-apo" }, { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-3DMV-1" ], "file": "models/P00720/T4L-L99A-apo.pdb", "format": "PDB", "model_id": "T4L-L99A-apo-pdb", "molecule_id": "P00720", "provenance": { "deposit_id": "3DMV", "doi": "10.1016/j.jmb.2008.10.086", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/3DMV.pdb" }, "state_id": "T4L-L99A-apo" }, { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-1L83-1" ], "file": "models/P00720/T4L-L99A-benzene.cif", "format": "mmCIF", "model_id": "T4L-L99A-benzene-cif", "molecule_id": "P00720", "provenance": { "deposit_id": "1L83", "doi": "10.1038/355371a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/1L83.cif" }, "state_id": "T4L-L99A-benzene" }, { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-1L83-1" ], "file": "models/P00720/T4L-L99A-benzene.pdb", "format": "PDB", "model_id": "T4L-L99A-benzene-pdb", "molecule_id": "P00720", "provenance": { "deposit_id": "1L83", "doi": "10.1038/355371a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/1L83.pdb" }, "state_id": "T4L-L99A-benzene" } ], "molecule": { "components": [], "domains": [], "gene": "E", "identifiers": { "genbank": null, "isoform": null, "nakb": null, "pdb": [], "rfam": null, "rnacentral": null, "uniprot": "P00720" }, "ligands": [ "substrate" ], "modifications": [], "molecule_id": "P00720", "molecule_type": "protein", "name": "Endolysin", "organism": { "name": "Enterobacteria phage T4", "taxon_id": 10665 }, "provenance": { "deposit_id": "P00720", "doi": null, "licence": "CC BY 4.0 (UniProt)", "retrieved": "2026-10-19", "source": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P00720/entry" }, "sequence": "MNIFEMLRIDERLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSIWYNQTPNRAKRVITTFRTGTWDAYKNL", "sequence_length": 164 }, "molecule_id": "P00720", "states": [ { "assumptions": [], "basis": "observed", "description": "Wild-type-like hydrophobic core, as in 2LZM.", "family_label": null, "molecule_id": "P00720", "name": "wild type", "parent_state": null, "population": null, "provenance": { "deposit_id": null, "doi": null, "licence": "Project licence (pending decision)", "retrieved": "2026-10-19", "source": "Conformome curation (P00720.yaml)", "url": "https://github.com/matth55/conformome/blob/HEAD/curation/P00720.yaml" }, "representative_model": "T4L-WT-cif", "secondary_structure": null, "state_id": "T4L-WT", "status": "draft" }, { "assumptions": [], "basis": "observed", "description": "Cavity-containing L99A mutant without bound ligand, as in 3DMV.", "family_label": null, "molecule_id": "P00720", "name": "L99A cavity, ligand-free", "parent_state": null, "population": null, "provenance": { "deposit_id": null, "doi": null, "licence": "Project licence (pending decision)", "retrieved": "2026-10-19", "source": "Conformome curation (P00720.yaml)", "url": "https://github.com/matth55/conformome/blob/HEAD/curation/P00720.yaml" }, "representative_model": "T4L-L99A-apo-cif", "secondary_structure": null, "state_id": "T4L-L99A-apo", "status": "draft" }, { "assumptions": [], "basis": "observed", "description": "Cavity-containing L99A mutant with buried benzene, as in 1L83.", "family_label": null, "molecule_id": "P00720", "name": "L99A cavity with buried benzene", "parent_state": null, "population": null, "provenance": { "deposit_id": null, "doi": null, "licence": "Project licence (pending decision)", "retrieved": "2026-10-19", "source": "Conformome curation (P00720.yaml)", "url": "https://github.com/matth55/conformome/blob/HEAD/curation/P00720.yaml" }, "representative_model": "T4L-L99A-benzene-cif", "secondary_structure": null, "state_id": "T4L-L99A-benzene", "status": "draft" } ], "transitions": [] }