{ "conflicts": [ { "conflict_id": "CF-HEWL-native-radius_of_gyration-EV-SASBDB-SASDMC2-EV-SASBDB-SASDMD2", "evidence_ids": [ "EV-SASBDB-SASDMC2", "EV-SASBDB-SASDMD2" ], "observable_type": "radius_of_gyration", "reason": "differ by 0.074 nm, beyond combined uncertainty 0.0618", "state_id": "HEWL-native", "uncertainties": [ 0.054, 0.03 ], "unit": "nm", "values": [ 1.322, 1.396 ] }, { "conflict_id": "CF-HEWL-native-radius_of_gyration-EV-SASBDB-SASDMC2-EV-SASBDB-SASDME2", "evidence_ids": [ "EV-SASBDB-SASDMC2", "EV-SASBDB-SASDME2" ], "observable_type": "radius_of_gyration", "reason": "differ by 0.096 nm, beyond combined uncertainty 0.0604", "state_id": "HEWL-native", "uncertainties": [ 0.054, 0.027 ], "unit": "nm", "values": [ 1.322, 1.418 ] }, { "conflict_id": "CF-HEWL-native-radius_of_gyration-EV-SASBDB-SASDMC2-EV-SASBDB-SASDMF2", "evidence_ids": [ "EV-SASBDB-SASDMC2", "EV-SASBDB-SASDMF2" ], "observable_type": "radius_of_gyration", "reason": "differ by 0.118 nm, beyond combined uncertainty 0.0613", "state_id": "HEWL-native", "uncertainties": [ 0.054, 0.029 ], "unit": "nm", "values": [ 1.322, 1.44 ] }, { "conflict_id": "CF-HEWL-native-radius_of_gyration-EV-SASBDB-SASDMC2-EV-SASBDB-SASDMG2", "evidence_ids": [ "EV-SASBDB-SASDMC2", "EV-SASBDB-SASDMG2" ], "observable_type": "radius_of_gyration", "reason": "differ by 0.132 nm, beyond combined uncertainty 0.0709", "state_id": "HEWL-native", "uncertainties": [ 0.054, 0.046 ], "unit": "nm", "values": [ 1.322, 1.454 ] }, { "conflict_id": "CF-HEWL-native-radius_of_gyration-EV-SASBDB-SASDMC2-EV-SASBDB-SASDMH2", "evidence_ids": [ "EV-SASBDB-SASDMC2", "EV-SASBDB-SASDMH2" ], "observable_type": "radius_of_gyration", "reason": "differ by 0.075 nm, beyond combined uncertainty 0.0672", "state_id": "HEWL-native", "uncertainties": [ 0.054, 0.04 ], "unit": "nm", "values": [ 1.322, 1.397 ] }, { "conflict_id": "CF-HEWL-native-radius_of_gyration-EV-SASBDB-SASDMC2-EV-SASBDB-SASDMJ2", "evidence_ids": [ "EV-SASBDB-SASDMC2", "EV-SASBDB-SASDMJ2" ], "observable_type": "radius_of_gyration", "reason": "differ by 0.076 nm, beyond combined uncertainty 0.0599", "state_id": "HEWL-native", "uncertainties": [ 0.054, 0.026 ], "unit": "nm", "values": [ 1.322, 1.398 ] }, { "conflict_id": "CF-HEWL-native-radius_of_gyration-EV-SASBDB-SASDMC2-EV-SASBDB-SASDML2", "evidence_ids": [ "EV-SASBDB-SASDMC2", "EV-SASBDB-SASDML2" ], "observable_type": "radius_of_gyration", "reason": "differ by 0.076 nm, beyond combined uncertainty 0.0599", "state_id": "HEWL-native", "uncertainties": [ 0.054, 0.026 ], "unit": "nm", "values": [ 1.322, 1.398 ] }, { "conflict_id": "CF-HEWL-native-radius_of_gyration-EV-SASBDB-SASDMD2-EV-SASBDB-SASDMF2", "evidence_ids": [ "EV-SASBDB-SASDMD2", "EV-SASBDB-SASDMF2" ], "observable_type": "radius_of_gyration", "reason": "differ by 0.044 nm, beyond combined uncertainty 0.0417", "state_id": "HEWL-native", "uncertainties": [ 0.03, 0.029 ], "unit": "nm", "values": [ 1.396, 1.44 ] }, { "conflict_id": "CF-HEWL-native-radius_of_gyration-EV-SASBDB-SASDMD2-EV-SASBDB-SASDMG2", "evidence_ids": [ "EV-SASBDB-SASDMD2", "EV-SASBDB-SASDMG2" ], "observable_type": "radius_of_gyration", "reason": "differ by 0.058 nm, beyond combined uncertainty 0.0549", "state_id": "HEWL-native", "uncertainties": [ 0.03, 0.046 ], "unit": "nm", "values": [ 1.396, 1.454 ] }, { "conflict_id": "CF-HEWL-native-radius_of_gyration-EV-SASBDB-SASDMF2-EV-SASBDB-SASDMJ2", "evidence_ids": [ "EV-SASBDB-SASDMF2", "EV-SASBDB-SASDMJ2" ], "observable_type": "radius_of_gyration", "reason": "differ by 0.042 nm, beyond combined uncertainty 0.0389", "state_id": "HEWL-native", "uncertainties": [ 0.029, 0.026 ], "unit": "nm", "values": [ 1.44, 1.398 ] }, { "conflict_id": "CF-HEWL-native-radius_of_gyration-EV-SASBDB-SASDMF2-EV-SASBDB-SASDML2", "evidence_ids": [ "EV-SASBDB-SASDMF2", "EV-SASBDB-SASDML2" ], "observable_type": "radius_of_gyration", "reason": "differ by 0.042 nm, beyond combined uncertainty 0.0389", "state_id": "HEWL-native", "uncertainties": [ 0.029, 0.026 ], "unit": "nm", "values": [ 1.44, 1.398 ] }, { "conflict_id": "CF-HEWL-native-radius_of_gyration-EV-SASBDB-SASDMG2-EV-SASBDB-SASDMJ2", "evidence_ids": [ "EV-SASBDB-SASDMG2", "EV-SASBDB-SASDMJ2" ], "observable_type": "radius_of_gyration", "reason": "differ by 0.056 nm, beyond combined uncertainty 0.0528", "state_id": "HEWL-native", "uncertainties": [ 0.046, 0.026 ], "unit": "nm", "values": [ 1.454, 1.398 ] }, { "conflict_id": "CF-HEWL-native-radius_of_gyration-EV-SASBDB-SASDMG2-EV-SASBDB-SASDML2", "evidence_ids": [ "EV-SASBDB-SASDMG2", "EV-SASBDB-SASDML2" ], "observable_type": "radius_of_gyration", "reason": "differ by 0.056 nm, beyond combined uncertainty 0.0528", "state_id": "HEWL-native", "uncertainties": [ 0.046, 0.026 ], "unit": "nm", "values": [ 1.454, 1.398 ] }, { "conflict_id": "CF-HEWL-native-radius_of_gyration-EV-SASBDB-SASDMJ4-EV-SASBDB-SASDMY3", "evidence_ids": [ "EV-SASBDB-SASDMJ4", "EV-SASBDB-SASDMY3" ], "observable_type": "radius_of_gyration", "reason": "differ by 8.17 nm, beyond combined uncertainty 0.153", "state_id": "HEWL-native", "uncertainties": [ 0.131, 0.08 ], "unit": "nm", "values": [ 30.226, 38.397 ] }, { "conflict_id": "CF-HEWL-native-radius_of_gyration-EV-SASBDB-SASDPT4-EV-SASBDB-SASDPV4", "evidence_ids": [ "EV-SASBDB-SASDPT4", "EV-SASBDB-SASDPV4" ], "observable_type": "radius_of_gyration", "reason": "differ by 0.22 nm, beyond combined uncertainty 0.075", "state_id": "HEWL-native", "uncertainties": [ 0.054, 0.052 ], "unit": "nm", "values": [ 1.464, 1.244 ] }, { "conflict_id": "CF-HEWL-native-radius_of_gyration-EV-SASBDB-SASDPV4-EV-SASBDB-SASDPZ4", "evidence_ids": [ "EV-SASBDB-SASDPV4", "EV-SASBDB-SASDPZ4" ], "observable_type": "radius_of_gyration", "reason": "differ by 0.184 nm, beyond combined uncertainty 0.0534", "state_id": "HEWL-native", "uncertainties": [ 0.052, 0.012 ], "unit": "nm", "values": [ 1.244, 1.428 ] }, { "conflict_id": "CF-HEWL-native-radius_of_gyration-EV-SASBDB-SASDPV4-EV-SASBDB-SASDUE4", "evidence_ids": [ "EV-SASBDB-SASDPV4", "EV-SASBDB-SASDUE4" ], "observable_type": "radius_of_gyration", "reason": "differ by 0.209 nm, beyond combined uncertainty 0.0547", "state_id": "HEWL-native", "uncertainties": [ 0.052, 0.017 ], "unit": "nm", "values": [ 1.244, 1.453 ] }, { "conflict_id": "CF-HEWL-native-radius_of_gyration-EV-SASBDB-SASDPZ4-EV-SASBDB-SASDUE4", "evidence_ids": [ "EV-SASBDB-SASDPZ4", "EV-SASBDB-SASDUE4" ], "observable_type": "radius_of_gyration", "reason": "differ by 0.025 nm, beyond combined uncertainty 0.0208", "state_id": "HEWL-native", "uncertainties": [ 0.012, 0.017 ], "unit": "nm", "values": [ 1.428, 1.453 ] } ], "coverage": { "cells": { "HEWL-fibril": { "af_prediction": 0, "cryoem": 3, "force_spectroscopy": 0, "md": 0, "microed": 0, "neutron": 0, "nmr_dynamics": 0, "nmr_shifts": 0, "nmr_structure": 0, "saxs_sans": 0, "xray": 4 }, "HEWL-native": { "af_prediction": 1, "cryoem": 5, "force_spectroscopy": 0, "md": 5, "microed": 23, "neutron": 5, "nmr_dynamics": 2, "nmr_shifts": 29, "nmr_structure": 3, "saxs_sans": 28, "xray": 1338 }, "HEWL-unfolded": { "af_prediction": 0, "cryoem": 0, "force_spectroscopy": 13, "md": 0, "microed": 0, "neutron": 0, "nmr_dynamics": 0, "nmr_shifts": 8, "nmr_structure": 0, "saxs_sans": 0, "xray": 0 } }, "data_levels": { "HEWL-fibril": { "cryoem": "processed", "xray": "processed" }, "HEWL-native": { "af_prediction": "processed", "cryoem": "processed", "md": "processed", "microed": "processed", "neutron": "processed", "nmr_dynamics": "processed", "nmr_shifts": "processed", "nmr_structure": "processed", "saxs_sans": "processed", "xray": "processed" }, "HEWL-unfolded": { "force_spectroscopy": "reported", "nmr_shifts": "processed" } }, "single_method_states": [], "states": [ "HEWL-native", "HEWL-unfolded", "HEWL-fibril" ], "techniques": [ "xray", "cryoem", "microed", "neutron", "nmr_structure", "nmr_dynamics", "nmr_shifts", "saxs_sans", "force_spectroscopy", "af_prediction", "md" ], "unmapped_evidence": 17 }, "curation": { "as_of": "2026-10-19", "curator": "draft (unreviewed)", "file": "P00698.yaml", "status": "draft" }, "evidence": [ { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/132L", "evidence_id": "EV-PDB-132L-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "132L", "doi": "10.1021/bi00088a041", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/132L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL CONSEQUENCES OF REDUCTIVE METHYLATION OF LYSINE RESIDUES IN HEN EGG WHITE LYSOZYME: AN X-RAY ANALYSIS AT 1.8 ANGSTROMS RESOLUTION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.3, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/193L", "evidence_id": "EV-PDB-193L-1", "mappings": [ { "confidence": "high", "justification": "Representative native structure; title and UniProt mapping checked against RCSB.", "rule": "curator_assignment", "state_id": "HEWL-native", "who": "curator:draft (unreviewed)" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.33 }, "provenance": { "deposit_id": "193L", "doi": "10.1107/S090744499501674X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/193L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE 1.33 A STRUCTURE OF TETRAGONAL HEN EGG WHITE LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.3, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/194L", "evidence_id": "EV-PDB-194L-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "194L", "doi": "10.1107/S090744499501674X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/194L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE 1.40 A STRUCTURE OF SPACEHAB-01 HEN EGG WHITE LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1A2Y", "evidence_id": "EV-PDB-1A2Y-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "1A2Y", "doi": "10.1021/bi980148j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1A2Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEN EGG WHITE LYSOZYME, D18A MUTANT, IN COMPLEX WITH MOUSE MONOCLONAL ANTIBODY D1.3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.48, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1AKI", "evidence_id": "EV-PDB-1AKI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "1AKI", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1AKI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE STRUCTURE OF THE ORTHORHOMBIC FORM OF HEN EGG-WHITE LYSOZYME AT 1.5 ANGSTROMS RESOLUTION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.2, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1AT5", "evidence_id": "EV-PDB-1AT5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1AT5", "doi": "10.1006/jmbi.1998.1674", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1AT5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEN EGG WHITE LYSOZYME WITH A SUCCINIMIDE RESIDUE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1AT6", "evidence_id": "EV-PDB-1AT6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1AT6", "doi": "10.1006/jmbi.1998.1674", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1AT6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEN EGG WHITE LYSOZYME WITH A ISOASPARTATE RESIDUE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BR" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1AZF", "evidence_id": "EV-PDB-1AZF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1AZF", "doi": "10.1107/S0907444998002844", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1AZF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CHICKEN EGG WHITE LYSOZYME CRYSTAL GROWN IN BROMIDE SOLUTION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "TSU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1B0D", "evidence_id": "EV-PDB-1B0D-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.84 }, "provenance": { "deposit_id": "1B0D", "doi": "10.1107/S0907444901004504", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1B0D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structural effects of monovalent anions on polymorphic lysozyme crystals" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 9.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1BGI", "evidence_id": "EV-PDB-1BGI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1BGI", "doi": "10.1107/S0907444998008713", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1BGI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ORTHORHOMBIC LYSOZYME CRYSTALLIZED AT HIGH TEMPERATURE (310K)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "LYSOZYME (chains C,F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1BVK", "evidence_id": "EV-PDB-1BVK-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.7 }, "provenance": { "deposit_id": "1BVK", "doi": "10.1084/jem.187.4.479", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1BVK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HUMANIZED ANTI-LYSOZYME FV COMPLEXED WITH LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1BVX", "evidence_id": "EV-PDB-1BVX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1BVX", "doi": "10.1107/S0907444998016047", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1BVX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE 1.8 A STRUCTURE OF GEL GROWN TETRAGONAL HEN EGG WHITE LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1BWH", "evidence_id": "EV-PDB-1BWH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1BWH", "doi": "10.1107/S0907444998016047", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1BWH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE 1.8 A STRUCTURE OF GROUND CONTROL GROWN TETRAGONAL HEN EGG WHITE LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1BWI", "evidence_id": "EV-PDB-1BWI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1BWI", "doi": "10.1107/S0907444998016047", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1BWI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE 1.8 A STRUCTURE OF MICROBATCH OIL DROP GROWN TETRAGONAL HEN EGG WHITE LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1BWJ", "evidence_id": "EV-PDB-1BWJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1BWJ", "doi": "10.1107/S0907444998016047", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1BWJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE 1.8 A STRUCTURE OF MICROGRAVITY GROWN TETRAGONAL HEN EGG WHITE LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.6, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "LYSOZYME (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C08", "evidence_id": "EV-PDB-1C08-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "1C08", "doi": "10.1074/jbc.274.39.27623", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C08" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF HYHEL-10 FV-HEN LYSOZYME COMPLEX" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MRD", "TRS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1DPW", "evidence_id": "EV-PDB-1DPW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.64 }, "provenance": { "deposit_id": "1DPW", "doi": "10.1107/S0907444900006685", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1DPW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURE OF HEN EGG-WHITE LYSOZYME IN COMPLEX WITH MPD" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1DPX", "evidence_id": "EV-PDB-1DPX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "1DPX", "doi": "10.1107/S0907444900006685", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1DPX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURE OF HEN EGG-WHITE LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1DQJ", "evidence_id": "EV-PDB-1DQJ-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1DQJ", "doi": "10.1021/bi000054l", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1DQJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF THE ANTI-LYSOZYME ANTIBODY HYHEL-63 COMPLEXED WITH HEN EGG WHITE LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1F0W", "evidence_id": "EV-PDB-1F0W-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1F0W", "doi": "10.1107/S0907444900008866", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1F0W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF ORTHORHOMBIC LYSOZYME GROWN AT PH 6.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1F10", "evidence_id": "EV-PDB-1F10-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1F10", "doi": "10.1107/S0907444900008866", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1F10" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF ORTHORHOMBIC LYSOZYME GROWN AT PH 6.5 AT 88% RELATIVE HUMIDITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NAG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains P,Q)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1F3J", "evidence_id": "EV-PDB-1F3J-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.1 }, "provenance": { "deposit_id": "1F3J", "doi": "10.1016/S1074-7613(00)80220-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1F3J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HISTOCOMPATIBILITY ANTIGEN I-AG7" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1FLQ", "evidence_id": "EV-PDB-1FLQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.801 }, "provenance": { "deposit_id": "1FLQ", "doi": "10.1093/protein/13.10.691", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1FLQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEN EGG WHITE LYSOZYME MUTANT WITH ALANINE SUBSTITUTED FOR GLYCINE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1FLU", "evidence_id": "EV-PDB-1FLU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.785 }, "provenance": { "deposit_id": "1FLU", "doi": "10.1093/protein/13.10.691", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1FLU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEN EGG WHITE LYSOZYME MUTANT WITH ALANINE SUBSTITUTED FOR GLYCINE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1FLW", "evidence_id": "EV-PDB-1FLW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.812 }, "provenance": { "deposit_id": "1FLW", "doi": "10.1093/protein/13.10.691", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1FLW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEN EGG WHITE LYSOZYME MUTANT WITH ALANINE SUBSTITUTED FOR GLYCINE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1FLY", "evidence_id": "EV-PDB-1FLY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.833 }, "provenance": { "deposit_id": "1FLY", "doi": "10.1093/protein/13.10.691", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1FLY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEN EGG WHITE LYSOZYME MUTANT WITH ALANINE SUBSTITUTED FOR GLYCINE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1FN5", "evidence_id": "EV-PDB-1FN5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.78 }, "provenance": { "deposit_id": "1FN5", "doi": "10.1093/protein/13.10.691", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1FN5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEN EGG WHITE LYSOZYME MUTANT WITH ALANINE SUBSTITUTED FOR GLYCINE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1G7H", "evidence_id": "EV-PDB-1G7H-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1G7H", "doi": "10.1021/bi000704l", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1G7H" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF HEN EGG WHITE LYSOZYME (HEL) COMPLEXED WITH THE MUTANT ANTI-HEL MONOCLONAL ANTIBODY D1.3(VLW92A)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME C (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1G7I", "evidence_id": "EV-PDB-1G7I-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1G7I", "doi": "10.1021/bi000704l", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1G7I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF HEN EGG WHITE LYSOZYME (HEL) COMPLEXED WITH THE MUTANT ANTI-HEL MONOCLONAL ANTIBODY D1.3 (VLW92F)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1G7J", "evidence_id": "EV-PDB-1G7J-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "1G7J", "doi": "10.1021/bi000704l", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1G7J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF HEN EGG WHITE LYSOZYME (HEL) COMPLEXED WITH THE MUTANT ANTI-HEL MONOCLONAL ANTIBODY D1.3 (VLW92H)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1G7L", "evidence_id": "EV-PDB-1G7L-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1G7L", "doi": "10.1021/bi000704l", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1G7L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF HEN EGG WHITE LYSOZYME (HEL) COMPLEXED WITH THE MUTANT ANTI-HEL MONOCLONAL ANTIBODY D1.3 (VLW92S)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME C (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1G7M", "evidence_id": "EV-PDB-1G7M-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1G7M", "doi": "10.1021/bi000704l", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1G7M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF HEN EGG WHITE LYSOZYME (HEL) COMPLEXED WITH THE MUTANT ANTI-HEL MONOCLONAL ANTIBODY D1.3 (VLW92V)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1GPQ", "evidence_id": "EV-PDB-1GPQ-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "1GPQ", "doi": "10.1073/PNAS.0611019104", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1GPQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of ivy complexed with its target, HEWL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CMO", "EDO", "IOD", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1GWD", "evidence_id": "EV-PDB-1GWD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.77 }, "provenance": { "deposit_id": "1GWD", "doi": "10.1107/S0907444902005486", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1GWD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Tri-iodide derivative of hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 2.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1GXX", "evidence_id": "EV-PDB-1GXX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "1GXX", "doi": "10.1016/S0022-2836(03)00209-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1GXX" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution structure of lysozyme at low and high pressure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-deoxy-2-fluoro-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1H6M", "evidence_id": "EV-PDB-1H6M-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.64 }, "provenance": { "deposit_id": "1H6M", "doi": "10.1038/35090602", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1H6M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Covalent glycosyl-enzyme intermediate of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "IOD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -123.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1HC0", "evidence_id": "EV-PDB-1HC0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.82 }, "provenance": { "deposit_id": "1HC0", "doi": "10.1107/S090744490501543X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1HC0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "structure of lysozyme with periodate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1HEL", "evidence_id": "EV-PDB-1HEL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1HEL", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1HEL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL AND THERMODYNAMIC ANALYSIS OF COMPENSATING MUTATIONS WITHIN THE CORE OF CHICKEN EGG WHITE LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1HEN", "evidence_id": "EV-PDB-1HEN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1HEN", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1HEN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL AND THERMODYNAMIC ANALYSIS OF COMPENSATING MUTATIONS WITHIN THE CORE OF CHICKEN EGG WHITE LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1HEP", "evidence_id": "EV-PDB-1HEP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1HEP", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1HEP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL AND THERMODYNAMIC ANALYSIS OF COMPENSATING MUTATIONS WITHIN THE CORE OF CHICKEN EGG WHITE LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1HEQ", "evidence_id": "EV-PDB-1HEQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1HEQ", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1HEQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL AND THERMODYNAMIC ANALYSIS OF COMPENSATING MUTATIONS WITHIN THE CORE OF CHICKEN EGG WHITE LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1HEO", "evidence_id": "EV-PDB-1HEO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1HEO", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1HEO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL AND THERMODYNAMIC ANALYSIS OF COMPENSATING MUTATIONS WITHIN THE CORE OF CHICKEN EGG WHITE LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1HEM", "evidence_id": "EV-PDB-1HEM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1HEM", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1HEM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL AND THERMODYNAMIC ANALYSIS OF COMPENSATING MUTATIONS WITHIN THE CORE OF CHICKEN EGG WHITE LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DO3", "GD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1H87", "evidence_id": "EV-PDB-1H87-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.72 }, "provenance": { "deposit_id": "1H87", "doi": "10.1107/S0907444901016444", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1H87" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Gadolinium derivative of tetragonal Hen Egg-White Lysozyme at 1.7 A resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 2.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME C (chains 2)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1GXV", "evidence_id": "EV-PDB-1GXV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "1GXV", "doi": "10.1016/S0022-2836(03)00209-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1GXV" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "Solution structure of lysozyme at low and high pressure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains Y)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1FDL", "evidence_id": "EV-PDB-1FDL-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "1FDL", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1FDL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTALLOGRAPHIC REFINEMENT OF THE THREE-DIMENSIONAL STRUCTURE OF THE FAB D1.3-LYSOZYME COMPLEX AT 2.5-ANGSTROMS RESOLUTION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.8, "salt_mM": null, "temperature_c": 34.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + NMR restraints", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1E8L", "evidence_id": "EV-PDB-1E8L-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "structure", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "1E8L", "doi": "10.1110/ps.43301", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1E8L" }, "reader": null, "source_kind": "deposit", "technique": "nmr_structure", "title": "NMR solution structure of hen lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "XE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1C10", "evidence_id": "EV-PDB-1C10-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.03 }, "provenance": { "deposit_id": "1C10", "doi": "10.1002/(SICI)1097-0134(19980101)30:1<61::AID-PROT6>3.3.CO;2-O", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1C10" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF HEW LYSOZYME UNDER PRESSURE OF XENON (8 BAR)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -149.15 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1BHZ", "evidence_id": "EV-PDB-1BHZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.9 }, "provenance": { "deposit_id": "1BHZ", "doi": "10.1107/S090744499800626X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1BHZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "LOW TEMPERATURE MIDDLE RESOLUTION STRUCTURE OF HEN EGG WHITE LYSOZYME FROM MASC DATA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "IOD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1B2K", "evidence_id": "EV-PDB-1B2K-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "1B2K", "doi": "10.1107/S0907444901004504", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1B2K" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structural effects of monovalent anions on polymorphic lysozyme crystals" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1HEW", "evidence_id": "EV-PDB-1HEW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "1HEW", "doi": "10.1016/0022-2836(92)90548-X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1HEW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "REFINEMENT OF AN ENZYME COMPLEX WITH INHIBITOR BOUND AT PARTIAL OCCUPANCY. HEN EGG-WHITE LYSOZYME AND TRI-N-ACETYLCHITOTRIOSE AT 1.75 ANGSTROMS RESOLUTION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "LYSOZYME (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1HF4", "evidence_id": "EV-PDB-1HF4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "1HF4", "doi": "10.1107/S0907444901004504", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1HF4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL EFFECTS OF MONOVALENT ANIONS ON POLYMORPHIC LYSOZYME CRYSTALS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.6, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1HSX", "evidence_id": "EV-PDB-1HSX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1HSX", "doi": "10.1107/S0907444998015522", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1HSX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "LYSOZYME GROWN AT BASIC PH AND ITS LOW HUMIDITY VARIANT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.6, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "LYSOZYME C (chains Y)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1IC4", "evidence_id": "EV-PDB-1IC4-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "1IC4", "doi": "10.1074/jbc.M100480200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1IC4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF HYHEL-10 FV MUTANT(HD32A)-HEN LYSOZYME COMPLEX" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.6, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "LYSOZYME C (chains Y)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1IC5", "evidence_id": "EV-PDB-1IC5-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "1IC5", "doi": "10.1074/jbc.M100480200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1IC5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF HYHEL-10 FV MUTANT(HD99A)-HEN LYSOZYME COMPLEX" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.6, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "LYSOZYME C (chains Y)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1IC7", "evidence_id": "EV-PDB-1IC7-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1IC7", "doi": "10.1074/jbc.M100480200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1IC7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF HYHEL-10 FV MUTANT(HD32A99A)-HEN LYSOZYME COMPLEX" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1IEE", "evidence_id": "EV-PDB-1IEE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.94 }, "provenance": { "deposit_id": "1IEE", "doi": "10.1107/S0907444901008873", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1IEE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURE OF TETRAGONAL HEN EGG WHITE LYSOZYME AT 0.94 A FROM CRYSTALS GROWN BY THE COUNTER-DIFFUSION METHOD" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1IO5", "evidence_id": "EV-PDB-1IO5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1IO5", "doi": "10.1038/nsb1197-909", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1IO5" }, "reader": null, "source_kind": "deposit", "technique": "neutron", "title": "HYDROGEN AND HYDRATION OF HEN EGG-WHITE LYSOZYME DETERMINED BY NEUTRON DIFFRACTION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1IOR", "evidence_id": "EV-PDB-1IOR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.76 }, "provenance": { "deposit_id": "1IOR", "doi": "10.1110/ps.37401", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1IOR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STABILIZATION OF HEN EGG WHITE LYSOZYME BY A CAVITY-FILLING MUTATION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1IOS", "evidence_id": "EV-PDB-1IOS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.76 }, "provenance": { "deposit_id": "1IOS", "doi": "10.1110/ps.37401", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1IOS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STABILIZATION OF HEN EGG WHITE LYSOZYME BY A CAVITY-FILLING MUTATION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1IOT", "evidence_id": "EV-PDB-1IOT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "1IOT", "doi": "10.1110/ps.37401", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1IOT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STABILIZATION OF HEN EGG WHITE LYSOZYME BY A CAVITY-FILLING MUTATION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1IR7", "evidence_id": "EV-PDB-1IR7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1IR7", "doi": "10.1093/protein/14.6.421", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1IR7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "IM mutant of lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1IR9", "evidence_id": "EV-PDB-1IR9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1IR9", "doi": "10.1093/protein/14.6.421", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1IR9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "IM mutant of lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains Y)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1J1O", "evidence_id": "EV-PDB-1J1O-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1J1O", "doi": "10.1074/jbc.M210182200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1J1O" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of HyHEL-10 Fv mutant LY50F complexed with hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains Y)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1J1P", "evidence_id": "EV-PDB-1J1P-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1J1P", "doi": "10.1074/jbc.M210182200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1J1P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of HyHEL-10 Fv mutant LS91A complexed with hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains Y)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1J1X", "evidence_id": "EV-PDB-1J1X-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1J1X", "doi": "10.1074/jbc.M210182200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1J1X" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of HyHEL-10 Fv mutant LS93A complexed with hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JIS", "evidence_id": "EV-PDB-1JIS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1JIS", "doi": "10.1107/S090744490101280X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JIS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF TETRAGONAL LYSOZYME GROWN AT PH 4.6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JIT", "evidence_id": "EV-PDB-1JIT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1JIT", "doi": "10.1107/S090744490101280X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JIT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF TETRAGONAL LYSOZYME GROWN IN PRESENCE 30% TREHALOSE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JIY", "evidence_id": "EV-PDB-1JIY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1JIY", "doi": "10.1107/S090744490101280X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JIY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF TETRAGONAL LYSOZYME GROWN IN PRESENCE 20% SORBITOL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JJ1", "evidence_id": "EV-PDB-1JJ1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1JJ1", "doi": "10.1107/S090744490101280X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JJ1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF ORTHORHOMBIC LYSOZYME GROWN AT PH 4.6 IN PRESENCE OF 5% SORBITOL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "LYSOZYME (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JJ3", "evidence_id": "EV-PDB-1JJ3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1JJ3", "doi": "10.1107/S090744490101280X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JJ3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF MONOCLINIC LYSOZYME GROWN AT PH 4.6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.4, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme (chains L,M)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JTO", "evidence_id": "EV-PDB-1JTO-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "1JTO", "doi": "10.1006/jmbi.2001.5075", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JTO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Degenerate interfaces in antigen-antibody complexes" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains L)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JTT", "evidence_id": "EV-PDB-1JTT-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1JTT", "doi": "10.1006/jmbi.2001.5075", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JTT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Degenerate interfaces in antigen-antibody complexes" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1KIP", "evidence_id": "EV-PDB-1KIP-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1KIP", "doi": "10.1021/bi961709e", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1KIP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "FV MUTANT Y(B 32)A (VH DOMAIN) OF MOUSE MONOCLONAL ANTIBODY D1.3 COMPLEXED WITH HEN EGG WHITE LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1KIQ", "evidence_id": "EV-PDB-1KIQ-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1KIQ", "doi": "10.1021/bi961709e", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1KIQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "FV MUTANT Y(B 101)F (VH DOMAIN) OF MOUSE MONOCLONAL ANTIBODY D1.3 COMPLEXED WITH HEN EGG WHITE LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1KIR", "evidence_id": "EV-PDB-1KIR-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1KIR", "doi": "10.1021/bi961709e", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1KIR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "FV MUTANT Y(A 50)S (VL DOMAIN) OF MOUSE MONOCLONAL ANTIBODY D1.3 COMPLEXED WITH HEN EGG WHITE LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SCN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": 9.85 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LCN", "evidence_id": "EV-PDB-1LCN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.63 }, "provenance": { "deposit_id": "1LCN", "doi": "10.1107/S0907444901004504", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LCN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Monoclinic hen egg white lysozyme, thiocyanate complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LJE", "evidence_id": "EV-PDB-1LJE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1LJE", "doi": "10.1107/S0907444902007126", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LJE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF MONOCLINIC LYSOZYME GROWN IN PRESENCE OF 10% SUCROSE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LJF", "evidence_id": "EV-PDB-1LJF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1LJF", "doi": "10.1107/S0907444902007126", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LJF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF MONOCLINIC LYSOZYME GROWN IN PRESENCE OF 10% SUCROSE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LJG", "evidence_id": "EV-PDB-1LJG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1LJG", "doi": "10.1107/S0907444902007126", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LJG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF MONOCLINIC LYSOZYME GROWN IN PRESENCE OF 5% GLYCEROL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LJH", "evidence_id": "EV-PDB-1LJH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1LJH", "doi": "10.1107/S0907444902007126", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LJH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF MONOCLINIC LYSOZYME GROWN IN PRESENCE OF 5% GLYCEROL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LJI", "evidence_id": "EV-PDB-1LJI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1LJI", "doi": "10.1107/S0907444902007126", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LJI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF MONOCLINIC LYSOZYME GROWN IN PRESENCE 10% SORBITOL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LJJ", "evidence_id": "EV-PDB-1LJJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1LJJ", "doi": "10.1107/S0907444902007126", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LJJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF MONOCLINIC LYSOZYME GROWN IN PRESENCE OF 10% TREHALOSE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LJK", "evidence_id": "EV-PDB-1LJK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1LJK", "doi": "10.1107/S0907444902007126", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LJK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF MONOCLINIC LYSOZYME GROWN IN PRESENCE OF 15% TREHALOSE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "IOD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LKR", "evidence_id": "EV-PDB-1LKR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "1LKR", "doi": "10.1107/S0907444997016922", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LKR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "MONOCLINIC HEN EGG WHITE LYSOZYME IODIDE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LJ4", "evidence_id": "EV-PDB-1LJ4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "1LJ4", "doi": "10.1107/S0907444902007126", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LJ4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF MONOCLINIC LYSOZYME GROWN AT PH 4.6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LJ3", "evidence_id": "EV-PDB-1LJ3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1LJ3", "doi": "10.1107/S0907444902007126", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LJ3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF MONOCLINIC LYSOZYME GROWN AT PH 4.6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1KXY", "evidence_id": "EV-PDB-1KXY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.79 }, "provenance": { "deposit_id": "1KXY", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1KXY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ANALYSIS OF THE STABILIZATION OF HEN LYSOZYME WITH THE HELIX DIPOLE AND CHARGED SIDE CHAINS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1KXX", "evidence_id": "EV-PDB-1KXX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.71 }, "provenance": { "deposit_id": "1KXX", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1KXX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ANALYSIS OF THE STABILIZATION OF HEN LYSOZYME WITH THE HELIX DIPOLE AND CHARGED SIDE CHAINS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1KXW", "evidence_id": "EV-PDB-1KXW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.96 }, "provenance": { "deposit_id": "1KXW", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1KXW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ANALYSIS OF THE STABILIZATION OF HEN LYSOZYME WITH THE HELIX DIPOLE AND CHARGED SIDE CHAINS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JPO", "evidence_id": "EV-PDB-1JPO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1JPO", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JPO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "LOW TEMPERATURE ORTHORHOMBIC LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "branched: beta-D-fructofuranose-(2-1)-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1JJ0", "evidence_id": "EV-PDB-1JJ0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1JJ0", "doi": "10.1107/S090744490101280X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1JJ0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF TETRAGONAL LYSOZYME GROWN IN PRESENCE of 30% SUCROSE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1IR8", "evidence_id": "EV-PDB-1IR8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.63 }, "provenance": { "deposit_id": "1IR8", "doi": "10.1093/protein/14.6.421", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1IR8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "IM mutant of lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1IOQ", "evidence_id": "EV-PDB-1IOQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.79 }, "provenance": { "deposit_id": "1IOQ", "doi": "10.1110/ps.37401", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1IOQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STABILIZATION OF HEN EGG WHITE LYSOZYME BY A CAVITY-FILLING MUTATION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 9.6, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1HSW", "evidence_id": "EV-PDB-1HSW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1HSW", "doi": "10.1107/S0907444998015522", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1HSW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "LYSOZYME (MUCOPEPTIDE N-ACETYLMURAMYL HYDROLASE)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1HER", "evidence_id": "EV-PDB-1HER-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1HER", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1HER" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURAL AND THERMODYNAMIC ANALYSIS OF COMPENSATING MUTATIONS WITHIN THE CORE OF CHICKEN EGG WHITE LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LKS", "evidence_id": "EV-PDB-1LKS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "1LKS", "doi": "10.1107/S0907444997016922", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LKS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEN EGG WHITE LYSOZYME NITRATE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LMA", "evidence_id": "EV-PDB-1LMA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "1LMA", "doi": "10.1107/S090744499200653X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LMA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PROTEIN HYDRATION AND WATER STRUCTURE: X-RAY ANALYSIS OF A CLOSELY PACKED PROTEIN CRYSTAL WITH VERY LOW SOLVENT CONTENT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 4.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LPI", "evidence_id": "EV-PDB-1LPI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1LPI", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LPI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEW LYSOZYME: TRP...NA CATION-PI INTERACTION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LSA", "evidence_id": "EV-PDB-1LSA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1LSA", "doi": "10.1107/S0907444994009261", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LSA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE INFLUENCE OF TEMPERATURE ON LYSOZYME CRYSTALS. STRUCTURE AND DYNAMICS OF PROTEIN AND WATER" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LSB", "evidence_id": "EV-PDB-1LSB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1LSB", "doi": "10.1107/S0907444994009261", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LSB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE INFLUENCE OF TEMPERATURE ON LYSOZYME CRYSTALS. STRUCTURE AND DYNAMICS OF PROTEIN AND WATER" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LSC", "evidence_id": "EV-PDB-1LSC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1LSC", "doi": "10.1107/S0907444994009261", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LSC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE INFLUENCE OF TEMPERATURE ON LYSOZYME CRYSTALS. STRUCTURE AND DYNAMICS OF PROTEIN AND WATER" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LSD", "evidence_id": "EV-PDB-1LSD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1LSD", "doi": "10.1107/S0907444994009261", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LSD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE INFLUENCE OF TEMPERATURE ON LYSOZYME CRYSTALS. STRUCTURE AND DYNAMICS OF PROTEIN AND WATER" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LSE", "evidence_id": "EV-PDB-1LSE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1LSE", "doi": "10.1107/S0907444994009261", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LSE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE INFLUENCE OF TEMPERATURE ON LYSOZYME CRYSTALS. STRUCTURE AND DYNAMICS OF PROTEIN AND WATER" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LSF", "evidence_id": "EV-PDB-1LSF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1LSF", "doi": "10.1107/S0907444994009261", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LSF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE INFLUENCE OF TEMPERATURE ON LYSOZYME CRYSTALS. STRUCTURE AND DYNAMICS OF PROTEIN AND WATER" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LSG", "evidence_id": "EV-PDB-1LSG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "1LSG", "doi": "10.1073/pnas.91.25.12178", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LSG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THREE-DIMENSIONAL STRUCTURE OF THE PLATELET INTEGRIN RECOGNITION SEGMENT OF THE FIBRINOGEN GAMMA CHAIN OBTAINED BY CARRIER PROTEIN-DRIVEN CRYSTALLIZATION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LSM", "evidence_id": "EV-PDB-1LSM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1LSM", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LSM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THERMAL STABILITY DETERMINANTS OF CHICKEN EGG-WHITE LYSOZYME CORE MUTANTS: HYDROPHOBICITY, PACKING VOLUME AND CONSERVED BURIED WATER MOLECULES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LSN", "evidence_id": "EV-PDB-1LSN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1LSN", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LSN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THERMAL STABILITY DETERMINANTS OF CHICKEN EGG-WHITE LYSOZYME CORE MUTANTS: HYDROPHOBICITY, PACKING VOLUME AND CONSERVED BURIED WATER MOLECULES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LSY", "evidence_id": "EV-PDB-1LSY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1LSY", "doi": "10.1006/jmbi.1994.1688", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LSY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF THE MUTANT D52S HEN EGG WHITE LYSOZYME WITH AN OLIGOSACCHARIDE PRODUCT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LSZ", "evidence_id": "EV-PDB-1LSZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1LSZ", "doi": "10.1006/jmbi.1994.1688", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LSZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF THE MUTANT D52S HEN EGG WHITE LYSOZYME WITH AN OLIGOSACCHARIDE PRODUCT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.3, "salt_mM": null, "temperature_c": 11.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LYO", "evidence_id": "EV-PDB-1LYO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.93 }, "provenance": { "deposit_id": "1LYO", "doi": "10.1016/S0167-4838(98)00027-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LYO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CROSS-LINKED LYSOZYME CRYSTAL IN NEAT WATER" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LYS", "evidence_id": "EV-PDB-1LYS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.72 }, "provenance": { "deposit_id": "1LYS", "doi": "10.1107/S0907444993013290", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LYS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-RAY STRUCTURE OF A MONOCLINIC FORM OF HEN EGG-WHITE LYSOZYME CRYSTALLIZED AT 313K. COMPARISON OF TWO INDEPENDENT MOLECULES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LYZ", "evidence_id": "EV-PDB-1LYZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1LYZ", "doi": "10.1016/0022-2836(74)90598-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LYZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Real-space refinement of the structure of hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -153.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LZ8", "evidence_id": "EV-PDB-1LZ8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.53 }, "provenance": { "deposit_id": "1LZ8", "doi": "10.1006/jmbi.1999.2743", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LZ8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "LYSOZYME PHASED ON ANOMALOUS SIGNAL OF SULFURS AND CHLORINES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BR", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LZ9", "evidence_id": "EV-PDB-1LZ9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1LZ9", "doi": "10.1006/jmbi.1999.2744", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LZ9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ANOMALOUS SIGNAL OF SOLVENT BROMINES USED FOR PHASING OF LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LZB", "evidence_id": "EV-PDB-1LZB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "1LZB", "doi": "10.1006/jmbi.1994.0139", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LZB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DISSECTION OF PROTEIN-CARBOHYDRATE INTERACTIONS IN MUTANT HEN EGG-WHITE LYSOZYME COMPLEXES AND THEIR HYDROLYTIC ACTIVITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LZC", "evidence_id": "EV-PDB-1LZC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1LZC", "doi": "10.1006/jmbi.1994.0139", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LZC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DISSECTION OF PROTEIN-CARBOHYDRATE INTERACTIONS IN MUTANT HEN EGG-WHITE LYSOZYME COMPLEXES AND THEIR HYDROLYTIC ACTIVITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LZD", "evidence_id": "EV-PDB-1LZD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1LZD", "doi": "10.1006/jmbi.1994.0139", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LZD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DISSECTION OF PROTEIN-CARBOHYDRATE INTERACTIONS IN MUTANT HEN EGG-WHITE LYSOZYME COMPLEXES AND THEIR HYDROLYTIC ACTIVITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LZE", "evidence_id": "EV-PDB-1LZE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1LZE", "doi": "10.1006/jmbi.1994.0139", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LZE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DISSECTION OF PROTEIN-CARBOHYDRATE INTERACTIONS IN MUTANT HEN EGG-WHITE LYSOZYME COMPLEXES AND THEIR HYDROLYTIC ACTIVITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LZG", "evidence_id": "EV-PDB-1LZG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1LZG", "doi": "10.1006/jmbi.1994.0139", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LZG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DISSECTION OF PROTEIN-CARBOHYDRATE INTERACTIONS IN MUTANT HEN EGG-WHITE LYSOZYME COMPLEXES AND THEIR HYDROLYTIC ACTIVITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LZH", "evidence_id": "EV-PDB-1LZH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 6.0 }, "provenance": { "deposit_id": "1LZH", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LZH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE STRUCTURES OF THE MONOCLINIC AND ORTHORHOMBIC FORMS OF HEN EGG-WHITE LYSOZYME AT 6 ANGSTROMS RESOLUTION." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "PROTEIN (LYSOZYME) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LZN", "evidence_id": "EV-PDB-1LZN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1LZN", "doi": "10.1107/S0907444998018514", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LZN" }, "reader": null, "source_kind": "deposit", "technique": "neutron", "title": "NEUTRON STRUCTURE OF HEN EGG-WHITE LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LZT", "evidence_id": "EV-PDB-1LZT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.97 }, "provenance": { "deposit_id": "1LZT", "doi": "10.1107/S0108768189009183", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LZT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "REFINEMENT OF TRICLINIC LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains E,F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MLC", "evidence_id": "EV-PDB-1MLC-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "1MLC", "doi": "10.1016/0022-2836(94)90046-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MLC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "MONOCLONAL ANTIBODY FAB D44.1 RAISED AGAINST CHICKEN EGG-WHITE LYSOZYME COMPLEXED WITH LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ASR", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1N4F", "evidence_id": "EV-PDB-1N4F-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.78 }, "provenance": { "deposit_id": "1N4F", "doi": "10.1107/S0907444903003512", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1N4F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Para-Arsanilate Derivative of Hen Egg-White Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1NBY", "evidence_id": "EV-PDB-1NBY-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1NBY", "doi": "10.1021/bi020589+", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1NBY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of HyHEL-63 complexed with HEL mutant K96A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1NBZ", "evidence_id": "EV-PDB-1NBZ-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1NBZ", "doi": "10.1021/bi020589+", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1NBZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of HyHEL-63 complexed with HEL mutant K97A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACY" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1NDG", "evidence_id": "EV-PDB-1NDG-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1NDG", "doi": "10.1038/nsb930", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1NDG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Fab fragment of antibody HyHEL-8 complexed with its antigen lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1PS5", "evidence_id": "EV-PDB-1PS5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1PS5", "doi": "10.1016/S0969-2126(03)00185-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1PS5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURE OF THE MONOCLINIC C2 FORM OF HEN EGG-WHITE LYSOZYME AT 2.0 ANGSTROMS RESOLUTION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QIO", "evidence_id": "EV-PDB-1QIO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "1QIO", "doi": "10.1073/pnas.97.2.623", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QIO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE CAUSED BY INTENSE SYNCHROTRON RADIATION TO HEN EGG WHITE LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "KR", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1QTK", "evidence_id": "EV-PDB-1QTK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.03 }, "provenance": { "deposit_id": "1QTK", "doi": "10.1002/(SICI)1097-0134(19980101)30:1<61::AID-PROT6>3.3.CO;2-O", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1QTK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF HEW LYSOZYME UNDER PRESSURE OF KRYPTON (55 BAR)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1RFP", "evidence_id": "EV-PDB-1RFP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "1RFP", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1RFP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ANALYSIS OF THE STABILIZATION OF HEN LYSOZYME WITH THE HELIX DIPOLE AND CHARGED SIDE CHAINS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1RJC", "evidence_id": "EV-PDB-1RJC-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "1RJC", "doi": "10.1074/jbc.M413011200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1RJC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the camelid single domain antibody cAb-Lys2 in complex with hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA", "RU7" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1T3P", "evidence_id": "EV-PDB-1T3P-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "1T3P", "doi": "10.1039/b408141b", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1T3P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Half-sandwich arene ruthenium(II)-enzyme complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains L)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1SQ2", "evidence_id": "EV-PDB-1SQ2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "1SQ2", "doi": "10.1126/science.1101148", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1SQ2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure Analysis of the Nurse Shark New Antigen Receptor (NAR) Variable Domain in Complex With Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1RI8", "evidence_id": "EV-PDB-1RI8-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1RI8", "doi": "10.1074/jbc.M413011200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1RI8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of the Camelid Single Domain Antibody 1D2L19 in complex with Hen Egg White Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACY" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1RCM", "evidence_id": "EV-PDB-1RCM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1RCM", "doi": "10.1073/pnas.90.9.4136", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1RCM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF A UBIQUITIN-DEPENDENT DEGRADATION SUBSTRATE: A THREE-DISULFIDE FORM OF LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains C,F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1P2C", "evidence_id": "EV-PDB-1P2C-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1P2C", "doi": "10.1073/pnas.0400060101", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1P2C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "crystal structure analysis of an anti-lysozyme antibody" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1NDM", "evidence_id": "EV-PDB-1NDM-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1NDM", "doi": "10.1038/nsb930", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1NDM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Fab fragment of antibody HyHEL-26 complexed with lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.4, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME (chains L,M)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1MEL", "evidence_id": "EV-PDB-1MEL-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "1MEL", "doi": "10.1038/nsb0996-803", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1MEL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF A CAMEL SINGLE-DOMAIN VH ANTIBODY FRAGMENT IN COMPLEX WITH LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1LZA", "evidence_id": "EV-PDB-1LZA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "1LZA", "doi": "10.1006/jmbi.1994.0139", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1LZA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DISSECTION OF PROTEIN-CARBOHYDRATE INTERACTIONS IN MUTANT HEN EGG-WHITE LYSOZYME COMPLEXES AND THEIR HYDROLYTIC ACTIVITY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains L,M)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1T6V", "evidence_id": "EV-PDB-1T6V-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1T6V", "doi": "10.1126/science.1101148", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1T6V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure analysis of the nurse shark new antigen receptor (NAR) variable domain in complex with lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "branched: beta-D-galactopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 9.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1UC0", "evidence_id": "EV-PDB-1UC0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1UC0", "doi": "10.1002/jmr.611", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1UC0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of wild-type hen-egg white lysozyme singly labeled with 2',3'-epoxypropyl beta-glycoside of N-acetyllactosamine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1UIA", "evidence_id": "EV-PDB-1UIA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.76 }, "provenance": { "deposit_id": "1UIA", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1UIA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ANALYSIS OF THE STABILIZATION OF HEN LYSOZYME WITH THE HELIX DIPOLE AND CHARGED SIDE CHAINS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1UIC", "evidence_id": "EV-PDB-1UIC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "1UIC", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1UIC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ANALYSIS OF THE STABILIZATION OF HEN LYSOZYME WITH THE HELIX DIPOLE AND CHARGED SIDE CHAINS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1UID", "evidence_id": "EV-PDB-1UID-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "1UID", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1UID" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ANALYSIS OF THE STABILIZATION OF HEN LYSOZYME WITH THE HELIX DIPOLE AND CHARGED SIDE CHAINS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1UIE", "evidence_id": "EV-PDB-1UIE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "1UIE", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1UIE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ANALYSIS OF THE STABILIZATION OF HEN LYSOZYME WITH THE HELIX DIPOLE AND CHARGED SIDE CHAINS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1UIF", "evidence_id": "EV-PDB-1UIF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "1UIF", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1UIF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ANALYSIS OF THE STABILIZATION OF HEN LYSOZYME WITH THE HELIX DIPOLE AND CHARGED SIDE CHAINS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1UIG", "evidence_id": "EV-PDB-1UIG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "1UIG", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1UIG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ANALYSIS OF THE STABILIZATION OF HEN LYSOZYME WITH THE HELIX DIPOLE AND CHARGED SIDE CHAINS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1UIH", "evidence_id": "EV-PDB-1UIH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "1UIH", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1UIH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ANALYSIS OF THE STABILIZATION OF HEN LYSOZYME WITH THE HELIX DIPOLE AND CHARGED SIDE CHAINS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1UUZ", "evidence_id": "EV-PDB-1UUZ-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1UUZ", "doi": "10.1073/PNAS.0611019104", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1UUZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "IVY:A NEW FAMILY OF PROTEIN" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 16.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1V7S", "evidence_id": "EV-PDB-1V7S-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.14 }, "provenance": { "deposit_id": "1V7S", "doi": "10.1107/S0907444904001805", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1V7S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Triclinic hen lysozyme crystallized at 313K from a D2O solution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "IOD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1VAT", "evidence_id": "EV-PDB-1VAT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "1VAT", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1VAT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Iodine derivative of hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "XE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1VAU", "evidence_id": "EV-PDB-1VAU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "1VAU", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1VAU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Xenon derivative of hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1VDS", "evidence_id": "EV-PDB-1VDS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "1VDS", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1VDS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The crystal structure of the tetragonal form of hen egg white lysozyme at 1.6 angstroms resolution in space" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1VDT", "evidence_id": "EV-PDB-1VDT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1VDT", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1VDT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The crystal structure of the tetragonal form of hen egg white lysozyme at 1.7 angstroms resolution under basic conditions in space" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1VED", "evidence_id": "EV-PDB-1VED-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1VED", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1VED" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The crystal structure of the orthorhombic form of hen egg white lysozyme at 1.9 angstroms resolution in space" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1VFB", "evidence_id": "EV-PDB-1VFB-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1VFB", "doi": "10.1073/pnas.91.3.1089", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1VFB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "BOUND WATER MOLECULES AND CONFORMATIONAL STABILIZATION HELP MEDIATE AN ANTIGEN-ANTIBODY ASSOCIATION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1W6Z", "evidence_id": "EV-PDB-1W6Z-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "1W6Z", "doi": "10.1107/S0021889806036387", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1W6Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High Energy Tetragonal Lysozyme X-ray Structure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1WTN", "evidence_id": "EV-PDB-1WTN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.13 }, "provenance": { "deposit_id": "1WTN", "doi": "10.1107/S0907444904030926", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1WTN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The structure of HEW Lysozyme Orthorhombic Crystal Growth under a High Magnetic Field" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1XEI", "evidence_id": "EV-PDB-1XEI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1XEI", "doi": "10.1002/(SICI)1097-0134(19980801)32:2<229::AID-PROT9>3.0.CO;2-F", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1XEI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE CRYSTAL STRUCTURES OF LYSOZYME AT VERY LOW LEVELS OF HYDRATION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1XEK", "evidence_id": "EV-PDB-1XEK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "1XEK", "doi": "10.1002/(SICI)1097-0134(19980801)32:2<229::AID-PROT9>3.0.CO;2-F", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1XEK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE CRYSTAL STRUCTURES OF LYSOZYME AT VERY LOW LEVELS OF HYDRATION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FMT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains L)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1XFP", "evidence_id": "EV-PDB-1XFP-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "1XFP", "doi": "10.1074/jbc.M407843200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1XFP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the CDR2 germline reversion mutant of cAb-Lys3 in complex with hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1XGP", "evidence_id": "EV-PDB-1XGP-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1XGP", "doi": "10.1016/j.str.2004.12.012", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1XGP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure for antibody HyHEL-63 Y33A mutant complexed with hen egg lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1XGQ", "evidence_id": "EV-PDB-1XGQ-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1XGQ", "doi": "10.1016/j.str.2004.12.012", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1XGQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure for antibody HyHEL-63 Y33V mutant complexed with hen egg lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1XGU", "evidence_id": "EV-PDB-1XGU-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1XGU", "doi": "10.1016/j.str.2004.12.012", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1XGU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure for antibody HyHEL-63 Y33F mutant complexed with hen egg lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "MM1", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1YIK", "evidence_id": "EV-PDB-1YIK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "1YIK", "doi": "10.1073/pnas.0407595102", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1YIK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Hen egg white lysozyme soaked with Cu-cyclam" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MM2", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1YIL", "evidence_id": "EV-PDB-1YIL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "1YIL", "doi": "10.1073/pnas.0407595102", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1YIL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Hen egg white lysozyme soaked with Cu2-Xylylbicyclam" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1BO", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1YKY", "evidence_id": "EV-PDB-1YKY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1YKY", "doi": "10.1107/S0907444905009364", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1YKY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Effect of alcohols on protein hydration" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Hen Egg White Lysozyme (chains Y)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1YQV", "evidence_id": "EV-PDB-1YQV-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1YQV", "doi": "10.1107/S0907444905007870", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1YQV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The crystal structure of the antibody Fab HyHEL5 complex with lysozyme at 1.7A resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1Z55", "evidence_id": "EV-PDB-1Z55-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1Z55", "doi": "10.1107/S0907444905009364", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1Z55" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Effect of alcohols on protein hydration" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains L,M)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1ZMY", "evidence_id": "EV-PDB-1ZMY-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "1ZMY", "doi": "10.1016/j.jmb.2005.07.038", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1ZMY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "cAbBCII-10 VHH framework with CDR loops of cAbLys3 grafted on it and in complex with hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains L)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1ZV5", "evidence_id": "EV-PDB-1ZV5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1ZV5", "doi": "10.1073/pnas.0505379103", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1ZV5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the variable domain of the camelid heavy-chain antibody D2-L29 in complex with hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains L)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1ZVH", "evidence_id": "EV-PDB-1ZVH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "1ZVH", "doi": "10.1073/pnas.0505379103", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1ZVH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the VHH domain D2-L24 in complex with hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1ZVY", "evidence_id": "EV-PDB-1ZVY-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.63 }, "provenance": { "deposit_id": "1ZVY", "doi": "10.1073/pnas.0505379103", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1ZVY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the VHH D3-L11 in complex with hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1IHW", "ACT", "NA", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/29LJ", "evidence_id": "EV-PDB-29LJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.13 }, "provenance": { "deposit_id": "29LJ", "doi": "10.1021/acs.inorgchem.6c02947", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/29LJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of Lysozyme with [Ru2Cl(D-p-CNPhF)(O2CCH3)3]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FER" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/23SI", "evidence_id": "EV-PDB-23SI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "23SI", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/23SI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg-White Lysozyme (HEWL) complexed with Trans-Ferulic Acid" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ETF", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1YL1", "evidence_id": "EV-PDB-1YL1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1YL1", "doi": "10.1107/S0907444905009364", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1YL1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Effect of alcohols on protein hydration" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "IPA", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1YL0", "evidence_id": "EV-PDB-1YL0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1YL0", "doi": "10.1107/S0907444905009364", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1YL0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Effect of alcohols on protein hydration" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "PTL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1YKZ", "evidence_id": "EV-PDB-1YKZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "1YKZ", "doi": "10.1107/S0907444905009364", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1YKZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Effect of alcohols on protein hydration" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EOH", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1YKX", "evidence_id": "EV-PDB-1YKX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1YKX", "doi": "10.1107/S0907444905009364", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1YKX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Effect of alcohols on protein hydration" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1XGT", "evidence_id": "EV-PDB-1XGT-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1XGT", "doi": "10.1016/j.str.2004.12.012", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1XGT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure for antibody HyHEL-63 Y33L mutant complexed with hen egg lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1XGR", "evidence_id": "EV-PDB-1XGR-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1XGR", "doi": "10.1016/j.str.2004.12.012", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1XGR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure for antibody HyHEL-63 Y33I mutant complexed with hen egg lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1XEJ", "evidence_id": "EV-PDB-1XEJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "1XEJ", "doi": "10.1002/(SICI)1097-0134(19980801)32:2<229::AID-PROT9>3.0.CO;2-F", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1XEJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE CRYSTAL STRUCTURES OF LYSOZYME AT VERY LOW LEVELS OF HYDRATION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1WTM", "evidence_id": "EV-PDB-1WTM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.33 }, "provenance": { "deposit_id": "1WTM", "doi": "10.1107/S0907444904030926", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1WTM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of HEW Lysozyme Orthorhombic Crystal formed in the Earth's magnetic field" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1VDQ", "evidence_id": "EV-PDB-1VDQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "1VDQ", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1VDQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The crystal structure of the orthorhombic form of hen egg white lysozyme at 1.5 angstroms resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1VDP", "evidence_id": "EV-PDB-1VDP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "1VDP", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1VDP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The crystal structure of the monoclinic form of hen egg white lysozyme at 1.7 angstroms resolution in space" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -183.15 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1V7T", "evidence_id": "EV-PDB-1V7T-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.13 }, "provenance": { "deposit_id": "1V7T", "doi": "10.1107/S0907444904001805", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1V7T" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Triclinic lysozyme with low solvent content obtained by phase transition" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1UIB", "evidence_id": "EV-PDB-1UIB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.76 }, "provenance": { "deposit_id": "1UIB", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1UIB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ANALYSIS OF THE STABILIZATION OF HEN LYSOZYME WITH THE HELIX DIPOLE AND CHARGED SIDE CHAINS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1UCO", "evidence_id": "EV-PDB-1UCO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "1UCO", "doi": "10.1107/S0907444996002181", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1UCO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEN EGG-WHITE LYSOZYME, LOW HUMIDITY FORM" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains Y)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/1UA6", "evidence_id": "EV-PDB-1UA6-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "1UA6", "doi": "10.1074/jbc.M301149200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/1UA6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of HYHEL-10 FV MUTANT SFSF complexed with HEN EGG WHITE LYSOZYME complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA", "NO3", "RU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/29MN", "evidence_id": "EV-PDB-29MN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.311 }, "provenance": { "deposit_id": "29MN", "doi": "10.1021/acs.inorgchem.6c02947", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/29MN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of Lysozyme with [Ru2Cl(p-TolA)(O2CCH3)3]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1IQW", "NA", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/29MR", "evidence_id": "EV-PDB-29MR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.42 }, "provenance": { "deposit_id": "29MR", "doi": "10.1021/acs.inorgchem.6c02947", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/29MR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of Lysozyme with [Ru2(D-p-FPhF)(O2CCH3)2(O2CO)]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1J46", "NA", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/29MY", "evidence_id": "EV-PDB-29MY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.747 }, "provenance": { "deposit_id": "29MY", "doi": "10.1021/acs.inorgchem.6c02947", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/29MY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of Lysozyme with [Ru2Cl(D-o-TolF)(O2CCH3)3]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1J4C", "CL", "NA", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/29NX", "evidence_id": "EV-PDB-29NX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "29NX", "doi": "10.1021/acs.inorgchem.6c02947", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/29NX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of Lysozyme with [Ru2Cl(D-p-TolF)(O2CCH3)3]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AU", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/29OH", "evidence_id": "EV-PDB-29OH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.54 }, "provenance": { "deposit_id": "29OH", "doi": "10.1021/acs.inorgchem.6c01884", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/29OH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of the gold compound AF-Npx with lysozyme (Structure 1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/29OL", "evidence_id": "EV-PDB-29OL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.441 }, "provenance": { "deposit_id": "29OL", "doi": "10.1021/acs.inorgchem.6c01884", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/29OL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of the gold compound AF-Npx with lysozyme (Structure 2)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2A7F", "evidence_id": "EV-PDB-2A7F-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "2A7F", "doi": "10.1107/S0907444905021475", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2A7F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "On the Routine Use of Soft X-Rays in Macromolecular Crystallography, Part III- The Optimal Data Collection Wavelength" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PG4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2BLX", "evidence_id": "EV-PDB-2BLX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "2BLX", "doi": "10.1107/S0907444905019360", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2BLX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL before a high dose x-ray \"burn\"" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PG4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2BLY", "evidence_id": "EV-PDB-2BLY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "2BLY", "doi": "10.1107/S0907444905019360", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2BLY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL after a high dose x-ray \"burn\"" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -168.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2BPU", "evidence_id": "EV-PDB-2BPU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "2BPU", "doi": "10.1107/S0021889806036387", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2BPU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The Kedge Holmium Derivative of Hen Egg-White Lysozyme at high resolution from Single Wavelength Anomalous Diffraction" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2C8O", "evidence_id": "EV-PDB-2C8O-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "2C8O", "doi": "10.1107/S0907444905041429", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2C8O" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "lysozyme (1sec) and UV lasr excited fluorescence" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2C8P", "evidence_id": "EV-PDB-2C8P-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "2C8P", "doi": "10.1107/S0907444905041429", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2C8P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "lysozyme (60sec) and UV laser excited fluorescence" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": 11.85 }, "construct": { "description": "PROTEIN (LYSOZYME (E.C.3.2.1.17)) (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2CDS", "evidence_id": "EV-PDB-2CDS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2CDS", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2CDS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 16.85 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2D4I", "evidence_id": "EV-PDB-2D4I-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.16 }, "provenance": { "deposit_id": "2D4I", "doi": "10.1107/S0907444906001314", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2D4I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Monoclinic hen egg-white lysozyme crystallized at pH4.5 form heavy water solution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 16.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2D4J", "evidence_id": "EV-PDB-2D4J-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.16 }, "provenance": { "deposit_id": "2D4J", "doi": "10.1107/S0907444906001314", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2D4J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Transformed monoclinic crystal of hen egg-white lysozyme from a heavy water solution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.6, "salt_mM": null, "temperature_c": 16.85 }, "construct": { "description": "Lysozyme C (chains A,N)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2D4K", "evidence_id": "EV-PDB-2D4K-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.15 }, "provenance": { "deposit_id": "2D4K", "doi": "10.1107/S0907444906001314", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2D4K" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Monoclinic hen egg-white lysozyme crystallized at 313K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "IOD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.3, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2D91", "evidence_id": "EV-PDB-2D91-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "2D91", "doi": "10.1107/S0907444905041909", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2D91" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of HYPER-VIL-lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains Y)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2DQD", "evidence_id": "EV-PDB-2DQD-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2DQD", "doi": "10.1074/jbc.M605197200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2DQD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hyhel-10 FV mutant (Hy50f) complexed with hen egg lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains Y)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2DQE", "evidence_id": "EV-PDB-2DQE-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "2DQE", "doi": "10.1074/jbc.M605197200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2DQE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hyhel-10 FV mutant (Hy53a) complexed with hen egg lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains C,F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2DQF", "evidence_id": "EV-PDB-2DQF-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "2DQF", "doi": "10.1074/jbc.M605197200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2DQF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hyhel-10 FV mutant (y33ay53a) complexed with hen egg lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains Y)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2DQG", "evidence_id": "EV-PDB-2DQG-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "2DQG", "doi": "10.1074/jbc.M605197200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2DQG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hyhel-10 FV mutant (Hy53f) complexed with hen egg lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains Y)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2DQI", "evidence_id": "EV-PDB-2DQI-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2DQI", "doi": "10.1074/jbc.M605197200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2DQI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hyhel-10 FV mutant (Ly50a) complexed with hen egg lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains Y)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2DQJ", "evidence_id": "EV-PDB-2DQJ-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2DQJ", "doi": "10.1074/jbc.M605197200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2DQJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hyhel-10 FV (wild-type) complexed with hen egg lysozyme at 1.8A resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.4, "salt_mM": null, "temperature_c": -178.15 }, "construct": { "description": "Lysozyme C (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2EIZ", "evidence_id": "EV-PDB-2EIZ-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "2EIZ", "doi": "10.1110/ps.073156708", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2EIZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of humanized HYHEL-10 fv mutant(HW47Y)-hen lysozyme complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.4, "salt_mM": null, "temperature_c": -178.15 }, "construct": { "description": "Lysozyme C (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2EKS", "evidence_id": "EV-PDB-2EKS-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2EKS", "doi": "10.1110/ps.073156708", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2EKS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of humanized HyHEL-10 FV-HEN lysozyme complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2F2N", "evidence_id": "EV-PDB-2F2N-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.603 }, "provenance": { "deposit_id": "2F2N", "doi": "10.1016/j.bbapap.2006.02.009", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2F2N" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Triclinic hen egg lysozyme cross-linked by glutaraldehyde" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "NO3", "TOU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2F4A", "evidence_id": "EV-PDB-2F4A-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "2F4A", "doi": "10.1016/j.bbapap.2006.02.009", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2F4A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Triclinic cross-linked lysozyme soaked with thiourea 1.5M" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.4, "salt_mM": null, "temperature_c": -263.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2FBB", "evidence_id": "EV-PDB-2FBB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.46 }, "provenance": { "deposit_id": "2FBB", "doi": "10.1107/S0907444906000825", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2FBB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure Analysis of Hexagonal Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2G4P", "evidence_id": "EV-PDB-2G4P-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.84 }, "provenance": { "deposit_id": "2G4P", "doi": "10.1107/S0907444906055624", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2G4P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Anomalous substructure of lysozyme at pH 4.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2G4Q", "evidence_id": "EV-PDB-2G4Q-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.84 }, "provenance": { "deposit_id": "2G4Q", "doi": "10.1107/S0907444906055624", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2G4Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Anomalous substructure of lysozyme at pH 8.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MM5", "NA", "NI" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2H9J", "evidence_id": "EV-PDB-2H9J-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "2H9J", "doi": "10.1002/chem.200601334", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2H9J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Hen egg white lysozyme soaked with Ni2-Xylylbicyclam" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MM6", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2H9K", "evidence_id": "EV-PDB-2H9K-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "2H9K", "doi": "10.1002/chem.200601334", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2H9K" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Hen egg white lysozyme soaked with Ni-cyclam" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "220", "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2HTX", "evidence_id": "EV-PDB-2HTX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.56 }, "provenance": { "deposit_id": "2HTX", "doi": "10.1002/bit.21459", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2HTX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure Analysis of Hen Egg White Lysozyme Crosslinked by Polymerized Glutaraldehyde in Acidic Environment" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "220", "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2HU1", "evidence_id": "EV-PDB-2HU1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.63 }, "provenance": { "deposit_id": "2HU1", "doi": "10.1002/bit.21459", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2HU1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure Analysis of Hen Egg White Lyszoyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA", "NH4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2HU3", "evidence_id": "EV-PDB-2HU3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "2HU3", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2HU3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Parent Structure of Hen Egg White Lysozyme grown in acidic pH 4.8. Refinement for comparison with crosslinked molecules of lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "EPE", "FMT", "NA", "PPI", "TAR" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2HUB", "evidence_id": "EV-PDB-2HUB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.201 }, "provenance": { "deposit_id": "2HUB", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2HUB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Hen Egg-White Lysozyme Determined from crystals grown in pH 7.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BRJ", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2F4G", "evidence_id": "EV-PDB-2F4G-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.654 }, "provenance": { "deposit_id": "2F4G", "doi": "10.1016/j.bbapap.2006.02.009", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2F4G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Triclinic cross-linked lysozyme soaked in bromoethanol 1M" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3", "URE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2F30", "evidence_id": "EV-PDB-2F30-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "2F30", "doi": "10.1016/j.bbapap.2006.02.009", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2F30" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Triclinic cross-linked Lysozyme soaked with 4.5M urea" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2EPE", "evidence_id": "EV-PDB-2EPE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "2EPE", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2EPE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure analysis of Hen egg white lysozyme grown by capillary method" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains Y)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2DQH", "evidence_id": "EV-PDB-2DQH-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "2DQH", "doi": "10.1074/jbc.M605197200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2DQH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hyhel-10 FV mutant (Hy58a) complexed with hen egg lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains Y)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2DQC", "evidence_id": "EV-PDB-2DQC-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2DQC", "doi": "10.1074/jbc.M605197200", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2DQC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hyhel-10 FV mutant(Hy33f) complexed with hen egg lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "202", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2D6B", "evidence_id": "EV-PDB-2D6B-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "2D6B", "doi": "10.1107/S0907444906021627", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2D6B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Novel Bromate Species trapped within a Protein Crystal" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2CGI", "evidence_id": "EV-PDB-2CGI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "2CGI", "doi": "10.1107/S0021889806036387", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2CGI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Siras structure of tetragonal lysozyme using derivative data collected at the high energy remote Holmium Kedge" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AZI", "BGS", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2B5Z", "evidence_id": "EV-PDB-2B5Z-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "2B5Z", "doi": "10.1107/S1744309105008869", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2B5Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen lysozyme chemically glycosylated" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2AUB", "evidence_id": "EV-PDB-2AUB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "2AUB", "doi": "10.1107/S0907444905006578", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2AUB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme structure derived from thin-film-based crystals" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "XE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2A7D", "evidence_id": "EV-PDB-2A7D-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.66 }, "provenance": { "deposit_id": "2A7D", "doi": "10.1107/S0907444905021475", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2A7D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "On the Routine Use of Soft X-Rays in Macromolecular Crystallography, Part III- The Optimal Data Collection Wavelength" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.3, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains L,M)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2I25", "evidence_id": "EV-PDB-2I25-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2I25", "doi": "10.1016/j.jmb.2006.12.045", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2I25" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure analysis of the nurse shark New antigen Receptor PBLA8 variable domain in complex with lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains L,M,Q)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2I26", "evidence_id": "EV-PDB-2I26-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "2I26", "doi": "10.1016/j.jmb.2006.12.045", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2I26" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure analysis of the nurse shark new antigen receptor ancestral variable domain in complex with lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CPT", "DMS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2I6Z", "evidence_id": "EV-PDB-2I6Z-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "2I6Z", "doi": "10.1039/b611122j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2I6Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray diffraction studies of adducts between anticancer platinum drugs and hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains Y)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2IFF", "evidence_id": "EV-PDB-2IFF-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.65 }, "provenance": { "deposit_id": "2IFF", "doi": "10.1006/jmbi.1994.0022", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2IFF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURE OF AN ANTIBODY-LYSOZYME COMPLEX: EFFECT OF A CONSERVATIVE MUTATION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2LYM", "evidence_id": "EV-PDB-2LYM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2LYM", "doi": "10.1016/0022-2836(87)90634-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2LYM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF HEN EGG-WHITE LYSOZYME AT A HYDROSTATIC PRESSURE OF 1000 ATMOSPHERES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2LYZ", "evidence_id": "EV-PDB-2LYZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2LYZ", "doi": "10.1016/0022-2836(74)90598-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2LYZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Real-space refinement of the structure of hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2LZH", "evidence_id": "EV-PDB-2LZH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 6.0 }, "provenance": { "deposit_id": "2LZH", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2LZH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE STRUCTURES OF THE MONOCLINIC AND ORTHORHOMBIC FORMS OF HEN EGG-WHITE LYSOZYME AT 6 ANGSTROMS RESOLUTION." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2LZT", "evidence_id": "EV-PDB-2LZT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.97 }, "provenance": { "deposit_id": "2LZT", "doi": "10.1107/S0108768189009195", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2LZT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "REFINEMENT OF TRICLINIC LYSOZYME. II. THE METHOD OF STEREOCHEMICALLY RESTRAINED LEAST-SQUARES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CMO", "MN", "NA", "TFS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.4, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2Q0M", "evidence_id": "EV-PDB-2Q0M-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "2Q0M", "doi": "10.1039/b703887a", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2Q0M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Tricarbonylmanganese(I)-lysozyme complex : a structurally characterized organometallic protein" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2W1M", "evidence_id": "EV-PDB-2W1M-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.78 }, "provenance": { "deposit_id": "2W1M", "doi": "10.1107/S0907444908030503", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2W1M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE INTERDEPENDENCE OF WAVELENGTH, REDUNDANCY AND DOSE IN SULFUR SAD EXPERIMENTS: 2.070 A WAVELENGTH with 2theta 30 degrees data" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2W1X", "evidence_id": "EV-PDB-2W1X-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "2W1X", "doi": "10.1107/S0907444908030503", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2W1X" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The interdependence of wavelength, redundancy and dose in sulfur SAD experiments: 1.284 A wavelength 360 images data" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2W1Y", "evidence_id": "EV-PDB-2W1Y-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.73 }, "provenance": { "deposit_id": "2W1Y", "doi": "10.1107/S0907444908030503", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2W1Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE INTERDEPENDENCE OF WAVELENGTH, REDUNDANCY AND DOSE IN SULFUR SAD EXPERIMENTS: 1.540 A wavelength 180 images data" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2WAR", "evidence_id": "EV-PDB-2WAR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2WAR", "doi": "10.1071/CH09038", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2WAR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme E35Q chitopentaose complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MRD", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2X0A", "evidence_id": "EV-PDB-2X0A-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.52 }, "provenance": { "deposit_id": "2X0A", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2X0A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "MPD-Lysozyme structure at 55.5 keV using a TRIXXEL CsI-aSi based digital imager and the new ESRF U22 undulator source at ID15" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2XBR", "evidence_id": "EV-PDB-2XBR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.29 }, "provenance": { "deposit_id": "2XBR", "doi": "10.1016/J.STR.2010.09.010", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2XBR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Raman crystallography of Hen White Egg Lysozyme - Low X-ray dose (0.2 MGy)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2XBS", "evidence_id": "EV-PDB-2XBS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.37 }, "provenance": { "deposit_id": "2XBS", "doi": "10.1016/J.STR.2010.09.010", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2XBS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Raman crystallography of Hen White Egg Lysozyme - High X-ray dose (16 MGy)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CMO", "NA", "RU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2XJW", "evidence_id": "EV-PDB-2XJW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.67 }, "provenance": { "deposit_id": "2XJW", "doi": "10.1021/JA108820S", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2XJW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme-CO releasing molecule adduct" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "6BP" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2XTH", "evidence_id": "EV-PDB-2XTH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "2XTH", "doi": "10.1524/ZKRI.2010.1349", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2XTH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "K2PtBr6 binding to lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2YBH", "evidence_id": "EV-PDB-2YBH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2YBH", "doi": "10.1107/S0909049511007163", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2YBH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Nitrate X-ray induced reduction on HEWL crystals (2.31 MGy)." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO2", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2YBI", "evidence_id": "EV-PDB-2YBI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2YBI", "doi": "10.1107/S0909049511007163", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2YBI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Nitrate X-ray induced reduction on HEWL crystals (6.62 MGy)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO2" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2YBJ", "evidence_id": "EV-PDB-2YBJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2YBJ", "doi": "10.1107/S0909049511007163", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2YBJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Nitrate X-ray induced reduction on HEWL crystals (12.31 MGy)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO2" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2YBL", "evidence_id": "EV-PDB-2YBL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2YBL", "doi": "10.1107/S0909049511007163", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2YBL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Nitrate X-ray induced reduction on HEWL crystals (17.9 MGy)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2YBM", "evidence_id": "EV-PDB-2YBM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2YBM", "doi": "10.1107/S0909049511007163", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2YBM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Nitrate X-ray induced reduction on HEWL crystals (23.3 MGy)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO2" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2YBN", "evidence_id": "EV-PDB-2YBN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2YBN", "doi": "10.1107/S0909049511007163", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2YBN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Nitrate X-ray induced reduction on HEWL crystals (28.6 MGy)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ASC", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2YDG", "evidence_id": "EV-PDB-2YDG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2YDG", "doi": "10.1107/S0909049511007163", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2YDG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ascorbate co-crystallized HEWL." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.4, "salt_mM": null, "temperature_c": -178.15 }, "construct": { "description": "Lysozyme C (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2YSS", "evidence_id": "EV-PDB-2YSS-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "2YSS", "doi": "10.1110/ps.073156708", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2YSS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Humanized HYHEL-10 FV mutant(HQ39KW47Y)-HEN lysozyme complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2YVB", "evidence_id": "EV-PDB-2YVB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.62 }, "provenance": { "deposit_id": "2YVB", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2YVB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High resolution X-ray crystal structure of Tetragonal Hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -183.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2Z12", "evidence_id": "EV-PDB-2Z12-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.15 }, "provenance": { "deposit_id": "2Z12", "doi": "10.1107/S0907444907031319", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2Z12" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of the transformed monoclinic lysozyme by controlled dehydration" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "HDZ", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -183.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2Z18", "evidence_id": "EV-PDB-2Z18-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.15 }, "provenance": { "deposit_id": "2Z18", "doi": "10.1107/S0907444907031319", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2Z18" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Phase transition of monoclinic lysozyme crystal soaked in a 10% NaCl solution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.6, "salt_mM": null, "temperature_c": -183.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2Z19", "evidence_id": "EV-PDB-2Z19-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.15 }, "provenance": { "deposit_id": "2Z19", "doi": "10.1107/S0907444907031319", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2Z19" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Phase transition of monoclinic lysozyme crystal soaked in a saturated NaCl solution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1PG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains Y,Z)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2ZNW", "evidence_id": "EV-PDB-2ZNW-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.71 }, "provenance": { "deposit_id": "2ZNW", "doi": "10.1021/bi300455t", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2ZNW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of ScFv10 in Complex with Hen Egg Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1PG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains Y,Z)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2ZNX", "evidence_id": "EV-PDB-2ZNX-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "2ZNX", "doi": "10.1021/bi300455t", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2ZNX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "5-Fluorotryptophan Incorporated ScFv10 Complexed to Hen Egg Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2ZQ3", "evidence_id": "EV-PDB-2ZQ3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "2ZQ3", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2ZQ3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The crystal structure of the orthorhombic form of hen egg white lysozyme at 1.6 angstroms resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2ZQ4", "evidence_id": "EV-PDB-2ZQ4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "2ZQ4", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2ZQ4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The crystal structure of the orthorhombic form of hen egg white lysozyme at 2.0 angstroms resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/30IG", "evidence_id": "EV-PDB-30IG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "30IG", "doi": "10.1107/S0907444912006907", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/30IG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "EVAL processed HEWL, N-acetylglucosamine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1J6T", "ACT", "CL", "NA", "VVB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/30JS", "evidence_id": "EV-PDB-30JS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "30JS", "doi": "10.1021/acs.inorgchem.6c02377", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/30JS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of lysozyme treated with V(V)-lactate complex (structure A)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1J6T", "A1J6Z", "ACT", "NA", "NO3", "VVB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/30JU", "evidence_id": "EV-PDB-30JU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.355 }, "provenance": { "deposit_id": "30JU", "doi": "10.1021/acs.inorgchem.6c02377", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/30JU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of lysozyme treated with V(V)-lactate complex (structure B)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1J62", "A1J6T", "VVO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/30JX", "evidence_id": "EV-PDB-30JX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.524 }, "provenance": { "deposit_id": "30JX", "doi": "10.1021/acs.inorgchem.6c02377", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/30JX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of lysozyme treated with V(V)-lactate complex (structure C)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1J62", "EPE", "NA", "VVO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/30JY", "evidence_id": "EV-PDB-30JY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.23 }, "provenance": { "deposit_id": "30JY", "doi": "10.1021/acs.inorgchem.6c02377", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/30JY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of lysozyme treated with V(V)-lactate complex (structure D)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "ARG", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3A34", "evidence_id": "EV-PDB-3A34-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "3A34", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3A34" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Effect of Ariginine on lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 7.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3A3Q", "evidence_id": "EV-PDB-3A3Q-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "3A3Q", "doi": "10.1093/jb/mvp110", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3A3Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of N59D HEN EGG-WHITE LYSOZYME in complex with (GlcNAc)3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 7.85 }, "construct": { "description": "Lysozyme C (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3A3R", "evidence_id": "EV-PDB-3A3R-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "3A3R", "doi": "10.1093/jb/mvp110", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3A3R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of N59D HEN EGG-WHITE LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains Y)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3A67", "evidence_id": "EV-PDB-3A67-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "3A67", "doi": "10.1074/jbc.M109.089623", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3A67" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of HyHEL-10 Fv mutant LN31D complexed with hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains Y)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3A6B", "evidence_id": "EV-PDB-3A6B-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "3A6B", "doi": "10.1074/jbc.M109.089623", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3A6B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of HyHEL-10 Fv mutant LN32D complexed with hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains Y)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3A6C", "evidence_id": "EV-PDB-3A6C-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "3A6C", "doi": "10.1074/jbc.M109.089623", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3A6C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of HyHEL-10 Fv mutant LN92D complexed with hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AYE", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2ZYP", "evidence_id": "EV-PDB-2ZYP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.18 }, "provenance": { "deposit_id": "2ZYP", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2ZYP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of hen egg-white lysozyme with poly(allyl amine)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2W1L", "evidence_id": "EV-PDB-2W1L-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.51 }, "provenance": { "deposit_id": "2W1L", "doi": "10.1107/S0907444908030503", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2W1L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "THE INTERDEPENDENCE OF WAVELENGTH, REDUNDANCY AND DOSE IN SULFUR SAD EXPERIMENTS: 0.979 a wavelength 991 images data" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "EDO", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2VB1", "evidence_id": "EV-PDB-2VB1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.65 }, "provenance": { "deposit_id": "2VB1", "doi": "10.1107/S0907444907054224", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2VB1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL at 0.65 angstrom resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EU", "PDC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.1, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2PC2", "evidence_id": "EV-PDB-2PC2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.538 }, "provenance": { "deposit_id": "2PC2", "doi": "10.1107/S0907444910010954", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2PC2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme Cocrystallized with Tris-dipicolinate Eu complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CCN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.3, "salt_mM": null, "temperature_c": 11.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/2LYO", "evidence_id": "EV-PDB-2LYO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.93 }, "provenance": { "deposit_id": "2LYO", "doi": "10.1016/S0167-4838(98)00027-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/2LYO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CROSS-LINKED CHICKEN LYSOZYME CRYSTAL IN 90% ACETONITRILE-WATER" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3A8Z", "evidence_id": "EV-PDB-3A8Z-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "3A8Z", "doi": "10.1002/chem.200903269", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3A8Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "RH3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3A91", "evidence_id": "EV-PDB-3A91-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "3A91", "doi": "10.1002/chem.200903269", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3A91" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme soaked with 5mM RhCl3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA", "RH3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3A92", "evidence_id": "EV-PDB-3A92-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "3A92", "doi": "10.1002/chem.200903269", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3A92" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme soaked with 10mM RhCl3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "RH3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3A93", "evidence_id": "EV-PDB-3A93-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "3A93", "doi": "10.1002/chem.200903269", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3A93" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme soaked with 30mM RhCl3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "RH3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3A94", "evidence_id": "EV-PDB-3A94-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "3A94", "doi": "10.1002/chem.200903269", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3A94" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme soaked with 100mM RhCl3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "RH3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3A95", "evidence_id": "EV-PDB-3A95-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "3A95", "doi": "10.1002/chem.200903269", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3A95" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme soaked with 100mM RhCl3 at pH3.8" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "RH3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3A96", "evidence_id": "EV-PDB-3A96-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "3A96", "doi": "10.1002/chem.200903269", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3A96" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme soaked with 100mM RhCl3 at pH2.2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains G)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3AGG", "evidence_id": "EV-PDB-3AGG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "3AGG", "doi": "10.1093/protein/gzq101", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3AGG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray analysis of lysozyme in the absence of Arg" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3AGH", "evidence_id": "EV-PDB-3AGH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.49 }, "provenance": { "deposit_id": "3AGH", "doi": "10.1093/protein/gzq101", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3AGH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray analysis of lysozyme in the presence of 200 mM Arg" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GM1", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3AJN", "evidence_id": "EV-PDB-3AJN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.05 }, "provenance": { "deposit_id": "3AJN", "doi": "10.1016/j.febslet.2011.01.008", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3AJN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structural basis of glycine amide on suppression of protein aggregation by high resolution X-ray analysis" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3ATN", "evidence_id": "EV-PDB-3ATN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.17 }, "provenance": { "deposit_id": "3ATN", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3ATN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Glycine ethyl ester shielding on the aromatic surfaces of lysozyme: Implication for suppression of protein aggregation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GEE", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3ATO", "evidence_id": "EV-PDB-3ATO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.17 }, "provenance": { "deposit_id": "3ATO", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3ATO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Glycine ethyl ester shielding on the aromatic surfaces of lysozyme: Implication for suppression of protein aggregation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.2, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3AW6", "evidence_id": "EV-PDB-3AW6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "3AW6", "doi": "10.1016/j.bpc.2011.07.001", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3AW6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of tetragonal hen egg white lysozyme at 84.2% relative humidity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.2, "salt_mM": null, "temperature_c": 27.45 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3AW7", "evidence_id": "EV-PDB-3AW7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "3AW7", "doi": "10.1016/j.bpc.2011.07.001", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3AW7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of tetragonal hen egg white lysozyme at 71.9% relative humidity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3AZ4", "evidence_id": "EV-PDB-3AZ4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.62 }, "provenance": { "deposit_id": "3AZ4", "doi": "10.1002/smll.201101866", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3AZ4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Co/O-HEWL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3AZ5", "evidence_id": "EV-PDB-3AZ5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.34 }, "provenance": { "deposit_id": "3AZ5", "doi": "10.1002/smll.201101866", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3AZ5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Pt/O-HEWL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CO", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3AZ6", "evidence_id": "EV-PDB-3AZ6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "3AZ6", "doi": "10.1002/smll.201101866", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3AZ6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Co/T-HEWL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3AZ7", "evidence_id": "EV-PDB-3AZ7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "3AZ7", "doi": "10.1002/smll.201101866", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3AZ7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Pt/T-HEWL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SDS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3B6L", "evidence_id": "EV-PDB-3B6L-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "3B6L", "doi": "10.1186/1472-6807-8-29", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3B6L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of lysozyme folded in SDS and 2-methyl-2,4-pentanediol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MPD", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3B72", "evidence_id": "EV-PDB-3B72-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "3B72", "doi": "10.1186/1472-6807-8-29", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3B72" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of lysozyme folded in SDS and 2-methyl-2,4-pentanediol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3D9A", "evidence_id": "EV-PDB-3D9A-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "3D9A", "doi": "10.1016/j.molimm.2009.08.018", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3D9A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High Resolution Crystal Structure Structure of HyHel10 Fab Complexed to Hen Egg Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3EXD", "evidence_id": "EV-PDB-3EXD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.49 }, "provenance": { "deposit_id": "3EXD", "doi": "10.1107/S0909049508034870", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3EXD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Sulfur-SAD phased HEWL Crystal" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains Y)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3HFM", "evidence_id": "EV-PDB-3HFM-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "3HFM", "doi": "10.1073/pnas.86.15.5938", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3HFM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURE OF AN ANTIBODY-ANTIGEN COMPLEX. CRYSTAL STRUCTURE OF THE HY/HEL-10 FAB-LYSOZYME COMPLEX" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3IJU", "evidence_id": "EV-PDB-3IJU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "3IJU", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3IJU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Chicken egg white lysozyme by highly ordered APA (Anodic Porous Alumina) nanotemplate crystallization method" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3J6K", "evidence_id": "EV-PDB-3J6K-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "3J6K", "doi": "10.1038/nmeth.3043", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3J6K" }, "reader": null, "source_kind": "deposit", "technique": "microed", "title": "2.5A structure of lysozyme solved by MicroED" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CMO", "NA", "RE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3KAM", "evidence_id": "EV-PDB-3KAM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.59 }, "provenance": { "deposit_id": "3KAM", "doi": "10.1039/b923688k", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3KAM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme Derivatized with rhenium(I) diaquatricarbonyl cation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3LYM", "evidence_id": "EV-PDB-3LYM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "3LYM", "doi": "10.1016/0022-2836(87)90634-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3LYM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF HEN EGG-WHITE LYSOZYME AT A HYDROSTATIC PRESSURE OF 1000 ATMOSPHERES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CCN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.3, "salt_mM": null, "temperature_c": 11.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3LYO", "evidence_id": "EV-PDB-3LYO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.93 }, "provenance": { "deposit_id": "3LYO", "doi": "10.1016/S0167-4838(98)00027-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3LYO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CROSS-LINKED CHICKEN LYSOZYME CRYSTAL IN 95% ACETONITRILE-WATER" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -153.15 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3LZT", "evidence_id": "EV-PDB-3LZT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.925 }, "provenance": { "deposit_id": "3LZT", "doi": "10.1107/S0907444997013656", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3LZT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "REFINEMENT OF TRICLINIC LYSOZYME AT ATOMIC RESOLUTION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3M18", "evidence_id": "EV-PDB-3M18-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "3M18", "doi": "10.1073/pnas.1005475107", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3M18" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of variable lymphocyte receptor VLRA.R2.1 in complex with hen egg lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3M3U", "evidence_id": "EV-PDB-3M3U-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.35 }, "provenance": { "deposit_id": "3M3U", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3M3U" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Effect of temperature on tryptophan fluorescence in lysozyme crystals" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NAG", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -177.15 }, "construct": { "description": "PEPTIDE HEL 11-27 (chains P,Q)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3MBE", "evidence_id": "EV-PDB-3MBE-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.886 }, "provenance": { "deposit_id": "3MBE", "doi": "10.1172/JCI41502", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3MBE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "TCR 21.30 in complex with MHC class II I-Ag7HEL(11-27)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3N9C", "evidence_id": "EV-PDB-3N9C-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "3N9C", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3N9C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mite-y Lysozyme: Marmite" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3N9E", "evidence_id": "EV-PDB-3N9E-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.38 }, "provenance": { "deposit_id": "3N9E", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3N9E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mite-y Lysozyme: Promite" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3OK0", "evidence_id": "EV-PDB-3OK0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.82 }, "provenance": { "deposit_id": "3OK0", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3OK0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "E35A Mutant of Hen Egg White Lysozyme (HEWL)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains G,H,I,J,K,L)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3OTP", "evidence_id": "EV-PDB-3OTP-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.76 }, "provenance": { "deposit_id": "3OTP", "doi": "10.1016/j.cell.2011.02.024", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3OTP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the DegP dodecamer with a model substrate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AU", "AU3", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -149.95 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3P4Z", "evidence_id": "EV-PDB-3P4Z-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "3P4Z", "doi": "10.1038/nnano.2010.280", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3P4Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Time-dependent and Protein-directed In Situ Growth of Gold Nanoparticles in a Single Crystal of Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3OJP", "evidence_id": "EV-PDB-3OJP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.81 }, "provenance": { "deposit_id": "3OJP", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3OJP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "D52N Mutant of Hen Egg White Lysozyme (HEWL)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3N9A", "evidence_id": "EV-PDB-3N9A-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "3N9A", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3N9A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mite-y Lysozyme: Vegemite" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3LYZ", "evidence_id": "EV-PDB-3LYZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "3LYZ", "doi": "10.1016/0022-2836(74)90598-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3LYZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Real-space refinement of the structure of hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3LYT", "evidence_id": "EV-PDB-3LYT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "3LYT", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3LYT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "COMPARISON OF RADIATION-INDUCED DECAY AND STRUCTURE REFINEMENT FROM X-RAY DATA COLLECTED FROM LYSOZYME CRYSTALS AT LOW AND AMBIENT TEMPERATURES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3J4G", "evidence_id": "EV-PDB-3J4G-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.901 }, "provenance": { "deposit_id": "3J4G", "doi": "10.7554/eLife.01345", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3J4G" }, "reader": null, "source_kind": "deposit", "technique": "microed", "title": "Structure of lysozyme solved by MicroED to 2.9 A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3IJV", "evidence_id": "EV-PDB-3IJV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "3IJV", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3IJV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Chicken egg white lysozyme by classical hanging drop vapour diffusion method" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains B,D,F,H)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3G3B", "evidence_id": "EV-PDB-3G3B-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "3G3B", "doi": "10.1038/nsmb.1619", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3G3B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of a lamprey variable lymphocyte receptor mutant in complex with a protein antigen" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains B,D,F,H)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3G3A", "evidence_id": "EV-PDB-3G3A-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "3G3A", "doi": "10.1038/nsmb.1619", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3G3A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of a lamprey variable lymphocyte receptor in complex with a protein antigen" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3F6Z", "evidence_id": "EV-PDB-3F6Z-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "3F6Z", "doi": "10.1016/j.bbrc.2008.11.039", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3F6Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Pseudomonas aeruginosa MliC in complex with hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ARG", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3EMS", "evidence_id": "EV-PDB-3EMS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.651 }, "provenance": { "deposit_id": "3EMS", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3EMS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Effect of Ariginine on lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EPE", "I3C" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3E3D", "evidence_id": "EV-PDB-3E3D-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "3E3D", "doi": "10.1107/S0907444908030266", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3E3D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of hen egg white lysozyme with the magic triangle I3C" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "ARG", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3AGI", "evidence_id": "EV-PDB-3AGI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "3AGI", "doi": "10.1093/protein/gzq101", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3AGI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High resolution X-ray analysis of Arg-lysozyme complex in the presence of 500 mM Arg" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3A90", "evidence_id": "EV-PDB-3A90-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "3A90", "doi": "10.1002/chem.200903269", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3A90" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme soaked with 1mM RhCl3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AU", "AU3", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -149.95 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3P64", "evidence_id": "EV-PDB-3P64-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "3P64", "doi": "10.1038/nnano.2010.280", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3P64" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Time-dependent and Protein-directed In Situ Growth of Gold Nanoparticles in a Single Crystal of Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AU", "AU3", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -149.95 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3P65", "evidence_id": "EV-PDB-3P65-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "3P65", "doi": "10.1038/nnano.2010.280", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3P65" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Time-dependent and Protein-directed In Situ Growth of Gold Nanoparticles in a Single Crystal of Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AU3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -149.95 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3P66", "evidence_id": "EV-PDB-3P66-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.36 }, "provenance": { "deposit_id": "3P66", "doi": "10.1038/nnano.2010.280", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3P66" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Time-dependent and Protein-directed In Situ Growth of Gold Nanoparticles in a Single Crystal of Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AU3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -149.95 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3P68", "evidence_id": "EV-PDB-3P68-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "3P68", "doi": "10.1038/nnano.2010.280", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3P68" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Time-dependent and Protein-directed In Situ Growth of Gold Nanoparticles in a Single Crystal of Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA", "REJ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.54, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3QNG", "evidence_id": "EV-PDB-3QNG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "3QNG", "doi": "10.1021/ic2023314", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3QNG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure Analysis of Lysozyme-bound fac-[Re(CO)3(L-serine)]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3QY4", "evidence_id": "EV-PDB-3QY4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "3QY4", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3QY4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystallization and in situ data collection of Lysozyme using the Crystal Former" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "EOH", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3RNX", "evidence_id": "EV-PDB-3RNX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.856 }, "provenance": { "deposit_id": "3RNX", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3RNX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Lysozyme in 30% ethanol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "IPA", "NA", "POL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains X)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3RT5", "evidence_id": "EV-PDB-3RT5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "3RT5", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3RT5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme in 30% propanol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AG", "EDO", "NA", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3RU5", "evidence_id": "EV-PDB-3RU5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "3RU5", "doi": "10.1039/c1cc15908a", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3RU5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Silver Metallated Hen Egg White Lysozyme at 1.35 A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "EOH", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3RW8", "evidence_id": "EV-PDB-3RW8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.855 }, "provenance": { "deposit_id": "3RW8", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3RW8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of lysozyme in 40% ethanol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EPE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3RZ4", "evidence_id": "EV-PDB-3RZ4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "3RZ4", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3RZ4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme in HEPES buffer at pH 7.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "branched: beta-D-fructofuranose-(2-1)-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3T6U", "evidence_id": "EV-PDB-3T6U-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.213 }, "provenance": { "deposit_id": "3T6U", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3T6U" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Lysozyme in 40% sucrose" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3TMU", "evidence_id": "EV-PDB-3TMU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "3TMU", "doi": "10.1107/S0907444911032835", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3TMU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-Ray Radiation Damage to HEWL Crystals soaked in 100mM Sodium Nitrate (Undosed)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3TMV", "evidence_id": "EV-PDB-3TMV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "3TMV", "doi": "10.1107/S0907444911032835", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3TMV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-Ray Radiation Damage to HEWL Crystals soaked in 100mM Sodium Nitrate (Dose=0.12MGy)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3TMW", "evidence_id": "EV-PDB-3TMW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "3TMW", "doi": "10.1107/S0907444911032835", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3TMW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-Ray Radiation Damage to HEWL Crystals soaked in 100mM Sodium Nitrate (Undosed)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3TMX", "evidence_id": "EV-PDB-3TMX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "3TMX", "doi": "10.1107/S0907444911032835", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3TMX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-Ray Radiation Damage to HEWL Crystals soaked in 100mM Sodium Nitrate (Dose=1.9MGy)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3TXB", "evidence_id": "EV-PDB-3TXB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.59 }, "provenance": { "deposit_id": "3TXB", "doi": "10.1107/S0021889812044172", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3TXB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL co-crystallization with cisplatin in aqueous media with glycerol as the cryoprotectant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3TXD", "evidence_id": "EV-PDB-3TXD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.53 }, "provenance": { "deposit_id": "3TXD", "doi": "10.1107/S0021889812044172", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3TXD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL co-crystallization with carboplatin in aqueous media with glycerol as the cryoprotectant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CPT", "DMS", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3TXF", "evidence_id": "EV-PDB-3TXF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.69 }, "provenance": { "deposit_id": "3TXF", "doi": "10.1107/S0021889812044172", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3TXF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL co-crystallization with cisplatin in DMSO media with glycerol as the cryoprotectant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DMS", "NA", "QPT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3TXI", "evidence_id": "EV-PDB-3TXI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "3TXI", "doi": "10.1107/S0021889812044172", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3TXI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL co-crystallization with carboplatin in DMSO media with paratone as the cryoprotectant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CPT", "DMS", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3TXK", "evidence_id": "EV-PDB-3TXK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "3TXK", "doi": "10.1107/S0021889812044172", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3TXK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL co-crystallization with cisplatin in DMSO media with paratone as the cryoprotectant at pH 6.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3ULR", "evidence_id": "EV-PDB-3ULR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "3ULR", "doi": "10.1107/S1744309111056132", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3ULR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme contamination facilitates crystallization of a hetero-trimericCortactin:Arg:Lysozyme complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA", "RBN", "RU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3W6A", "evidence_id": "EV-PDB-3W6A-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.77 }, "provenance": { "deposit_id": "3W6A", "doi": "10.1002/asia.201301347", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3W6A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of cross-linked tetragonal hen egg white lysozyme soaked wiht 5mM [Ru(benzene)Cl2]2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "NA", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3WL2", "evidence_id": "EV-PDB-3WL2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.96 }, "provenance": { "deposit_id": "3WL2", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3WL2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Monoclinic Lysozyme at 0.96 A resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3WMK", "evidence_id": "EV-PDB-3WMK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.46 }, "provenance": { "deposit_id": "3WMK", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3WMK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Hen egg-white lysozyme in pH 4.5 Sodium Acetatewith 1M NaCl at 277K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3WPJ", "evidence_id": "EV-PDB-3WPJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "3WPJ", "doi": "10.1038/srep05731", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3WPJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPATIOTEMPORAL DEVELOPMENT of SOAKED PROTEIN CRYSTAL; NATIVE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PT4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3WPK", "evidence_id": "EV-PDB-3WPK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "3WPK", "doi": "10.1038/srep05731", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3WPK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPATIOTEMPORAL DEVELOPMENT of SOAKED PROTEIN CRYSTAL; 750 SEC" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PT4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3WU7", "evidence_id": "EV-PDB-3WU7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "3WU7", "doi": "10.1038/srep05731", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3WU7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Spatiotemporal development of soaked protein crystal; derivative 250 sec" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PT4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3WU8", "evidence_id": "EV-PDB-3WU8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "3WU8", "doi": "10.1038/srep05731", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3WU8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Spatiotemporal development of soaked protein crystal; derivative 1080 sec" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PT4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3WU9", "evidence_id": "EV-PDB-3WU9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "3WU9", "doi": "10.1038/srep05731", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3WU9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Spatiotemporal development of soaked protein crystal; derivative 1580 sec" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PT4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3WUA", "evidence_id": "EV-PDB-3WUA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "3WUA", "doi": "10.1038/srep05731", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3WUA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Spatiotemporal development of soaked protein crystal; derivative 3610 sec" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3WUL", "evidence_id": "EV-PDB-3WUL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "3WUL", "doi": "10.1038/nmeth.3172", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3WUL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3WUM", "evidence_id": "EV-PDB-3WUM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "3WUM", "doi": "10.1038/nmeth.3172", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3WUM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3WUN", "evidence_id": "EV-PDB-3WUN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "3WUN", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3WUN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3WVX", "evidence_id": "EV-PDB-3WVX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.58 }, "provenance": { "deposit_id": "3WVX", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3WVX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of D48A hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3WVY", "evidence_id": "EV-PDB-3WVY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.56 }, "provenance": { "deposit_id": "3WVY", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3WVY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of D48A hen egg white lysozyme in complex with (GlcNAc)4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3WW6", "evidence_id": "EV-PDB-3WW6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.53 }, "provenance": { "deposit_id": "3WW6", "doi": "10.1002/pro.2966", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3WW6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of hen egg white lysozyme mutant N46D/D52S" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/45KK", "evidence_id": "EV-PDB-45KK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "45KK", "doi": "10.64898/2026.09.17.752399", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/45KK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "6-conformation model of Hen Egg White Lysozyme at 100K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME C (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3ZVQ", "evidence_id": "EV-PDB-3ZVQ-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "3ZVQ", "doi": "10.2174/092986610789909395", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3ZVQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of proteolyzed lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3ZVQ", "evidence_id": "EV-PDB-3ZVQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "3ZVQ", "doi": "10.2174/092986610789909395", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3ZVQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of proteolyzed lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3ZEK", "evidence_id": "EV-PDB-3ZEK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.43 }, "provenance": { "deposit_id": "3ZEK", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3ZEK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme structure determined at room temperature by in- situ diffraction in ChipX" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3WXU", "evidence_id": "EV-PDB-3WXU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "3WXU", "doi": "10.1038/nmeth.3172", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3WXU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3WXT", "evidence_id": "EV-PDB-3WXT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "3WXT", "doi": "10.1038/nmeth.3172", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3WXT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3WW5", "evidence_id": "EV-PDB-3WW5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.53 }, "provenance": { "deposit_id": "3WW5", "doi": "10.1002/pro.2966", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3WW5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of hen egg white lysozyme mutant N46E/D52S" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "PT4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3WPL", "evidence_id": "EV-PDB-3WPL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "3WPL", "doi": "10.1038/srep05731", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3WPL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SPATIOTEMPORAL DEVELOPMENT of SOAKED PROTEIN CRYSTAL; 2510 SEC" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NAG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3TXJ", "evidence_id": "EV-PDB-3TXJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.48 }, "provenance": { "deposit_id": "3TXJ", "doi": "10.1107/S0021889812044172", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3TXJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL co-crystallization with NAG with silicone oil as the cryoprotectant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DMS", "GOL", "NA", "QPT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3TXH", "evidence_id": "EV-PDB-3TXH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.69 }, "provenance": { "deposit_id": "3TXH", "doi": "10.1107/S0021889812044172", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3TXH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL co-crystallization with carboplatin in DMSO media with glycerol as the cryoprotectant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CPT", "DMS", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3TXG", "evidence_id": "EV-PDB-3TXG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "3TXG", "doi": "10.1107/S0021889812044172", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3TXG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL co-crystallization with cisplatin in DMSO media with paratone as the cryoprotectant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MEB", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3TXE", "evidence_id": "EV-PDB-3TXE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "3TXE", "doi": "10.1107/S0021889812044172", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3TXE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL co-crystallization with carboplatin in aqueous media with paratone as the cryoprotectant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "branched: beta-D-fructofuranose-(2-1)-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3SP3", "evidence_id": "EV-PDB-3SP3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.801 }, "provenance": { "deposit_id": "3SP3", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3SP3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme in 20% sucrose" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "REI" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.54, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/3QE8", "evidence_id": "EV-PDB-3QE8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.49 }, "provenance": { "deposit_id": "3QE8", "doi": "10.1021/ic2023314", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/3QE8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure Analysis of Lysozyme-bound fac-[Re(CO)3(H2O)(Im)]+" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME C (chains M)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4A8A", "evidence_id": "EV-PDB-4A8A-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 14.2 }, "provenance": { "deposit_id": "4A8A", "doi": "10.1038/NSMB.2210", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4A8A" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Asymmetric cryo-EM reconstruction of E. coli DegQ 12-mer in complex with lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME C (chains M,N,O,P,Q,R)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4A8B", "evidence_id": "EV-PDB-4A8B-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 13.0 }, "provenance": { "deposit_id": "4A8B", "doi": "10.1038/NSMB.2210", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4A8B" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Symmetrized cryo-EM reconstruction of E. coli DegQ 12-mer in complex with lysozymes" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CHT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -210.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4AGA", "evidence_id": "EV-PDB-4AGA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "4AGA", "doi": "10.1039/C2CE25129A", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4AGA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hofmeister effects of ionic liquids in protein crystallization: direct and water-mediated interactions" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4AXT", "evidence_id": "EV-PDB-4AXT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "4AXT", "doi": "10.1107/S0907444912031459", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4AXT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF HEN EGG WHITE LYSOZYME FROM AN AUTO HARVESTED CRYSTAL, Control Experiment" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4B0D", "evidence_id": "EV-PDB-4B0D-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "4B0D", "doi": "10.1107/S0907444912031459", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4B0D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF HEN EGG WHITE LYSOZYME FROM AN AUTO HARVESTED CRYSTAL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "K3G", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -113.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4B1A", "evidence_id": "EV-PDB-4B1A-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.67 }, "provenance": { "deposit_id": "4B1A", "doi": "10.1039/C2DT32174B", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4B1A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of lysozyme with Keggin molecule" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MRD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4B4E", "evidence_id": "EV-PDB-4B4E-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.0 }, "provenance": { "deposit_id": "4B4E", "doi": "10.1107/S1399004714025061", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4B4E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "1.00 A Structure of Lysozyme Crystallized with (R)-2-methyl-2,4- pentanediol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "EU3", "HM6", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4BAD", "evidence_id": "EV-PDB-4BAD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "4BAD", "doi": "10.1039/C2CC36982F", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4BAD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme structure in complex with the europium tris- hydroxymethyltriazoledipicolinate complex at 1.35 A resolution." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "EU3", "IKX", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4BAF", "evidence_id": "EV-PDB-4BAF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.507 }, "provenance": { "deposit_id": "4BAF", "doi": "10.1039/C2CC36982F", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4BAF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme structure in complex with the europium tris- hydroxyethyltriazoledipicolinate complex at 1.51 A resolution." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "DCJ", "EU3", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4BAP", "evidence_id": "EV-PDB-4BAP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.207 }, "provenance": { "deposit_id": "4BAP", "doi": "10.1039/C2CC36982F", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4BAP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme structure in complex with the europium tris- hydroxyethylcholinetriazoledipicolinate complex at 1.21 A resolution." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "YB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4BS7", "evidence_id": "EV-PDB-4BS7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.701 }, "provenance": { "deposit_id": "4BS7", "doi": "10.1021/CG301757G", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4BS7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme structure determined at room temperature by in- situ diffraction and SAD phasing in ChipX" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "AIV", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4C3W", "evidence_id": "EV-PDB-4C3W-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.28 }, "provenance": { "deposit_id": "4C3W", "doi": "10.1002/EJIC.201402408", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4C3W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Vanadium(IV)-Picolinate Complexed with Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4CJ2", "evidence_id": "EV-PDB-4CJ2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "4CJ2", "doi": "10.1371/JOURNAL.PONE.0097438", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4CJ2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of HEWL in complex with affitin H4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4DC4", "evidence_id": "EV-PDB-4DC4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.654 }, "provenance": { "deposit_id": "4DC4", "doi": "10.1038/srep22475", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4DC4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme Trimer" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MEB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4DD1", "evidence_id": "EV-PDB-4DD1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "4DD1", "doi": "10.1107/S0907444912006907", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4DD1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "EVAL processed HEWL, cisplatin aqueous paratone" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4DD2", "evidence_id": "EV-PDB-4DD2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "4DD2", "doi": "10.1107/S0907444912006907", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4DD2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "EVAL processed HEWL, carboplatin aqueous glycerol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MEB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4DD3", "evidence_id": "EV-PDB-4DD3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "4DD3", "doi": "10.1107/S0907444912006907", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4DD3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "EVAL processed HEWL, carboplatin aqueous paratone" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DMS", "GOL", "QPT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4DD7", "evidence_id": "EV-PDB-4DD7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "4DD7", "doi": "10.1107/S0907444912006907", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4DD7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "EVAL processed HEWL, carboplatin DMSO glycerol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DMS", "QPT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4DD9", "evidence_id": "EV-PDB-4DD9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "4DD9", "doi": "10.1107/S0907444912006907", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4DD9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "EVAL processed HEWL, carboplatin DMSO paratone" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CPT", "DMS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4DDB", "evidence_id": "EV-PDB-4DDB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.0 }, "provenance": { "deposit_id": "4DDB", "doi": "10.1107/S0907444912006907", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4DDB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "EVAL processed HEWL, cisplatin DMSO paratone pH 6.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "PRO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -150.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4E3U", "evidence_id": "EV-PDB-4E3U-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "4E3U", "doi": "10.1107/S0907444912019580", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4E3U" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Hen Egg White Lysozyme Cryoprotected in Proline" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "ARG", "CL", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4EOF", "evidence_id": "EV-PDB-4EOF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.83 }, "provenance": { "deposit_id": "4EOF", "doi": "10.1038/srep22475", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4EOF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme in the presence of arginine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4ET9", "evidence_id": "EV-PDB-4ET9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "4ET9", "doi": "10.1126/science.1217737", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4ET9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme solved from 5 fs free-electron laser pulse data" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4ETB", "evidence_id": "EV-PDB-4ETB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.908 }, "provenance": { "deposit_id": "4ETB", "doi": "10.1126/science.1217737", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4ETB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "lysozyme, room temperature, 200 kGy dose" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4ETC", "evidence_id": "EV-PDB-4ETC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.906 }, "provenance": { "deposit_id": "4ETC", "doi": "10.1126/science.1217737", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4ETC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme, room temperature, 24 kGy dose" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "CPT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4G49", "evidence_id": "EV-PDB-4G49-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "4G49", "doi": "10.1107/S1744309112042005", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4G49" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature X-ray diffraction of cisplatin binding to HEWL in aqueous media after 15 months of crystal storage" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CPT", "DMS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4G4B", "evidence_id": "EV-PDB-4G4B-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "4G4B", "doi": "10.1107/S1744309112042005", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4G4B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature X-ray diffraction study of cisplatin binding to HEWL in DMSO media with NAG after 7 months of crystal storage" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DMS", "QPT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4G4C", "evidence_id": "EV-PDB-4G4C-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "4G4C", "doi": "10.1107/S1744309112042005", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4G4C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature X-ray diffraction study of carboplatin binding to HEWL in DMSO media after 13 months of crystal storage" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DMS", "QPT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4G4H", "evidence_id": "EV-PDB-4G4H-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "4G4H", "doi": "10.1107/S1744309112042005", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4G4H" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "100K X-ray diffraction study of carboplatin binding to HEWL in DMSO media after 13 months of crystal storage" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CPT", "DMS", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4GCB", "evidence_id": "EV-PDB-4GCB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "4GCB", "doi": "10.1107/S090744491204423X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4GCB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "100K X-ray diffraction study of a 6-fold molar excess of a cisplatin/carboplatin mixture binding to HEWL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CPT", "DMS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4GCC", "evidence_id": "EV-PDB-4GCC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "4GCC", "doi": "10.1107/S090744491204423X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4GCC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature X-ray diffraction study of a 6-fold molar excess of a cisplatin/carboplatin mixture binding to HEWL, Dataset 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CPT", "DMS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4GCD", "evidence_id": "EV-PDB-4GCD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "4GCD", "doi": "10.1107/S090744491204423X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4GCD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature X-ray diffraction study of a 6-fold molar excess of a cisplatin/carboplatin mixture binding to HEWL, Dataset 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CPT", "DMS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4GCE", "evidence_id": "EV-PDB-4GCE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.9 }, "provenance": { "deposit_id": "4GCE", "doi": "10.1107/S090744491204423X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4GCE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature X-ray diffraction study of a 6-fold molar excess of a cisplatin/carboplatin mixture binding to HEWL, Dataset 3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DMS", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4GCF", "evidence_id": "EV-PDB-4GCF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.5 }, "provenance": { "deposit_id": "4GCF", "doi": "10.1107/S090744491204423X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4GCF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature X-ray diffraction study of a 6-fold molar excess of a cisplatin/carboplatin mixture binding to HEWL, Dataset 4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EPE", "GOL", "PO4", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.3, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,C,E,G)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4GLV", "evidence_id": "EV-PDB-4GLV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.574 }, "provenance": { "deposit_id": "4GLV", "doi": "10.1371/journal.pone.0086050", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4GLV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "OBody AM3L09 bound to hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EPE", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,C,E,G,I,K,M,O,Q)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4GN3", "evidence_id": "EV-PDB-4GN3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "4GN3", "doi": "10.1371/journal.pone.0086050", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4GN3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "OBody AM1L10 bound to hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.3, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4GLA", "evidence_id": "EV-PDB-4GLA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.75 }, "provenance": { "deposit_id": "4GLA", "doi": "10.1371/journal.pone.0086050", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4GLA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "OBody NL8 bound to hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "0UF", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4FJR", "evidence_id": "EV-PDB-4FJR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.86 }, "provenance": { "deposit_id": "4FJR", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4FJR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mode of interaction of Merocyanine 540 with HEW Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4ETE", "evidence_id": "EV-PDB-4ETE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.905 }, "provenance": { "deposit_id": "4ETE", "doi": "10.1126/science.1217737", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4ETE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme, room-temperature, rotating anode, 0.0021 MGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4ETD", "evidence_id": "EV-PDB-4ETD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.904 }, "provenance": { "deposit_id": "4ETD", "doi": "10.1126/science.1217737", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4ETD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme, room-temperature, rotating anode, 0.0026 MGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4ETA", "evidence_id": "EV-PDB-4ETA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.91 }, "provenance": { "deposit_id": "4ETA", "doi": "10.1126/science.1217737", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4ETA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme, room temperature, 400 kGy dose" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4ET8", "evidence_id": "EV-PDB-4ET8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "4ET8", "doi": "10.1126/science.1217737", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4ET8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme solved from 40 fs free-electron laser pulse data" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "ZN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4DT3", "evidence_id": "EV-PDB-4DT3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "4DT3", "doi": "10.1107/S0907444912024420", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4DT3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of zinc-charged lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CPT", "DMS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4DDC", "evidence_id": "EV-PDB-4DDC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "4DDC", "doi": "10.1107/S0907444912006907", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4DDC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "EVAL processed HEWL, cisplatin DMSO NAG silicone oil" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4DD0", "evidence_id": "EV-PDB-4DD0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "4DD0", "doi": "10.1107/S0907444912006907", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4DD0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "EVAL processed HEWL, cisplatin aqueous glycerol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4D9Z", "evidence_id": "EV-PDB-4D9Z-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.709 }, "provenance": { "deposit_id": "4D9Z", "doi": "10.1038/srep22475", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4D9Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme at 318K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MRD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4B4J", "evidence_id": "EV-PDB-4B4J-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "4B4J", "doi": "10.1107/S1399004714025061", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4B4J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "1.25 A Structure of Lysozyme Crystallized with (RS)-2-methyl-2,4- pentanediol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MPD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4B4I", "evidence_id": "EV-PDB-4B4I-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "4B4I", "doi": "10.1107/S1399004714025061", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4B4I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "1.20 A Structure of Lysozyme Crystallized with (S)-2-methyl-2,4- pentanediol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "TRS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4B49", "evidence_id": "EV-PDB-4B49-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.15 }, "provenance": { "deposit_id": "4B49", "doi": "10.1107/S1399004714025061", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4B49" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "1.15 A Structure of Lysozyme Crystallized without 2-methyl-2,4- pentanediol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4A7D", "evidence_id": "EV-PDB-4A7D-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.497 }, "provenance": { "deposit_id": "4A7D", "doi": "10.1107/S1744309112009670", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4A7D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray crystal structure of HEWL flash-cooled at high pressure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4GN4", "evidence_id": "EV-PDB-4GN4-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.861 }, "provenance": { "deposit_id": "4GN4", "doi": "10.1371/journal.pone.0086050", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4GN4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "OBody AM2EP06 bound to hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "EPE", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4GN5", "evidence_id": "EV-PDB-4GN5-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.86 }, "provenance": { "deposit_id": "4GN5", "doi": "10.1371/journal.pone.0086050", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4GN5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "OBody AM3L15 bound to hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EU", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4H1P", "evidence_id": "EV-PDB-4H1P-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "4H1P", "doi": "10.1107/S1744309112047562", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4H1P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Use of Europium for SAD Phasing at the Cu K alpha wavelength" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4H8X", "evidence_id": "EV-PDB-4H8X-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1998 }, "provenance": { "deposit_id": "4H8X", "doi": "10.1107/S0907444913022117", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4H8X" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Radiation damage study of lysozyme - 0.07 MGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4H8Y", "evidence_id": "EV-PDB-4H8Y-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1998 }, "provenance": { "deposit_id": "4H8Y", "doi": "10.1107/S0907444913022117", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4H8Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Radiation damage study of lysozyme- 0.14 MGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4H8Z", "evidence_id": "EV-PDB-4H8Z-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1998 }, "provenance": { "deposit_id": "4H8Z", "doi": "10.1107/S0907444913022117", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4H8Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Radiation damage study of lysozyme - 0.21 MGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4H90", "evidence_id": "EV-PDB-4H90-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1999 }, "provenance": { "deposit_id": "4H90", "doi": "10.1107/S0907444913022117", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4H90" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Radiation damage study of lysozyme - 0.28 MGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4H91", "evidence_id": "EV-PDB-4H91-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2002 }, "provenance": { "deposit_id": "4H91", "doi": "10.1107/S0907444913022117", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4H91" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Radiation damage study of lysozyme - 0.35 MGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4H92", "evidence_id": "EV-PDB-4H92-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2002 }, "provenance": { "deposit_id": "4H92", "doi": "10.1107/S0907444913022117", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4H92" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Radiation damage study of lysozyme- 0.42 MGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4H93", "evidence_id": "EV-PDB-4H93-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2003 }, "provenance": { "deposit_id": "4H93", "doi": "10.1107/S0907444913022117", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4H93" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Radiation damage study of lysozyme - 0.49 MGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4H94", "evidence_id": "EV-PDB-4H94-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "4H94", "doi": "10.1107/S0907444913022117", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4H94" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Radiation damage in lysozyme - 0.56 MGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4H9A", "evidence_id": "EV-PDB-4H9A-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1997 }, "provenance": { "deposit_id": "4H9A", "doi": "10.1107/S0907444913022117", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4H9A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Radiation damage study of lysozyme - 0.63 MGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4H9B", "evidence_id": "EV-PDB-4H9B-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1998 }, "provenance": { "deposit_id": "4H9B", "doi": "10.1107/S0907444913022117", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4H9B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Radiation damage study of lysozyme - 0.70 MGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4H9C", "evidence_id": "EV-PDB-4H9C-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1998 }, "provenance": { "deposit_id": "4H9C", "doi": "10.1107/S0907444913022117", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4H9C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Radiation damage study of lysozyme - 0.77 MGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4H9E", "evidence_id": "EV-PDB-4H9E-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1998 }, "provenance": { "deposit_id": "4H9E", "doi": "10.1107/S0907444913022117", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4H9E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Radiation damage study of lysozyme - 0.84 MGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4H9F", "evidence_id": "EV-PDB-4H9F-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2003 }, "provenance": { "deposit_id": "4H9F", "doi": "10.1107/S0907444913022117", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4H9F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Radiation damage study of lysozyme - 0.91 MGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4H9I", "evidence_id": "EV-PDB-4H9I-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2002 }, "provenance": { "deposit_id": "4H9I", "doi": "10.1107/S0907444913022117", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4H9I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Radiation damage study of lysozyme - 1.05 MGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-1-DEOXYNOJIRIMYCIN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -178.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4HP0", "evidence_id": "EV-PDB-4HP0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.19 }, "provenance": { "deposit_id": "4HP0", "doi": "10.1074/jbc.M112.439281", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4HP0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Hen Egg White Lysozyme in complex with GN3-M" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-1-DEOXYNOJIRIMYCIN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -178.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4HPI", "evidence_id": "EV-PDB-4HPI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.19 }, "provenance": { "deposit_id": "4HPI", "doi": "10.1074/jbc.M112.439281", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4HPI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Hen Egg White Lysozyme complex with GN2-M" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ARG", "CL", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4HSF", "evidence_id": "EV-PDB-4HSF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.82 }, "provenance": { "deposit_id": "4HSF", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4HSF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme with Arginine at 318K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.73, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4HTK", "evidence_id": "EV-PDB-4HTK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "4HTK", "doi": "10.1107/S0907444913009335", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4HTK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mitigation of X-ray damage in macromolecular crystallography by submicrometer line focusing; total dose 2.17 x 10e+12 X-ray photons" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.73, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4HTN", "evidence_id": "EV-PDB-4HTN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "4HTN", "doi": "10.1107/S0907444913009335", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4HTN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mitigation of X-ray damage in macromolecular crystallography by submicrometer line focusing; total dose 1.32 x 10e+12 X-ray photons" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.73, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4HTQ", "evidence_id": "EV-PDB-4HTQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.399 }, "provenance": { "deposit_id": "4HTQ", "doi": "10.1107/S0907444913009335", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4HTQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mitigation of X-ray damage in macromolecular crystallography by submicrometer line focusing; total dose 6.70 x 10e+11 X-ray photons" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4HV1", "evidence_id": "EV-PDB-4HV1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "4HV1", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4HV1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Laser-induced microfragmentation of lysozyme crystals allows X-ray nanodiffraction characterization of individual domains (lb4)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4HV2", "evidence_id": "EV-PDB-4HV2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.501 }, "provenance": { "deposit_id": "4HV2", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4HV2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Laser-induced microfragmentation of lysozyme crystals allows X-ray nanodiffraction characterization of individual domains (lb5)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4I8S", "evidence_id": "EV-PDB-4I8S-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "4I8S", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4I8S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Lysozyme protein crystallization via standard hanging drop vapor diffusion" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4IAT", "evidence_id": "EV-PDB-4IAT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "4IAT", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4IAT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEW Lysozyme by langmuir- blodgett modified vapour diffusion" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "010", "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4II8", "evidence_id": "EV-PDB-4II8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.88 }, "provenance": { "deposit_id": "4II8", "doi": "10.1038/srep22475", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4II8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme with Benzyl alcohol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "RU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4J1B", "evidence_id": "EV-PDB-4J1B-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.66 }, "provenance": { "deposit_id": "4J1B", "doi": "10.1021/ic4004142", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4J1B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct between hen egg white lysozyme and AziRu (black crystal)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "RBN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.3, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4J7V", "evidence_id": "EV-PDB-4J7V-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.54 }, "provenance": { "deposit_id": "4J7V", "doi": "10.1002/asia.201301347", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4J7V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of cross-linked hen egg white lysozyme soaked with 5mM [Ru(benzene)Cl2]2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "LCP", "NI", "SNF" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4KXI", "evidence_id": "EV-PDB-4KXI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "4KXI", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4KXI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystallographic study of the complex of Ni(II) Schiff base complex and HEW Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AU", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LFX", "evidence_id": "EV-PDB-4LFX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "4LFX", "doi": "10.1039/c3cc46400h", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LFX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct between hen egg white lysozyme and Auoxo6, a dinuclear gold(III) complex with -dioxo bridges linking the two metal centers" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AU", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LGK", "evidence_id": "EV-PDB-4LGK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.96 }, "provenance": { "deposit_id": "4LGK", "doi": "10.1039/c3cc46400h", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LGK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct between hen egg white lysozyme and Au2Phen, a dinuclear gold(III) complex with -dioxo bridges linking the two metal centers" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DMS", "MPD", "QPT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LT0", "evidence_id": "EV-PDB-4LT0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "4LT0", "doi": "10.1107/S2053230X14016161", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LT0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL co-crystallized with Carboplatin in non-NaCl conditions: crystal 1 processed using the EVAL software package" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DMS", "MPD", "QPT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -163.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LT1", "evidence_id": "EV-PDB-4LT1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "4LT1", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LT1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL co-crystallised with Carboplatin in non-NaCl conditions: crystal 1 processed using the XDS software package" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DMS", "MPD", "QPT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -146.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LT2", "evidence_id": "EV-PDB-4LT2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "4LT2", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LT2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL co-crystallized with Carboplatin in non-NaCl conditions: crystal 2 processed using the EVAL software package" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LYB", "evidence_id": "EV-PDB-4LYB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "4LYB", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LYB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CdS within a lysoyzme single crystal" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LYC", "evidence_id": "EV-PDB-4LYC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "4LYC", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LYC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Cd ions within a lysoyzme single crystal" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.3, "salt_mM": null, "temperature_c": 11.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LYO", "evidence_id": "EV-PDB-4LYO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.05 }, "provenance": { "deposit_id": "4LYO", "doi": "10.1016/S0167-4838(98)00027-2", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LYO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CROSS-LINKED CHICKEN LYSOZYME CRYSTAL IN NEAT ACETONITRILE, THEN BACK-SOAKED IN WATER" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4M4O", "evidence_id": "EV-PDB-4M4O-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "4M4O", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4M4O" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the aptamer minE-lysozyme complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,C,E,G,I,K)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4M6D", "evidence_id": "EV-PDB-4M6D-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.68 }, "provenance": { "deposit_id": "4M6D", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4M6D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the aptamer minF-lysozyme complex." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LZT", "evidence_id": "EV-PDB-4LZT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.95 }, "provenance": { "deposit_id": "4LZT", "doi": "10.1107/S0907444997013656", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LZT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "ATOMIC RESOLUTION REFINEMENT OF TRICLINIC HEW LYSOZYME AT 295K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LYZ", "evidence_id": "EV-PDB-4LYZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "4LYZ", "doi": "10.1016/0022-2836(74)90598-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LYZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Real-space refinement of the structure of hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LYT", "evidence_id": "EV-PDB-4LYT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "4LYT", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LYT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "COMPARISON OF RADIATION-INDUCED DECAY AND STRUCTURE REFINEMENT FROM X-RAY DATA COLLECTED FROM LYSOZYME CRYSTALS AT LOW AND AMBIENT TEMPERATURES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LYM", "evidence_id": "EV-PDB-4LYM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "4LYM", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LYM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF LOW HUMIDITY TETRAGONAL LYSOZYME AT 2.1-ANGSTROMS RESOLUTION. VARIABILITY IN HYDRATION SHELL AND ITS STRUCTURAL CONSEQUENCES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DMS", "MPD", "QPT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -146.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LT3", "evidence_id": "EV-PDB-4LT3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "4LT3", "doi": "10.1107/S2053230X14016161", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LT3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL co-crystallized with Carboplatin in non-NaCl conditions: crystal 2 processed using the XDS software package" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AU", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4LFP", "evidence_id": "EV-PDB-4LFP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.72 }, "provenance": { "deposit_id": "4LFP", "doi": "10.1039/c3cc46400h", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4LFP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct between hen egg white lysozyme and a homoleptic gold(I) complex with the saccharynate ligand" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "RU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4J1A", "evidence_id": "EV-PDB-4J1A-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.79 }, "provenance": { "deposit_id": "4J1A", "doi": "10.1021/ic4004142", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4J1A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct between hen egg white lysozyme and AziRu (green crystal)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4IAS", "evidence_id": "EV-PDB-4IAS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "4IAS", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4IAS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEW Lysozyme by langmuir- blodgett modified vapour diffusion" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4H9H", "evidence_id": "EV-PDB-4H9H-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2002 }, "provenance": { "deposit_id": "4H9H", "doi": "10.1107/S0907444913022117", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4H9H" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Radiation damage study of lysozyme - 0.98 MGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BEN", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4N8Z", "evidence_id": "EV-PDB-4N8Z-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "4N8Z", "doi": "10.1107/S1399004713034603", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4N8Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "In situ lysozyme crystallized on a MiTeGen micromesh with benzamidine ligand" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NG1", "evidence_id": "EV-PDB-4NG1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.82 }, "provenance": { "deposit_id": "4NG1", "doi": "10.1107/S1399004714011304", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NG1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Previously de-ionized HEW lysozyme batch crystallized in 1.9 M CsCl" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NG8", "evidence_id": "EV-PDB-4NG8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.09 }, "provenance": { "deposit_id": "4NG8", "doi": "10.1107/S1399004714011304", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NG8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Dialyzed HEW lysozyme batch crystallized in 1.9 M CsCl and collected at 100 K." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "RB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NGJ", "evidence_id": "EV-PDB-4NGJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "4NGJ", "doi": "10.1107/S1399004714011304", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NGJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Dialyzed HEW lysozyme batch crystallized in 1.0 M RbCl and collected at 100 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NGK", "evidence_id": "EV-PDB-4NGK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "4NGK", "doi": "10.1107/S1399004714011304", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NGK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Previously de-ionized HEW lysozyme batch crystallized in 0.2 M CoCl2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "YB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NGV", "evidence_id": "EV-PDB-4NGV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.64 }, "provenance": { "deposit_id": "4NGV", "doi": "10.1107/S1399004714011304", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NGV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Previously de-ionized HEW lysozyme batch crystallized in 0.5 M YbCl3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "YB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NGW", "evidence_id": "EV-PDB-4NGW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.37 }, "provenance": { "deposit_id": "4NGW", "doi": "10.1107/S1399004714011304", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NGW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Dialyzed HEW lysozyme batch crystallized in 0.5 M YbCl3 and collected at 100 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "YB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NGY", "evidence_id": "EV-PDB-4NGY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "4NGY", "doi": "10.1107/S1399004714011304", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NGY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Dialyzed HEW lysozyme batch crystallized in 0.75 M YbCl3 and collected at 100 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "YB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NGZ", "evidence_id": "EV-PDB-4NGZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "4NGZ", "doi": "10.1107/S1399004714011304", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NGZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Previously de-ionized HEW lysozyme crystallized in 0.5 M YbCl3/30% (v/v) glycerol and collected at 125K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NHI", "evidence_id": "EV-PDB-4NHI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.34 }, "provenance": { "deposit_id": "4NHI", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NHI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Hen egg-white lysozyme in Tris buffer at pH 7.5 with Magnesium formate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "2T8", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NHP", "evidence_id": "EV-PDB-4NHP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.42 }, "provenance": { "deposit_id": "4NHP", "doi": "10.1021/ic501498g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NHP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the complex between the hen egg white lysozyme and pentachlorocarbonyliridate (III) (4 days)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "2T8", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NHQ", "evidence_id": "EV-PDB-4NHQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.92 }, "provenance": { "deposit_id": "4NHQ", "doi": "10.1021/ic501498g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NHQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the complex between hen egg white lysozyme and pentachlorocarbonyliridate(III) (5 days)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "2T8", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NHS", "evidence_id": "EV-PDB-4NHS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.99 }, "provenance": { "deposit_id": "4NHS", "doi": "10.1021/ic501498g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NHS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the complex between hen egg white lysozyme and pentachlorocarbonyliridate(III) (9 days)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AU", "EDO", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4OOT", "evidence_id": "EV-PDB-4OOT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "4OOT", "doi": "10.1021/ml500231b", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4OOT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the protein-gold adduct formed upon reaction of Aubipic with hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AU", "EDO", "NA", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4QY9", "evidence_id": "EV-PDB-4QY9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.05 }, "provenance": { "deposit_id": "4QY9", "doi": "10.1039/c4dt02332c", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4QY9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct between hen egg white lysozyme and Auoxo3, a cytotoxic gold(III) compound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "I83" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4QGZ", "evidence_id": "EV-PDB-4QGZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.51 }, "provenance": { "deposit_id": "4QGZ", "doi": "10.1021/ic5012583", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4QGZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed between hen egg white lysozyme and trans-dimethylamine methylamine dichlorido platinum(II)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.9, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4QEQ", "evidence_id": "EV-PDB-4QEQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.381 }, "provenance": { "deposit_id": "4QEQ", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4QEQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High resolution structure of egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "T3Y" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.3, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4PRU", "evidence_id": "EV-PDB-4PRU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "4PRU", "doi": "10.1039/C4SC02383H", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4PRU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of dimethyllysine hen egg-white lysozyme in complex with sclx4 at 2.2 A resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MG", "P6G", "PG4", "PG6", "T3Y" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.3, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4PRQ", "evidence_id": "EV-PDB-4PRQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.72 }, "provenance": { "deposit_id": "4PRQ", "doi": "10.1039/c4cc04897k", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4PRQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF HEN EGG-WHITE LYSOZYME IN COMPLEX WITH SCLX4 AT 1.72 A RESOLUTION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1PT", "EDO", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4PPO", "evidence_id": "EV-PDB-4PPO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.73 }, "provenance": { "deposit_id": "4PPO", "doi": "10.1039/c4cc02254h", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4PPO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "First Crystal Structure for an Oxaliplatin-Protein Complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "GOL", "NA", "TEW" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4PHI", "evidence_id": "EV-PDB-4PHI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.811 }, "provenance": { "deposit_id": "4PHI", "doi": "10.1002/cbic.201402597", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4PHI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of HEWL with hexatungstotellurate(VI)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains B,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4PGJ", "evidence_id": "EV-PDB-4PGJ-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "4PGJ", "doi": "10.1074/jbc.M114.614842", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4PGJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Human heavy-chain domain antibody in complex with hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CU", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4P2E", "evidence_id": "EV-PDB-4P2E-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "4P2E", "doi": "10.1107/S1399004714013728", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4P2E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Acoustic transfer of protein crystals from agar pedestals to micromeshes for high throughput screening of heavy atom derivatives" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "6BP", "ACT", "BR", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4OWH", "evidence_id": "EV-PDB-4OWH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.484 }, "provenance": { "deposit_id": "4OWH", "doi": "10.1107/S2053230X14014009", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4OWH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PtBr6 binding to HEWL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4OWE", "evidence_id": "EV-PDB-4OWE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.41 }, "provenance": { "deposit_id": "4OWE", "doi": "10.1107/S2053230X14014009", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4OWE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PtCl6 binding to HEWL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "IOD", "NA", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4OWC", "evidence_id": "EV-PDB-4OWC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.62 }, "provenance": { "deposit_id": "4OWC", "doi": "10.1107/S2053230X14014009", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4OWC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PtI6 binding to HEWL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "BR", "CL", "DMS", "MEB", "NA", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4OWB", "evidence_id": "EV-PDB-4OWB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.69 }, "provenance": { "deposit_id": "4OWB", "doi": "10.1107/S2053230X14013995", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4OWB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Cisplatin binding to HEWL under sodium bromide crystallisation conditions" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "DMS", "IOD", "QPT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4OWA", "evidence_id": "EV-PDB-4OWA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.796 }, "provenance": { "deposit_id": "4OWA", "doi": "10.1107/S2053230X14013995", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4OWA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carboplatin binding to HEWL under sodium iodide crystallisation conditions" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "RU0" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4OOO", "evidence_id": "EV-PDB-4OOO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.15 }, "provenance": { "deposit_id": "4OOO", "doi": "10.1002/anie.201403337", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4OOO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the lysozyme derivative of tetrakis(acetato)chlorido diruthenium(II,III) complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4O34", "evidence_id": "EV-PDB-4O34-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.09 }, "provenance": { "deposit_id": "4O34", "doi": "10.1107/S2052252514010070", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4O34" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature macromolecular serial crystallography using synchrotron radiation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "RU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NY5", "evidence_id": "EV-PDB-4NY5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "4NY5", "doi": "10.1039/c3dt53582g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NY5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed between hen egg white lysozyme and NAMI-A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "XE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NWH", "evidence_id": "EV-PDB-4NWH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "4NWH", "doi": "10.1097/ALN.0000000000000435", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NWH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme UNDER 30 BAR PRESSURE OF XENON" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "N2O" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NWE", "evidence_id": "EV-PDB-4NWE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.58 }, "provenance": { "deposit_id": "4NWE", "doi": "10.1097/ALN.0000000000000435", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NWE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme UNDER 30 BAR PRESSURE OF NITROUS OXIDE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DMS", "FMT", "NA", "QPT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NSJ", "evidence_id": "EV-PDB-4NSJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "4NSJ", "doi": "10.1107/S2053230X14016161", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NSJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carboplatin binding to HEWL in 2M NH4formate, 0.1M HEPES at pH 7.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DMS", "FLC", "QPT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NSI", "evidence_id": "EV-PDB-4NSI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "4NSI", "doi": "10.1107/S2053230X14016161", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NSI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carboplatin binding to HEWL in 20% propanol, 20% PEG 4000 at pH5.6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "DMS", "QPT", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NSH", "evidence_id": "EV-PDB-4NSH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "4NSH", "doi": "10.1107/S2053230X14016161", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NSH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carboplatin binding to HEWL in 0.2M NH4SO4, 0.1M NaAc in 25% PEG 4000 at pH 4.6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "BR", "DMS", "NA", "QPT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NSG", "evidence_id": "EV-PDB-4NSG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "4NSG", "doi": "10.1107/S2053230X14016161", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NSG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carboplatin binding to HEWL in NaBr crystallisation conditions studied at an X-ray wavelength of 1.5418A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "2T8", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NIJ", "evidence_id": "EV-PDB-4NIJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.86 }, "provenance": { "deposit_id": "4NIJ", "doi": "10.1021/ic501498g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NIJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the complex between hen egg white lysozyme and pentachlorocarbonyliridate(III) (30 days)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "2T8", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NHT", "evidence_id": "EV-PDB-4NHT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "4NHT", "doi": "10.1021/ic501498g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NHT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the complex between hen egg white lysozyme and pentachlorocarbonyliridate(III) (6 days)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NGO", "evidence_id": "EV-PDB-4NGO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.58 }, "provenance": { "deposit_id": "4NGO", "doi": "10.1107/S1399004714011304", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NGO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Previously de-ionized HEW lysozyme batch crystallized in 1.0 M CoCl2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NGL", "evidence_id": "EV-PDB-4NGL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.52 }, "provenance": { "deposit_id": "4NGL", "doi": "10.1107/S1399004714011304", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NGL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Previously de-ionized HEW lysozyme batch crystallized in 0.6 M CoCl2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "RB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NGI", "evidence_id": "EV-PDB-4NGI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "4NGI", "doi": "10.1107/S1399004714011304", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NGI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Previously de-ionized HEW lysozyme crystallized in 1.0 M RbCl and collected at 125K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NFV", "evidence_id": "EV-PDB-4NFV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.63 }, "provenance": { "deposit_id": "4NFV", "doi": "10.1107/S1399004714011304", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NFV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Previously de-ionized HEW lysozyme batch crystallized in 1.1 M MnCl2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "MN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4NEB", "evidence_id": "EV-PDB-4NEB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.48 }, "provenance": { "deposit_id": "4NEB", "doi": "10.1107/S1399004714011304", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4NEB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Previously de-ionized HEW lysozyme batch crystallized in 0.5 M MnCl2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "2T8", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4N9R", "evidence_id": "EV-PDB-4N9R-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "4N9R", "doi": "10.1021/ic501498g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4N9R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the complex between hen egg white lysozyme and pentacholrocarbonyliridate(III) (1 day)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DO3", "GD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4N5R", "evidence_id": "EV-PDB-4N5R-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "4N5R", "doi": "10.1038/nature12773", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4N5R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme phased using free-electron laser data" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains I,J,K,L)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4N1E", "evidence_id": "EV-PDB-4N1E-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.23 }, "provenance": { "deposit_id": "4N1E", "doi": "10.1073/pnas.1613477114", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4N1E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structural evidence for antigen receptor evolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4N1C", "evidence_id": "EV-PDB-4N1C-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "4N1C", "doi": "10.1073/pnas.1613477114", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4N1C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structural evidence for antigen receptor evolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "MG", "NA", "T3Y" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.1, "salt_mM": null, "temperature_c": -74.35 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4N0J", "evidence_id": "EV-PDB-4N0J-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "4N0J", "doi": "10.1039/C4SC02383H", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4N0J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of dimethyllysine hen egg-white lysozyme in complex with sclx4 at 1.9 A resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "YPT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.2, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4MR1", "evidence_id": "EV-PDB-4MR1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.99 }, "provenance": { "deposit_id": "4MR1", "doi": "10.1021/ic402611m", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4MR1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct between hen egg white lysozyme and cis-diamminediiodoplatinum(II)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4R0F", "evidence_id": "EV-PDB-4R0F-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.941 }, "provenance": { "deposit_id": "4R0F", "doi": "10.1038/srep22475", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4R0F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Lysozyme Dimer at 318K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "6BP", "BR", "CL", "NA", "TBR" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4R6C", "evidence_id": "EV-PDB-4R6C-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "4R6C", "doi": "10.1039/c4fd00166d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4R6C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray diffraction in temporally and spatially resolved biomolecular science: the X-ray crystal structure of hen egg white lysozyme cocrystallized with Ta6Br12 and then a crystal soaked in K2PtBr6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4RDS", "evidence_id": "EV-PDB-4RDS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.23 }, "provenance": { "deposit_id": "4RDS", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4RDS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme crystallized with red food coloring dye" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4RLM", "evidence_id": "EV-PDB-4RLM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "4RLM", "doi": "10.1107/S1399004714026327", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4RLM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme solved from serial crystallography at a synchrotron source, data processed with CrystFEL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4RLN", "evidence_id": "EV-PDB-4RLN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.17 }, "provenance": { "deposit_id": "4RLN", "doi": "10.1107/S1399004714026327", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4RLN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme solved from serial crystallography at a synchrotron source, data processed with nXDS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4RW1", "evidence_id": "EV-PDB-4RW1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "4RW1", "doi": "10.1107/S1600577515004002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4RW1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme structure from a spent-beam experiment at LCLS: original beam" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4RW2", "evidence_id": "EV-PDB-4RW2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "4RW2", "doi": "10.1107/S1600577515004002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4RW2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme structure from a spent-beam experiment at LCLS: refocused beam" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4TSA", "evidence_id": "EV-PDB-4TSA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.27 }, "provenance": { "deposit_id": "4TSA", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4TSA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of a lysozyme FAb complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4TSB", "evidence_id": "EV-PDB-4TSB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "4TSB", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4TSB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of a lysozyme antibody complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4TSC", "evidence_id": "EV-PDB-4TSC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.92 }, "provenance": { "deposit_id": "4TSC", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4TSC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of a lysozyme antibody complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4TTD", "evidence_id": "EV-PDB-4TTD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.15 }, "provenance": { "deposit_id": "4TTD", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4TTD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of a lysozyme antibody complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "MVH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4TUN", "evidence_id": "EV-PDB-4TUN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.925 }, "provenance": { "deposit_id": "4TUN", "doi": "10.1007/s00216-014-7953-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4TUN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Chicken egg white lysozyme adduct with Organophosphorus pesticide Monochrotophos" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DO3", "GD", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -183.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4TWS", "evidence_id": "EV-PDB-4TWS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "4TWS", "doi": "10.1111/febs.12922", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4TWS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Gadolinium Derivative of Tetragonal Hen Egg-White Lysozyme at 1.45 A Resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains B,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4U3X", "evidence_id": "EV-PDB-4U3X-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.26 }, "provenance": { "deposit_id": "4U3X", "doi": "10.1074/jbc.M114.614842", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4U3X" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of a human VH antibody domain binding to the cleft of hen egg lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CMO", "GOL", "NA", "RU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4UWN", "evidence_id": "EV-PDB-4UWN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.67 }, "provenance": { "deposit_id": "4UWN", "doi": "10.1039/C4DT02966F", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4UWN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme soaked with a ruthenium based CORM with a methione oxide ligand (complex 6b)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CMO", "FMT", "NA", "RU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4UWU", "evidence_id": "EV-PDB-4UWU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.78 }, "provenance": { "deposit_id": "4UWU", "doi": "10.1039/C4DT02966F", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4UWU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme soaked with a ruthenium based CORM with a pyridine ligand (complex 7)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CMO", "NA", "RU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4UWV", "evidence_id": "EV-PDB-4UWV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.77 }, "provenance": { "deposit_id": "4UWV", "doi": "10.1039/C4DT02966F", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4UWV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme soaked with a ruthenium based CORM with a pyridine ligand (complex 8)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DMF", "NA", "RU", "RU1", "ZXK" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4W94", "evidence_id": "EV-PDB-4W94-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "4W94", "doi": "10.1021/ic502159x", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4W94" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of cross-linked tetragonal hen egg white lysozyme soaked with 5mM [Ru(CO)3Cl2]2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DMF", "NA", "RU", "ZXK" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4W96", "evidence_id": "EV-PDB-4W96-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "4W96", "doi": "10.1021/ic502159x", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4W96" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of cross-linked tetragonal hen egg white lysozyme soaked with 5mM [Ru(CO)3Cl2]2 followed by the reaction in deoxy-myoglobin solution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4WG1", "evidence_id": "EV-PDB-4WG1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "4WG1", "doi": "10.1107/S1399004715004514", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4WG1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature crystal structure of lysozyme determined by serial synchrotron crystallography (micro focused beam - crystFEL)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4WG7", "evidence_id": "EV-PDB-4WG7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "4WG7", "doi": "10.1107/S1399004715004514", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4WG7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room-temperature crystal structure of lysozyme determined by serial synchrotron crystallography using a nano focused beam." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4WL6", "evidence_id": "EV-PDB-4WL6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "4WL6", "doi": "10.1107/S1399004715004514", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4WL6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Raster-scanning protein crystallography using micro and nano-focused synchrotron beams" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4WL7", "evidence_id": "EV-PDB-4WL7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "4WL7", "doi": "10.1107/S1399004715004514", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4WL7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room-temperature crystal structure of lysozyme determined by serial synchrotron crystallography using a micro focused beam (Conventional resolution cut-off)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4WLD", "evidence_id": "EV-PDB-4WLD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.54 }, "provenance": { "deposit_id": "4WLD", "doi": "10.1107/S1399004715000292", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4WLD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High pressure protein crystallography of hen egg white lysozyme at 0.1 MPa" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4WLT", "evidence_id": "EV-PDB-4WLT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "4WLT", "doi": "10.1107/S1399004715000292", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4WLT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High pressure protein crystallography of hen egg white lysozyme at 190 MPa" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4WLX", "evidence_id": "EV-PDB-4WLX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "4WLX", "doi": "10.1107/S1399004715000292", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4WLX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High pressure protein crystallography of hen egg white lysozyme at 280 MPa" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4WLY", "evidence_id": "EV-PDB-4WLY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.62 }, "provenance": { "deposit_id": "4WLY", "doi": "10.1107/S1399004715000292", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4WLY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High pressure protein crystallography of hen egg white lysozyme at 380 MPa" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4WM1", "evidence_id": "EV-PDB-4WM1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "4WM1", "doi": "10.1107/S1399004715000292", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4WM1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High pressure protein crystallography of hen egg white lysozyme at 500 MPa" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4WM2", "evidence_id": "EV-PDB-4WM2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "4WM2", "doi": "10.1107/S1399004715000292", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4WM2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High pressure protein crystallography of hen egg white lysozyme at 600 MPa" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4WM3", "evidence_id": "EV-PDB-4WM3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "4WM3", "doi": "10.1107/S1399004715000292", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4WM3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High pressure protein crystallography of hen egg white lysozyme at 710 MPa" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4WM4", "evidence_id": "EV-PDB-4WM4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "4WM4", "doi": "10.1107/S1399004715000292", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4WM4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High pressure protein crystallography of hen egg white lysozyme at 800 MPa" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4WM5", "evidence_id": "EV-PDB-4WM5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "4WM5", "doi": "10.1107/S1399004715000292", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4WM5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High pressure protein crystallography of hen egg white lysozyme at 890 MPa" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A,B,C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4WM6", "evidence_id": "EV-PDB-4WM6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "4WM6", "doi": "10.1107/S1399004715000292", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4WM6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High pressure protein crystallography of hen egg white lysozyme at 950 MPa" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 20.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4WMG", "evidence_id": "EV-PDB-4WMG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "4WMG", "doi": "10.1107/S1399004715002308", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4WMG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of hen egg-white lysozyme from a microfludic harvesting device using synchrotron radiation (2.5A)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4WO6", "evidence_id": "EV-PDB-4WO6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.001 }, "provenance": { "deposit_id": "4WO6", "doi": "10.1002/smll.201403262", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4WO6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme Pre-surface acoustic wave" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4WO9", "evidence_id": "EV-PDB-4WO9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.99 }, "provenance": { "deposit_id": "4WO9", "doi": "10.1002/smll.201403262", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4WO9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme Post-Surface Acoustic Waves" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4WOA", "evidence_id": "EV-PDB-4WOA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "4WOA", "doi": "10.1002/smll.201403262", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4WOA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme Multiple Crystals After Surface Acoustic Wave Alignment" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4X3B", "evidence_id": "EV-PDB-4X3B-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "4X3B", "doi": "10.1038/srep10451", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4X3B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "A micro-patterned silicon chip as sample holder for macromolecular crystallography experiments with minimal background scattering" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "branched: beta-D-galactofuranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4XAD", "evidence_id": "EV-PDB-4XAD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "4XAD", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4XAD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme in complex with Galf-GlcNAc" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4XEN", "evidence_id": "EV-PDB-4XEN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "4XEN", "doi": "10.1107/S1399004715000292", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4XEN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High pressure protein crystallography of hen egg white lysozyme in complex with Tetra-N-acetylchitotetraose at 920 MPa" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4XJB", "evidence_id": "EV-PDB-4XJB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "4XJB", "doi": "10.1107/S1399004715005210", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4XJB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of Lysozyme1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4XJD", "evidence_id": "EV-PDB-4XJD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.801 }, "provenance": { "deposit_id": "4XJD", "doi": "10.1107/S1399004715005210", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4XJD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of Lysozyme2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BR", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4XJF", "evidence_id": "EV-PDB-4XJF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "4XJF", "doi": "10.1107/S1399004715005210", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4XJF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of Lysozyme B1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BR", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4XJG", "evidence_id": "EV-PDB-4XJG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "4XJG", "doi": "10.1107/S1399004715005210", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4XJG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of Lysozyme B2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4XJH", "evidence_id": "EV-PDB-4XJH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "4XJH", "doi": "10.1107/S1399004715005210", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4XJH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of LysozymeS1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4XJI", "evidence_id": "EV-PDB-4XJI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "4XJI", "doi": "10.1107/S1399004715005210", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4XJI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of LysozymeS2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BEN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4XN6", "evidence_id": "EV-PDB-4XN6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "4XN6", "doi": "10.1107/S1399004715010342", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4XN6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure at room temperature of hen-egg lysozyme in complex with benzamidine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DMS", "EDN", "ZKG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4XYY", "evidence_id": "EV-PDB-4XYY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.38 }, "provenance": { "deposit_id": "4XYY", "doi": "10.1002/chem.201501998", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4XYY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg-White Lysozyme (HEWL) complexed with Zr(IV)-substituted Keggin-type polyoxometalate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "BR", "CL", "DMS", "NA", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4YEM", "evidence_id": "EV-PDB-4YEM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.47 }, "provenance": { "deposit_id": "4YEM", "doi": "10.1107/S139900471500629X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4YEM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Carboplatin binding to HEWL in NaBr crystallisation conditions studied at an X-ray wavelength of 0.9163A - new refinement" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DMS", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4YEN", "evidence_id": "EV-PDB-4YEN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "4YEN", "doi": "10.1107/S139900471500629X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4YEN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature X-ray diffraction studies of cisplatin binding to HEWL in DMSO media after 14 months of crystal storage - new refinement" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4YM8", "evidence_id": "EV-PDB-4YM8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "4YM8", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4YM8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4YOP", "evidence_id": "EV-PDB-4YOP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "4YOP", "doi": "10.1107/S139900471501857X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4YOP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF HEN EGG-WHITE LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "4KV", "DMS", "EDO", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4Z3M", "evidence_id": "EV-PDB-4Z3M-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.15 }, "provenance": { "deposit_id": "4Z3M", "doi": "10.1021/acs.inorgchem.5b01238", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4Z3M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed in the reaction between lysozyme and a platinum(II) Complex with S,O Bidentate Ligands (9b)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4Z98", "evidence_id": "EV-PDB-4Z98-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "4Z98", "doi": "10.1107/S1399004715015011", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4Z98" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Hen Egg White Lysozyme using Serial X-ray Diffraction Data Collection" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AU", "EDO", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4ZFP", "evidence_id": "EV-PDB-4ZFP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.96 }, "provenance": { "deposit_id": "4ZFP", "doi": "10.1007/s10534-015-9863-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4ZFP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "A new crystal structure for the adduct formed in the reaction between AuSac2, a cytotoxic homoleptic gold(I) compound with the saccharinate ligand, and the model protein hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5A3E", "evidence_id": "EV-PDB-5A3E-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.501 }, "provenance": { "deposit_id": "5A3E", "doi": "10.1038/NMETH.3043", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5A3E" }, "reader": null, "source_kind": "deposit", "technique": "microed", "title": "2.5A structure of lysozyme determined by MicroED with data from a single crystal" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5A3Z", "evidence_id": "EV-PDB-5A3Z-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.59 }, "provenance": { "deposit_id": "5A3Z", "doi": "10.1107/S1399004715017927", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5A3Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of monoclinic Lysozyme obtained by multi crystal data collection" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5AMY", "evidence_id": "EV-PDB-5AMY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "5AMY", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5AMY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Hen egg white lysozyme processed with the CrystalDirect automated mounting and cryo-cooling technology" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 23.85 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5APD", "evidence_id": "EV-PDB-5APD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5APD", "doi": "10.1063/1.4931825", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5APD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme not illuminated with 0.4THz radiation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 23.85 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5APE", "evidence_id": "EV-PDB-5APE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5APE", "doi": "10.1063/1.4931825", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5APE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme reference dataset odd frames" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5B05", "evidence_id": "EV-PDB-5B05-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "5B05", "doi": "10.1007/s12033-015-9908-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5B05" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme (control experiment)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5B06", "evidence_id": "EV-PDB-5B06-1", "mappings": [], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "5B06", "doi": "10.1007/s12033-015-9908-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5B06" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme (denatured by NaOD and refolded)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5B07", "evidence_id": "EV-PDB-5B07-1", "mappings": [], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "5B07", "doi": "10.1007/s12033-015-9908-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5B07" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme (denatured by DCl and refolded)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5B1G", "evidence_id": "EV-PDB-5B1G-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "5B1G", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5B1G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "KTO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -178.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5B59", "evidence_id": "EV-PDB-5B59-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "5B59", "doi": "10.1021/jacs.6b06692", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5B59" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme modified with a keto-ABNO." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "UTX" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5B5J", "evidence_id": "EV-PDB-5B5J-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.26 }, "provenance": { "deposit_id": "5B5J", "doi": "10.1016/j.xphs.2016.06.005", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5B5J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg white lysozyme with boron tracedrug UTX-97" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACY", "BR", "NA", "PE5" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5D5C", "evidence_id": "EV-PDB-5D5C-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5D5C", "doi": "10.1107/S2059798315021683", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5D5C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "In meso in situ serial X-ray crystallography structure of lysozyme at 100 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACY", "BR", "NA", "PE5" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5D5F", "evidence_id": "EV-PDB-5D5F-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "5D5F", "doi": "10.1107/S2059798315021683", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5D5F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "In meso in situ serial X-ray crystallography structure of lysozyme by bromine-SAD at 100 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "EDO", "IOD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5DL9", "evidence_id": "EV-PDB-5DL9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.38 }, "provenance": { "deposit_id": "5DL9", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5DL9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Tetragonal Lysozyme in complex with Iodine solved by UWO Students" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5DLA", "evidence_id": "EV-PDB-5DLA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.22 }, "provenance": { "deposit_id": "5DLA", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5DLA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Tetragonal Lysozyme solved by UWO Students" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5DM9", "evidence_id": "EV-PDB-5DM9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "5DM9", "doi": "10.1107/S2059798316001480", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5DM9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "XFEL structure of hen egg-white lysozyme solved using a droplet injector at SACLA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5EBH", "evidence_id": "EV-PDB-5EBH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "5EBH", "doi": "10.1107/S2059798316000954", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5EBH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure HEW Lysozyme processed with the CrystalDirect automated mounting and cryo-cooling technology" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5F14", "evidence_id": "EV-PDB-5F14-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.148 }, "provenance": { "deposit_id": "5F14", "doi": "10.1021/acs.biomac.5b01743", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5F14" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of native hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CPT", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5F9X", "evidence_id": "EV-PDB-5F9X-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.94 }, "provenance": { "deposit_id": "5F9X", "doi": "10.1007/s00775-016-1352-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5F9X" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-RAY STRUCTURE OF THE ADDUCT BETWEEN HEN EGG WHITE LYSOZYME AND CISPLATIN UPON 24 HOURS OF INCUBATION AT 55 DEGREES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "HFW", "K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5FHW", "evidence_id": "EV-PDB-5FHW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.52 }, "provenance": { "deposit_id": "5FHW", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5FHW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg-White Lysozyme (HEWL) complexed with Hf(IV)-substituted Wells Dawson-type polyoxometalate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "KR", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5FST", "evidence_id": "EV-PDB-5FST-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "5FST", "doi": "10.1107/S1600576716010992", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5FST" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of lysozyme prepared by the 'soak-and-freeze' method under 100 bar of krypton pressure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GAI" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5GWB", "evidence_id": "EV-PDB-5GWB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.001 }, "provenance": { "deposit_id": "5GWB", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5GWB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme native crystals soaked for 2 hours in precipitant solution containing 1 M guanidine hydrochloride and 25% glycerol, before data collection" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "BR", "DMS", "NA", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5HMJ", "evidence_id": "EV-PDB-5HMJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.29990102989 }, "provenance": { "deposit_id": "5HMJ", "doi": "10.1107/S2053230X16000777", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5HMJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Re-refinement of 4xan: hen lysozyme with carboplatin in sodium bromide solution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DMS", "NO3", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -123.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5HMV", "evidence_id": "EV-PDB-5HMV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.98 }, "provenance": { "deposit_id": "5HMV", "doi": "10.1063/1.4948613", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5HMV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Re refinement of 4mwk." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DMS", "NA", "NH3", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5HLL", "evidence_id": "EV-PDB-5HLL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5HLL", "doi": "10.1107/S2053230X16000856", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5HLL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Re-refinement of 4g4a: room-temperature X-ray diffraction study of cisplatin and its binding to His15 of HEWL after 14 months chemical exposure in the presence of DMSO." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5FEL", "evidence_id": "EV-PDB-5FEL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "5FEL", "doi": "10.1038/srep25558", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5FEL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg lysozyme at room temperature solved from dataset acquired by oscillation method" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5FEK", "evidence_id": "EV-PDB-5FEK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "5FEK", "doi": "10.1038/srep25558", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5FEK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg lysozyme at room temperature solved from 3600 diffraction images acquired by ultrasonic acoustic levitation method and processed by CrystFEL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5FDJ", "evidence_id": "EV-PDB-5FDJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "5FDJ", "doi": "10.1038/srep25558", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5FDJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg lysozyme at room temperature solved from datasets acquired by ultrasonic acoustic levitation method and processed by CrystFEL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CPT", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5FCP", "evidence_id": "EV-PDB-5FCP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "5FCP", "doi": "10.1007/s00775-016-1352-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5FCP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-RAY STRUCTURE OF THE ADDUCT BETWEEN HEN EGG WHITE LYSOZYME AND CISPLATIN AT LONG INCUBATION TIMES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CPT", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5F9U", "evidence_id": "EV-PDB-5F9U-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "5F9U", "doi": "10.1007/s00775-016-1352-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5F9U" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-RAY STRUCTURE OF THE ADDUCT BETWEEN HEN EGG WHITE LYSOZYME AND CISPLATIN UPON 24 HOURS OF INCUBATION AT 20 DEGREES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5F81", "evidence_id": "EV-PDB-5F81-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.13 }, "provenance": { "deposit_id": "5F81", "doi": "10.1016/j.str.2016.02.007", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5F81" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Acoustic injectors for drop-on-demand serial femtosecond crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5F16", "evidence_id": "EV-PDB-5F16-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "5F16", "doi": "10.1021/acs.biomac.5b01743", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5F16" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CTA-modified hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "5LN", "CL", "CMO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5E9R", "evidence_id": "EV-PDB-5E9R-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.25 }, "provenance": { "deposit_id": "5E9R", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5E9R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the complex between lysozyme and the compound fac, cis-[RuII(CO)3Cl2(N3-MBI), MBI=N-methyl-benzimidazole" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5E4P", "evidence_id": "EV-PDB-5E4P-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.792 }, "provenance": { "deposit_id": "5E4P", "doi": "10.1107/S1600576716001357", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5E4P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray Crystal Structure Analysis of Magnetically Oriented Microcrystals of Lysozyme at 1.8 angstrom Resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DO3", "GD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 17.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5C6L", "evidence_id": "EV-PDB-5C6L-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "5C6L", "doi": "10.1107/S2052252515014049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5C6L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Gadolinium derivative of HEWL solved using intense Free-Electron Laser radiation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DO3", "GD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 17.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5C6J", "evidence_id": "EV-PDB-5C6J-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "5C6J", "doi": "10.1107/S2052252515014049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5C6J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Gadolinium derivative of HEWL solved using Free-Electron Laser radiation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DO3", "GD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 17.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5C6I", "evidence_id": "EV-PDB-5C6I-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "5C6I", "doi": "10.1107/S2052252515014049", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5C6I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Gadolinium derivative of HEWL solved using Free-Electron Laser radiation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5B1F", "evidence_id": "EV-PDB-5B1F-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "5B1F", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5B1F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 23.85 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5APF", "evidence_id": "EV-PDB-5APF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5APF", "doi": "10.1063/1.4931825", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5APF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme reference dataset even frames" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 23.85 }, "construct": { "description": "LYSOZYME C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5APC", "evidence_id": "EV-PDB-5APC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5APC", "doi": "10.1063/1.4931825", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5APC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme illuminated with 0.4THz radiation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4ZIX", "evidence_id": "EV-PDB-4ZIX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.89 }, "provenance": { "deposit_id": "4ZIX", "doi": "10.1107/S2052252515013160", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4ZIX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of HEWL using Serial Femtosecond Crystallography of Soluble Proteins in Lipidic Cubic Phase" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1PT", "CPT", "EDO", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4ZEE", "evidence_id": "EV-PDB-4ZEE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "4ZEE", "doi": "10.1039/c5dt01279a", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4ZEE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the bis-platinum lysozyme adduct formed in the reaction between the protein and the two drugs Cisplatin and Oxaliplatin (preparation 2)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1PT", "CPT", "EDO", "NA", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4Z46", "evidence_id": "EV-PDB-4Z46-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "4Z46", "doi": "10.1039/c5dt01279a", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4Z46" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the bis-platinum lysozyme adduct formed in the reaction between the protein and the two drugs Cisplatin and Oxaliplatin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "4KV", "DMS", "EDO", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4Z41", "evidence_id": "EV-PDB-4Z41-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.89 }, "provenance": { "deposit_id": "4Z41", "doi": "10.1021/acs.inorgchem.5b01238", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4Z41" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed in the reaction between lysozyme and a platinum(II) Compound with a S,O Bidentate Ligand (9a=Chloro-(1-(3'-hydroxy)-3-(methylthio)-3-thioxo-prop-1-en-1-olate-O,S)-(dimethylsulfoxide-S)-platinum(II))" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CPT", "DMS", "EDO", "NO3", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -123.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/4YEO", "evidence_id": "EV-PDB-4YEO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.98 }, "provenance": { "deposit_id": "4YEO", "doi": "10.1107/S139900471500629X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/4YEO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Triclinic HEWL co-crystallised with cisplatin, studied at a data collection temperature of 150K - new refinement" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5HNC", "evidence_id": "EV-PDB-5HNC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.76 }, "provenance": { "deposit_id": "5HNC", "doi": "10.1107/S2059798316007415", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5HNC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Synchrotron X-ray single crystal diffraction from protein microcrystals via magnetically oriented microcrystal arrays in gels" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5HNL", "evidence_id": "EV-PDB-5HNL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.424 }, "provenance": { "deposit_id": "5HNL", "doi": "10.1107/S2059798316007415", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5HNL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "In-house X-ray single crystal diffraction from protein microcrystals via magnetically oriented microcrystal arrays in gels" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DMS", "NO3", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -73.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5HQ1", "evidence_id": "EV-PDB-5HQ1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.0 }, "provenance": { "deposit_id": "5HQ1", "doi": "10.1063/1.4948613", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5HQ1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Comment on S. W. M. Tanley and J. R. Helliwell Structural dynamics of cisplatin binding to histidine in a protein Struct. Dyn. 1, 034701 (2014) regarding the refinement of 4mwk, 4mwm, 4mwn and 4oxe and the method we have adopted." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5I4W", "evidence_id": "EV-PDB-5I4W-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "5I4W", "doi": "10.1038/srep32277", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5I4W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Exploring the onset of lysozyme denaturation by urea" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "URE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5I4X", "evidence_id": "EV-PDB-5I4X-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.607 }, "provenance": { "deposit_id": "5I4X", "doi": "10.1038/srep32277", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5I4X" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Exploring onset of lysozyme denaturation by urea - soak period 2 hours" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "URE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5I4Y", "evidence_id": "EV-PDB-5I4Y-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.607 }, "provenance": { "deposit_id": "5I4Y", "doi": "10.1038/srep32277", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5I4Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Exploring onset of lysozyme denaturation by urea: soak period 10 hours." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "URE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5I53", "evidence_id": "EV-PDB-5I53-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.608 }, "provenance": { "deposit_id": "5I53", "doi": "10.1038/srep32277", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5I53" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Exploring onset of lysozyme denaturation by urea - soak period 7 hours" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "URE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5I54", "evidence_id": "EV-PDB-5I54-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.608 }, "provenance": { "deposit_id": "5I54", "doi": "10.1038/srep32277", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5I54" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Exploring onset of lysozyme denaturation by urea - soak period 4 hours" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DMS", "NO3", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 20.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5I5Q", "evidence_id": "EV-PDB-5I5Q-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.42 }, "provenance": { "deposit_id": "5I5Q", "doi": "10.1063/1.4948613", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5I5Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Re refinement of 4mwn." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "DMS", "NA", "NO3", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -73.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5IDD", "evidence_id": "EV-PDB-5IDD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.13 }, "provenance": { "deposit_id": "5IDD", "doi": "10.1063/1.4948613", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5IDD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Comment on S. W. M. Tanley and J. R. Helliwell Structural dynamics of cisplatin binding to histidine in a protein Struct. Dyn. 1, 034701 (2014) regarding the refinement of 4mwk, 4mwm, 4mwn and 4oxe and the method we have adopted." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "6B9" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5IEL", "evidence_id": "EV-PDB-5IEL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.15 }, "provenance": { "deposit_id": "5IEL", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5IEL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Lysozyme labeled with fluorescein isothiocyanate (FITC) at 1.15 Angstroms resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DMS", "NA", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5IHG", "evidence_id": "EV-PDB-5IHG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "5IHG", "doi": "10.1039/c6dt01388k", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5IHG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The X-ray structure of the adduct formed in the reaction between hen egg white lysozyme a compound I, a platin(II) compound containing a O, S bidentate ligand" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DMS", "NA", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5II3", "evidence_id": "EV-PDB-5II3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.78 }, "provenance": { "deposit_id": "5II3", "doi": "10.1039/c6dt01388k", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5II3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The X-ray structure of the adduct formed in the reaction between hen egg white lysozyme and compound 3, a platin(II) compound containing a O, S bidentate ligand" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "DMS", "NA", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5ILC", "evidence_id": "EV-PDB-5ILC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "5ILC", "doi": "10.1039/c6dt01388k", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5ILC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The X-ray structure of the adduct formed in the reaction between hen egg white lysozyme a compound 2, a platin(II) compound containing a O, S bidentate ligand" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "DMS", "NA", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5ILF", "evidence_id": "EV-PDB-5ILF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "5ILF", "doi": "10.1039/c6dt01388k", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5ILF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The X-ray structure of the adduct formed in the reaction between hen egg white lysozyme and compound 4, a platin(II) compound containing a O, S bidentate ligand" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5J7C", "evidence_id": "EV-PDB-5J7C-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.535 }, "provenance": { "deposit_id": "5J7C", "doi": "10.1093/protein/gzw046", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5J7C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "A picomolar affinity FN3 domain in complex with hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains B,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5JEN", "evidence_id": "EV-PDB-5JEN-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "5JEN", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5JEN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the anti-sigma factor RsiV bound to lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5K2K", "evidence_id": "EV-PDB-5K2K-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "5K2K", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5K2K" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5K2N", "evidence_id": "EV-PDB-5K2N-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "5K2N", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5K2N" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "lysozyme with nano particles" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5K2P", "evidence_id": "EV-PDB-5K2P-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.24 }, "provenance": { "deposit_id": "5K2P", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5K2P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5K2R", "evidence_id": "EV-PDB-5K2R-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "5K2R", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5K2R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5K2S", "evidence_id": "EV-PDB-5K2S-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "5K2S", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5K2S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme with nano particles" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5K7O", "evidence_id": "EV-PDB-5K7O-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "5K7O", "doi": "10.1038/nmeth.4178", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5K7O" }, "reader": null, "source_kind": "deposit", "technique": "microed", "title": "MicroED structure of lysozyme at 1.8 A resolution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "RU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KJ9", "evidence_id": "EV-PDB-5KJ9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "5KJ9", "doi": "10.1016/j.jinorgbio.2016.06.025", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KJ9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Anticancer activity of Ru- and Os(arene) compounds of a maleimide-functionalized bioactive pyridinecarbothioamide ligand" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACY", "CL", "NA", "PE5" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KKI", "evidence_id": "EV-PDB-5KKI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5KKI", "doi": "10.1021/acs.cgd.6b00950", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KKI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "1.7-Angstrom in situ Mylar structure of hen egg-white lysozyme (HEWL) at 100 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACY", "CL", "NA", "PE5" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KKJ", "evidence_id": "EV-PDB-5KKJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.001 }, "provenance": { "deposit_id": "5KKJ", "doi": "10.1021/acs.cgd.6b00950", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KKJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "2.0-Angstrom In situ Mylar structure of hen egg-white lysozyme (HEWL) at 293 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KXK", "evidence_id": "EV-PDB-5KXK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.198 }, "provenance": { "deposit_id": "5KXK", "doi": "10.1107/S1600577516017343", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KXK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme at 100K, Data set 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KXL", "evidence_id": "EV-PDB-5KXL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.198 }, "provenance": { "deposit_id": "5KXL", "doi": "10.1107/S1600577516017343", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KXL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme at 100K, Data set 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KXM", "evidence_id": "EV-PDB-5KXM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.198 }, "provenance": { "deposit_id": "5KXM", "doi": "10.1107/S1600577516017343", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KXM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme at 100K, Data set 3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KXN", "evidence_id": "EV-PDB-5KXN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.198 }, "provenance": { "deposit_id": "5KXN", "doi": "10.1107/S1600577516017343", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KXN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme at 100K, Data set 4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 4.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KXO", "evidence_id": "EV-PDB-5KXO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "5KXO", "doi": "10.1107/S1600577516017343", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KXO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme at 278K, Data set 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 4.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KXP", "evidence_id": "EV-PDB-5KXP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "5KXP", "doi": "10.1107/S1600577516017343", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KXP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme at 278K, Data set 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 4.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KXR", "evidence_id": "EV-PDB-5KXR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "5KXR", "doi": "10.1107/S1600577516017343", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KXR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme at 278K, Data set 3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 4.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KXS", "evidence_id": "EV-PDB-5KXS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "5KXS", "doi": "10.1107/S1600577516017343", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KXS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme at 278K, Data set 4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 4.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KXT", "evidence_id": "EV-PDB-5KXT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "5KXT", "doi": "10.1107/S1600577516017343", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KXT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme at 278K, Data set 5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 4.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KXW", "evidence_id": "EV-PDB-5KXW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "5KXW", "doi": "10.1107/S1600577516017343", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KXW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme at 278K, Data set 6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 4.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KXX", "evidence_id": "EV-PDB-5KXX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "5KXX", "doi": "10.1107/S1600577516017343", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KXX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme at 278K, Data set 7" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 4.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KXY", "evidence_id": "EV-PDB-5KXY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "5KXY", "doi": "10.1107/S1600577516017343", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KXY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme at 278K, Data set 8" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 4.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KXZ", "evidence_id": "EV-PDB-5KXZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "5KXZ", "doi": "10.1107/S1600577516017343", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KXZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme at 278K, Data set 9" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 4.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5KY1", "evidence_id": "EV-PDB-5KY1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "5KY1", "doi": "10.1107/S1600577516017343", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5KY1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme at 278K, Data set 10" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DMS", "NA", "NH3", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5L3H", "evidence_id": "EV-PDB-5L3H-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5L3H", "doi": "10.3927/45371856", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5L3H" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Re-refinement of 4dd4; cisplatin coordination chemistry determination at hen egg white lysozyme His15 with standard uncertainties" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DMS", "NA", "NH3", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5L3I", "evidence_id": "EV-PDB-5L3I-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5L3I", "doi": "10.3927/45371856", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5L3I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Re-refinement of 4dd6; cisplatin coordination chemistry determination at hen egg white lysozyme His15" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5L9J", "evidence_id": "EV-PDB-5L9J-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "5L9J", "doi": "10.1107/S1600577516018452", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5L9J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature X-ray diffraction of tetragonal HEWL. First data set (0.31 MGy)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5LA5", "evidence_id": "EV-PDB-5LA5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5LA5", "doi": "10.1107/S1600577516018452", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5LA5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature X-ray diffraction of tetragonal HEWL. Second data set (0.62 MGy)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5LA8", "evidence_id": "EV-PDB-5LA8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "5LA8", "doi": "10.1107/S1600577516018452", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5LA8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature X-ray diffraction of tetragonal HEWL. Third data set (0.93 MGy)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5LAF", "evidence_id": "EV-PDB-5LAF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "5LAF", "doi": "10.1107/S1600577516018452", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5LAF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature X-ray diffraction of tetragonal HEWL with 1M of uridine. First data set (0.31 MGy)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5LAG", "evidence_id": "EV-PDB-5LAG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "5LAG", "doi": "10.1107/S1600577516018452", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5LAG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature X-ray diffraction of tetragonal HEWL with 1M of uridine. Second data set (0.62 MGy)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5LAN", "evidence_id": "EV-PDB-5LAN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "5LAN", "doi": "10.1107/S1600577516018452", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5LAN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature X-ray diffraction of tetragonal HEWL with 1M of uridine. Third data set (0.93 MGy)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5LIN", "evidence_id": "EV-PDB-5LIN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.496 }, "provenance": { "deposit_id": "5LIN", "doi": "10.1107/S2059798316012304", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5LIN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme, collected at rotation 1 degree per second" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5K2Q", "evidence_id": "EV-PDB-5K2Q-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "5K2Q", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5K2Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme with nano particles" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DMS", "NA", "NH3", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5LXW", "evidence_id": "EV-PDB-5LXW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.0 }, "provenance": { "deposit_id": "5LXW", "doi": "10.5281/zenodo.155068", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5LXW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Atomic resolution X-ray crystal structure of cisplatin bound to hen egg white lysozyme stored for 5 years on the shelf" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "LYSOZYME (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5LYM", "evidence_id": "EV-PDB-5LYM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "5LYM", "doi": "10.1107/S0907444995009504", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5LYM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STUDIES OF MONOCLINIC HEN EGG WHITE LYSOZYME. IV. X-RAY REFINEMENT AT 1.8 ANGSTROM RESOLUTION AND A COMPARISON OF THE VARIABLE REGIONS IN THE POLYMORPHIC FORMS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5LYT", "evidence_id": "EV-PDB-5LYT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "5LYT", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5LYT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "COMPARISON OF RADIATION-INDUCED DECAY AND STRUCTURE REFINEMENT FROM X-RAY DATA COLLECTED FROM LYSOZYME CRYSTALS AT LOW AND AMBIENT TEMPERATURES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5NJQ", "evidence_id": "EV-PDB-5NJQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5NJQ", "doi": "10.1107/S2052252517013124", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5NJQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mix-and-diffuse serial synchrotron crystallography: structure of N,N',N''-Triacetylchitotriose bound to Lysozyme with 1s time-delay, phased with 4ET8" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5O6Q", "evidence_id": "EV-PDB-5O6Q-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "5O6Q", "doi": "10.1107/S2059798317016357", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5O6Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High pressure flash cooled hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DO3", "GD", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5OER", "evidence_id": "EV-PDB-5OER-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "5OER", "doi": "10.1038/s41467-017-00754-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5OER" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme refined against 5000 9 keV diffraction patterns" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5OOV", "evidence_id": "EV-PDB-5OOV-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.365 }, "provenance": { "deposit_id": "5OOV", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5OOV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Designed Ankyrin Repeat Protein (DARPin) ETVD-1 in complex with Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains B,F)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5OOY", "evidence_id": "EV-PDB-5OOY-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.72 }, "provenance": { "deposit_id": "5OOY", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5OOY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Designed Ankyrin Repeat Protein (DARPin) VHAH-1 in complex with Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5TK0", "evidence_id": "EV-PDB-5TK0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.795 }, "provenance": { "deposit_id": "5TK0", "doi": "10.1021/acs.analchem.7b00443", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5TK0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme structure collected with 3D printed polymer mounts" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6ABN", "evidence_id": "EV-PDB-6ABN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.17 }, "provenance": { "deposit_id": "6ABN", "doi": "10.1371/journal.pone.0232953", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6ABN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of HEWL at pH 8.6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GAI", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6A4Q", "evidence_id": "EV-PDB-6A4Q-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "6A4Q", "doi": "10.1016/j.ijbiomac.2018.11.023", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6A4Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL crystals soaked in 2.5M GuHCl for 110 minutes" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GAI", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6A4P", "evidence_id": "EV-PDB-6A4P-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.76 }, "provenance": { "deposit_id": "6A4P", "doi": "10.1016/j.ijbiomac.2018.11.023", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6A4P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL crystals soaked in 2.5M GuHCl for 40 minutes" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GAI", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6A4O", "evidence_id": "EV-PDB-6A4O-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "6A4O", "doi": "10.1016/j.ijbiomac.2018.11.023", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6A4O" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL crystals soaked in 2.5M GuHCl for 20 minutes" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GAI", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6A4N", "evidence_id": "EV-PDB-6A4N-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "6A4N", "doi": "10.1016/j.ijbiomac.2018.11.023", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6A4N" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL crystals soaked in 2.5M GuHCl for 8 minutes" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,B,C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6A10", "evidence_id": "EV-PDB-6A10-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.13 }, "provenance": { "deposit_id": "6A10", "doi": "10.1021/acs.cgd.9b00256", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6A10" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme crystallized by ammonium sulfate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5YKY", "evidence_id": "EV-PDB-5YKY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.88 }, "provenance": { "deposit_id": "5YKY", "doi": "10.1016/j.apcatb.2018.01.046", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5YKY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of Cross-Linked Tetragonal Hen Egg White Lysozyme Soaked with 10 mM Rose Bengal and 10mM H2PtCl6" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5YIN", "evidence_id": "EV-PDB-5YIN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.66 }, "provenance": { "deposit_id": "5YIN", "doi": "10.1021/acs.cgd.8b00326", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5YIN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme precipitant-free orthorhombic form" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 25.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5WRB", "evidence_id": "EV-PDB-5WRB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.013 }, "provenance": { "deposit_id": "5WRB", "doi": "10.1038/s41598-017-00761-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5WRB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 25.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5WRA", "evidence_id": "EV-PDB-5WRA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "5WRA", "doi": "10.1038/s41598-017-00761-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5WRA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 25.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5WR9", "evidence_id": "EV-PDB-5WR9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "5WR9", "doi": "10.1038/s41598-017-00761-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5WR9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "8WV", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5V4I", "evidence_id": "EV-PDB-5V4I-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "5V4I", "doi": "10.1039/c6cc10150j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5V4I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Osmium(II)(cymene)(chlorido)2-lysozyme adduct with one binding site" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "RU7" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5V4H", "evidence_id": "EV-PDB-5V4H-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.22 }, "provenance": { "deposit_id": "5V4H", "doi": "10.1039/c6cc10150j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5V4H" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ruthenium(II)(cymene)(chlorido)2-lysozyme adduct formed when ruthenium(II)(cymene)(bromido)2 underwent ligand exchange, resulting in one binding site" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "RU7" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5V4G", "evidence_id": "EV-PDB-5V4G-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "5V4G", "doi": "10.1039/c6cc10150j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5V4G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ruthenium(II)(cymene)(chlorido)2-lysozyme adduct with two binding sites" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5UVJ", "evidence_id": "EV-PDB-5UVJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.05 }, "provenance": { "deposit_id": "5UVJ", "doi": "10.1107/S205225251700570X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5UVJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Serial Millisecond Crystallography of Membrane and Soluble Protein Micro-crystals using Synchrotron Radiation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SEY" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5T3F", "evidence_id": "EV-PDB-5T3F-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "5T3F", "doi": "10.1038/srep37123", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5T3F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "hen egg-white lysozyme soaked with selenourea for 10 min" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5OP1", "evidence_id": "EV-PDB-5OP1-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.284 }, "provenance": { "deposit_id": "5OP1", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5OP1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Designed Ankyrin Repeat Protein (DARPin) A4 in complex with Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DMS", "EDO", "NO3", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5OLE", "evidence_id": "EV-PDB-5OLE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.78 }, "provenance": { "deposit_id": "5OLE", "doi": "10.1016/j.jinorgbio.2018.01.002", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5OLE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of hen egg white lysozyme with a tetranuclear Pt-thiosemicarbazone compound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.4, "salt_mM": null, "temperature_c": -176.15 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5OCV", "evidence_id": "EV-PDB-5OCV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "5OCV", "doi": "10.1016/j.str.2018.02.015", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5OCV" }, "reader": null, "source_kind": "deposit", "technique": "microed", "title": "A Rare Lysozyme Crystal Form Solved Using High-Redundancy 3D Electron Diffraction Data from Micron-Sized Needle Shaped Crystals" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "9Q8", "EDO", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5OB9", "evidence_id": "EV-PDB-5OB9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.38 }, "provenance": { "deposit_id": "5OB9", "doi": "10.1039/c7dt01991b", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5OB9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of lysozyme with the compound fac-[RuII(CO)3Cl2(N3-MIM), MIM=methyl-imidazole (crystals grown using ethylene glycol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "9QB", "ACT", "CL", "NA", "RU2" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5OB8", "evidence_id": "EV-PDB-5OB8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "5OB8", "doi": "10.1039/c7dt01991b", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5OB8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of lysozyme with the compound fac-[RuII(CO)3Cl2(N3-MIM), MIM=methyl-imidazole (crystals grown using NaCl)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "9Q8", "9QB", "CL", "GOL", "NA", "RU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5OB7", "evidence_id": "EV-PDB-5OB7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "5OB7", "doi": "10.1039/c7dt01991b", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5OB7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of lysozyme with the compound fac-[RuII(CO)3Cl2(N3-IM), IM=imidazole (crystal 2)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "9Q8", "CL", "GOL", "NA", "RU1", "RU2" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5OB6", "evidence_id": "EV-PDB-5OB6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.88 }, "provenance": { "deposit_id": "5OB6", "doi": "10.1039/c7dt01991b", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5OB6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of lysozyme with the compound fac-[RuII(CO)3Cl2(N3-IM), IM=imidazole" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5O4X", "evidence_id": "EV-PDB-5O4X-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.11 }, "provenance": { "deposit_id": "5O4X", "doi": "10.1107/S2059798317010348", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5O4X" }, "reader": null, "source_kind": "deposit", "technique": "microed", "title": "Protein structure determination by electron diffraction using a single three-dimensional nanocrystal" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5O4W", "evidence_id": "EV-PDB-5O4W-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.11 }, "provenance": { "deposit_id": "5O4W", "doi": "10.1107/S2059798317010348", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5O4W" }, "reader": null, "source_kind": "deposit", "technique": "microed", "title": "Protein structure determination by electron diffraction using a single three-dimensional nanocrystal" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5NJS", "evidence_id": "EV-PDB-5NJS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5NJS", "doi": "10.1107/S2052252517013124", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5NJS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mix-and-diffuse serial synchrotron crystallography: structure of N,N',N''-Triacetylchitotriose bound to Lysozyme with 50s time-delay, phased with 1HEW" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5NJR", "evidence_id": "EV-PDB-5NJR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5NJR", "doi": "10.1107/S2052252517013124", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5NJR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mix-and-diffuse serial synchrotron crystallography: structure of N,N',N''-Triacetylchitotriose bound to Lysozyme with 50s time-delay, phased with 4ET8" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5NJP", "evidence_id": "EV-PDB-5NJP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5NJP", "doi": "10.1107/S2052252517013124", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5NJP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mix-and-diffuse serial synchrotron crystallography: structure of N,N',N''-Triacetylchitotriose bound to Lysozyme with 1s time-delay, phased with 1HEW" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5NJM", "evidence_id": "EV-PDB-5NJM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "5NJM", "doi": "10.1038/s41467-017-00630-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5NJM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme room-temperature structure determined by serial millisecond crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A6R", "EDO", "NA", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5NJ1", "evidence_id": "EV-PDB-5NJ1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "5NJ1", "doi": "10.1021/jacs.8b13681", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5NJ1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The X-ray structure of the adduct formed in the reaction between hen egg white lysozyme and arsenoplatin-1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5NE0", "evidence_id": "EV-PDB-5NE0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.57 }, "provenance": { "deposit_id": "5NE0", "doi": "10.1107/S1600576717005799", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5NE0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature in-situ structure of hen egg-white lysozyme from crystals enclosed between ultrathin silicon nitride membranes" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "RE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5NBJ", "evidence_id": "EV-PDB-5NBJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.266 }, "provenance": { "deposit_id": "5NBJ", "doi": "10.1107/S2052252517003475", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5NBJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "DLS Tetragonal - ReHEWL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CD", "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -193.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5MYY", "evidence_id": "EV-PDB-5MYY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "5MYY", "doi": "10.1107/S2059798317006970", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5MYY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg-White Lysozyme (HEWL) cocrystallized in the presence of Cadmium sulphate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5MJJ", "evidence_id": "EV-PDB-5MJJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75009201311 }, "provenance": { "deposit_id": "5MJJ", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5MJJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Single-shot pink beam serial crystallography: Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DMS", "IOD", "NA", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5M1Y", "evidence_id": "EV-PDB-5M1Y-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.904 }, "provenance": { "deposit_id": "5M1Y", "doi": "10.5281/zenodo.160328", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5M1Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The case of 1lkr held at the PDB and its variable amino acid occupancies; re refinement of 4ow9 to correct this" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5LYZ", "evidence_id": "EV-PDB-5LYZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "5LYZ", "doi": "10.1016/0022-2836(74)90598-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5LYZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Real-space refinement of the structure of hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "GOL", "NA", "RU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -153.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5LVJ", "evidence_id": "EV-PDB-5LVJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "5LVJ", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5LVJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme co-crystallized with [H2Ind][trans-RuCl4(DMSO)(HInd)]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA", "RU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -153.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5LVI", "evidence_id": "EV-PDB-5LVI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "5LVI", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5LVI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme co-crystallized with [HIsq][trans-RuCl4(DMSO)(Isq)]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "GOL", "NA", "RU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -153.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5LVH", "evidence_id": "EV-PDB-5LVH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "5LVH", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5LVH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme co-crystallized with trans-Ru(DMSO)4Cl2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA", "RU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -153.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5LVG", "evidence_id": "EV-PDB-5LVG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "5LVG", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5LVG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme co-crystallized with cis-Ru(DMSO)4Cl2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/5LIO", "evidence_id": "EV-PDB-5LIO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.496 }, "provenance": { "deposit_id": "5LIO", "doi": "10.1107/S2059798316012304", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/5LIO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme, collected at rotation 360 degree per second" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "9U3", "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6AD5", "evidence_id": "EV-PDB-6AD5-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as an amyloid fibril; a fibril entry shows the cross-beta fibril fold, not the native fold. Polymorphs are pooled.", "rule": "hewl-fibril-structures", "state_id": "HEWL-fibril", "who": "rule:hewl-fibril-structures" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "6AD5", "doi": "10.1371/journal.pone.0232953", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6AD5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of HEWL in complex with TEMED (in the aroma form) after 24 hours under fibrillation conditions" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "9U3", "ACT", "CL", "NA", "PGO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6ADF", "evidence_id": "EV-PDB-6ADF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.08 }, "provenance": { "deposit_id": "6ADF", "doi": "10.1371/journal.pone.0232953", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6ADF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of HEWL co-crystallised with TEMED" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "9U3", "CL", "NA", "PGO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6AEA", "evidence_id": "EV-PDB-6AEA-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as an amyloid fibril; a fibril entry shows the cross-beta fibril fold, not the native fold. Polymorphs are pooled.", "rule": "hewl-fibril-structures", "state_id": "HEWL-fibril", "who": "rule:hewl-fibril-structures" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "6AEA", "doi": "10.1371/journal.pone.0232953", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6AEA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of HEWL in complex with TEMED (in the aroma form) after 5 hours under fibrillation conditions" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "EDO", "NA", "PEL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6AGR", "evidence_id": "EV-PDB-6AGR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.22 }, "provenance": { "deposit_id": "6AGR", "doi": "10.1016/j.ijbiomac.2019.12.204", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6AGR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of HEWL co-crystallised with phenylethyl alcohol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "PEL", "PGO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6AHH", "evidence_id": "EV-PDB-6AHH-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as an amyloid fibril; a fibril entry shows the cross-beta fibril fold, not the native fold. Polymorphs are pooled.", "rule": "hewl-fibril-structures", "state_id": "HEWL-fibril", "who": "rule:hewl-fibril-structures" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "6AHH", "doi": "10.1038/s41598-019-55082-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6AHH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of HEWL in complex with Phenylethyl alcohol (in the aroma form) after 5 hours under fibrillation conditions" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CIN", "CL", "NA", "PGO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6AHL", "evidence_id": "EV-PDB-6AHL-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as an amyloid fibril; a fibril entry shows the cross-beta fibril fold, not the native fold. Polymorphs are pooled.", "rule": "hewl-fibril-structures", "state_id": "HEWL-fibril", "who": "rule:hewl-fibril-structures" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "6AHL", "doi": "10.1038/s41598-019-55082-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6AHL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of HEWL in complex with Cinnamaldehyde (in the aroma form) after 5 hours under fibrillation conditions" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6B7U", "evidence_id": "EV-PDB-6B7U-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.581 }, "provenance": { "deposit_id": "6B7U", "doi": "10.1016/j.ifset.2018.02.008", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6B7U" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of hen egg-white lysozyme without high-pressure pre-treatment" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6B7V", "evidence_id": "EV-PDB-6B7V-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.482 }, "provenance": { "deposit_id": "6B7V", "doi": "10.1016/j.ifset.2018.02.008", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6B7V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of hen egg-white lysozyme pre-treated with high-pressure homogenization at 120 MPa" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "E3D", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6BO1", "evidence_id": "EV-PDB-6BO1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.24 }, "provenance": { "deposit_id": "6BO1", "doi": "10.1039/c8cc02433b", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6BO1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mono-adduct formed after 3 days in the reaction of dichlorido(1,3-dimethylbenzimidazol-2-ylidene)(eta6-p-cymene)ruthenium(II) with HEWL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "E3D", "NA", "RU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6BO2", "evidence_id": "EV-PDB-6BO2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.48 }, "provenance": { "deposit_id": "6BO2", "doi": "10.1039/c8cc02433b", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6BO2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Adducts formed after 1 month in the reaction of dichlorido(1,3-dimethylbenzimidazol-2-ylidene)(eta6-p-cymene)ruthenium(II) with HEWL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CD", "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6BRE", "evidence_id": "EV-PDB-6BRE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.86 }, "provenance": { "deposit_id": "6BRE", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6BRE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg-White Lysozyme cocrystallized with Cadmium sulphate using CuKalpha source." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "F44" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6CIW", "evidence_id": "EV-PDB-6CIW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.42 }, "provenance": { "deposit_id": "6CIW", "doi": "10.1039/C8PY00545A", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6CIW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme Cocrystallized with 1,3-Di(2-pyridyl)propane" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D6E", "evidence_id": "EV-PDB-6D6E-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "6D6E", "doi": "10.1107/S2059798318008793", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D6E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Triclinic lysozyme (295 K) in the presence of 47% xylose" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3", "XYS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D6F", "evidence_id": "EV-PDB-6D6F-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "6D6F", "doi": "10.1107/S2059798318008793", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D6F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Triclinic lysozyme cryocooled to 100 K with 47% xylose as cryoprotectant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D6G", "evidence_id": "EV-PDB-6D6G-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "6D6G", "doi": "10.1107/S2059798318008793", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D6G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Triclinic lysozyme (295 K) in the presence of 47% MPD" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MRD", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6D6H", "evidence_id": "EV-PDB-6D6H-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.00006383515 }, "provenance": { "deposit_id": "6D6H", "doi": "10.1107/S2059798318008793", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6D6H" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Triclinic lysozyme cryocooled to 100 K with 47% MPD as cryoprotectant" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6F1M", "evidence_id": "EV-PDB-6F1M-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.48 }, "provenance": { "deposit_id": "6F1M", "doi": "10.1107/S205979831800517X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6F1M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme crystallized in presence of 100 mM sodium phosphate at pH 4.5: low-humidity form" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6F1O", "evidence_id": "EV-PDB-6F1O-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.96 }, "provenance": { "deposit_id": "6F1O", "doi": "10.1107/S205979831800517X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6F1O" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Orthorhombic Lysozyme crystallized at 298 K and pH 4.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "7MT", "ACT", "CL", "NA", "TB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6F2I", "evidence_id": "EV-PDB-6F2I-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "6F2I", "doi": "10.1002/chem.201802172", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6F2I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Hen Egg-White Lysozyme co-crystallized in presence of 100 mM Tb-Xo4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "7MT", "CL", "NA", "TB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6F2J", "evidence_id": "EV-PDB-6F2J-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "6F2J", "doi": "10.1002/chem.201802172", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6F2J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Hen Egg-White Lysozyme co-crystallized in presence of 100 mM Tb-Xo4 and 100 mM sodium sulfate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "TB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6F2K", "evidence_id": "EV-PDB-6F2K-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "6F2K", "doi": "10.1002/chem.201802172", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6F2K" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Hen Egg-White Lysozyme co-crystallized in presence of 100 mM Tb-Xo4 and 100 mM potassium phosphate monobasic." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6F9X", "evidence_id": "EV-PDB-6F9X-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "6F9X", "doi": "10.1107/S205979831800517X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6F9X" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme crystallized in presence of 100 mM lithium sulphate at pH 4.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6F9Y", "evidence_id": "EV-PDB-6F9Y-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "6F9Y", "doi": "10.1107/S205979831800517X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6F9Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme crystallized in presence of 10 mM lithium sulphate at pH 4.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6FA0", "evidence_id": "EV-PDB-6FA0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "6FA0", "doi": "10.1107/S205979831800517X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6FA0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme crystallized in presence of 100 mM ammonium sulphate at pH 4.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "7MT", "IOD", "NA", "TB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6FRO", "evidence_id": "EV-PDB-6FRO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.42 }, "provenance": { "deposit_id": "6FRO", "doi": "10.1002/chem.201802172", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6FRO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Hen Egg-White Lysozyme co-crystallized in presence of 100 mM Tb-Xo4 and 100 mM potassium iodide." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "TB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6FRQ", "evidence_id": "EV-PDB-6FRQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.69 }, "provenance": { "deposit_id": "6FRQ", "doi": "10.1002/chem.201802172", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6FRQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of tetragonal Hen Egg-White Lysozyme co-crystallized in presence of 100 mM Tb-Xo4 and 100 mM Potassium sodium tartrate tetrahydrate." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6FTR", "evidence_id": "EV-PDB-6FTR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.76000104975 }, "provenance": { "deposit_id": "6FTR", "doi": "10.1038/s41467-018-06156-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6FTR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Serial Femtosecond Crystallography at Megahertz pulse rates" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DMS", "NO3", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6G5Y", "evidence_id": "EV-PDB-6G5Y-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.49 }, "provenance": { "deposit_id": "6G5Y", "doi": "10.1039/c8dt01254g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6G5Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The X-ray structure of the adduct formed in the reaction between lysozyme and a platinum(II) terpyridine compound (acid pH)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6G8A", "evidence_id": "EV-PDB-6G8A-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.143 }, "provenance": { "deposit_id": "6G8A", "doi": "10.1038/s41592-018-0143-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6G8A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme solved by Native SAD from a dataset collected in 5 seconds at 1 A wavelength with JUNGFRAU detector" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "ZKG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6GNL", "evidence_id": "EV-PDB-6GNL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.23 }, "provenance": { "deposit_id": "6GNL", "doi": "10.1107/S2053229618010690", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6GNL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Zr(IV)-substituted Keggin directly binding to the side chain of Hen Egg-White Lysozyme (HEWL)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6H0K", "evidence_id": "EV-PDB-6H0K-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "6H0K", "doi": "10.1038/s41467-018-05953-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6H0K" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme structure determined with data from the EuXFEL, the first MHz free electron laser, 7.47 keV photon energy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6H3B", "evidence_id": "EV-PDB-6H3B-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "6H3B", "doi": "10.1073/pnas.1809978115", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6H3B" }, "reader": null, "source_kind": "deposit", "technique": "microed", "title": "Lysozyme: Machining protein microcrystals for structure determination by electron diffraction" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6H0L", "evidence_id": "EV-PDB-6H0L-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "6H0L", "doi": "10.1038/s41467-018-05953-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6H0L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme structure determined with data from the EuXFEL, 9.22 keV photon energy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NO3", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6GOJ", "evidence_id": "EV-PDB-6GOJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.25 }, "provenance": { "deposit_id": "6GOJ", "doi": "10.1039/c8dt01663a", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6GOJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of lysozyme with a Pt(II) complex bearing N,N-pyridylbenzimidazole derivative with an alkylated triphenylphosphonium cation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DMS", "NO3", "PD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6GOI", "evidence_id": "EV-PDB-6GOI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.99 }, "provenance": { "deposit_id": "6GOI", "doi": "10.1039/c8dt01663a", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6GOI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of lysozyme with a Pd(II) complex bearing N,N-pyridylbenzimidazole derivative with an alkylated triphenylphosphonium cation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DMS", "F7T", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6GOH", "evidence_id": "EV-PDB-6GOH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.43 }, "provenance": { "deposit_id": "6GOH", "doi": "10.1039/c8dt01663a", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6GOH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of lysozyme with a Pt(II) complex bearing N,N-pyridylbenzimidazole derivative with an alkylated sulphonate side chain" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "F6Q", "NO3", "PD", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6GOB", "evidence_id": "EV-PDB-6GOB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.96 }, "provenance": { "deposit_id": "6GOB", "doi": "10.1039/c8dt01663a", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6GOB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of lysozyme with a Pd(II) complex bearing N,N-pyridylbenzimidazole derivative with an alkylated sulphonate side chain" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6GF0", "evidence_id": "EV-PDB-6GF0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.07 }, "provenance": { "deposit_id": "6GF0", "doi": "10.1107/S2059798318011634", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6GF0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme structure determined from SFX data using a Sheet-on-Sheet chipless chip" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DMS", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6G5V", "evidence_id": "EV-PDB-6G5V-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.96 }, "provenance": { "deposit_id": "6G5V", "doi": "10.1039/c8dt01254g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6G5V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The X-ray structure of the adduct formed in the reaction between lysozyme and a platinum(II) terpyridine compound (pH 7.0)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "4TI", "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -143.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6G5C", "evidence_id": "EV-PDB-6G5C-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "6G5C", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6G5C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Interaction of TiO2 nanoparticles (NM-101) with Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CIT", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6FSJ", "evidence_id": "EV-PDB-6FSJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "6FSJ", "doi": "10.1107/S2053230X18005253", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6FSJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of TCE-treated Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6F9Z", "evidence_id": "EV-PDB-6F9Z-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "6F9Z", "doi": "10.1107/S205979831800517X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6F9Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme crystallized in presence of 5 mM ammonium sulphate at pH 4.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6F1R", "evidence_id": "EV-PDB-6F1R-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "6F1R", "doi": "10.1107/S205979831800517X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6F1R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Tetragonal Lysozyme crystallized at 298 K and pH 4.5 with phosphate bound: control experiment" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6F1P", "evidence_id": "EV-PDB-6F1P-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.12 }, "provenance": { "deposit_id": "6F1P", "doi": "10.1107/S205979831800517X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6F1P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Tetragonal Lysozyme crystallized at 298 K and pH 4.5 with phosphate bound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "PO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6F1L", "evidence_id": "EV-PDB-6F1L-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "6F1L", "doi": "10.1107/S205979831800517X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6F1L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme crystallized in presence of 100 mM sodium phosphate at pH 4.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6B7W", "evidence_id": "EV-PDB-6B7W-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.482 }, "provenance": { "deposit_id": "6B7W", "doi": "10.1016/j.ifset.2018.02.008", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6B7W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of hen egg-white lysozyme pre-treated with high pressure (600 MPa) under isobaric condition" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6APM", "evidence_id": "EV-PDB-6APM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.05 }, "provenance": { "deposit_id": "6APM", "doi": "10.1021/acs.biochem.7b00711", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6APM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme (WT), solved with serial millisecond crystallography using synchrotron radiation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "9Y3", "9Y6", "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6AGN", "evidence_id": "EV-PDB-6AGN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.08 }, "provenance": { "deposit_id": "6AGN", "doi": "10.1016/j.ijbiomac.2019.12.204", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6AGN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of HEWL co-crystallised with Cinnamaldehyde" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA", "PGO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6AC2", "evidence_id": "EV-PDB-6AC2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.23 }, "provenance": { "deposit_id": "6AC2", "doi": "10.1038/s41598-019-55082-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6AC2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of HEWL at pH 2.2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "PGO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6ABZ", "evidence_id": "EV-PDB-6ABZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "6ABZ", "doi": "10.1016/j.ijbiomac.2019.12.204", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6ABZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure of HEWL in deionized water" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6HT2", "evidence_id": "EV-PDB-6HT2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.6 }, "provenance": { "deposit_id": "6HT2", "doi": "10.1107/S2052252518017657", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6HT2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURE OF HEWL BY ELECTRON DIFFRACTION AND MICROFOCUS DIFFRACTION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CWO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6HY4", "evidence_id": "EV-PDB-6HY4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.83 }, "provenance": { "deposit_id": "6HY4", "doi": "10.1002/ejic.201801113", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6HY4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Co(II)-substituted Wells-Dawson binding to Hen Egg-White Lysozyme (HEWL)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GXZ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6HY6", "evidence_id": "EV-PDB-6HY6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.87 }, "provenance": { "deposit_id": "6HY6", "doi": "10.1002/ejic.201801113", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6HY6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Ni(II)-substituted Wells-Dawson binding to Hen Egg-White Lysozyme (HEWL)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "K", "ZRW" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6HYB", "evidence_id": "EV-PDB-6HYB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.964 }, "provenance": { "deposit_id": "6HYB", "doi": "10.1002/ejic.201801113", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6HYB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Zr(IV)-substituted Wells-Dawson binding to Hen Egg-White Lysozyme (HEWL)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6IG6", "evidence_id": "EV-PDB-6IG6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "6IG6", "doi": "10.1038/s41598-019-39020-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6IG6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of lysozyme delivered in polyacrylamide using x-ray free electron laser" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6JB2", "evidence_id": "EV-PDB-6JB2-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "6JB2", "doi": "10.1038/s41598-019-50722-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6JB2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of nanobody D3-L11 mutant Y102A in complex with hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6JB8", "evidence_id": "EV-PDB-6JB8-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "6JB8", "doi": "10.1038/s41598-019-50722-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6JB8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of nanobody D3-L11 in complex with hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 25.0 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6JXP", "evidence_id": "EV-PDB-6JXP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.56 }, "provenance": { "deposit_id": "6JXP", "doi": "10.1107/S160057751900897X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6JXP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature structure of lysozyme delivered in LCP by serial millisecond crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 25.0 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6JXQ", "evidence_id": "EV-PDB-6JXQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.76 }, "provenance": { "deposit_id": "6JXQ", "doi": "10.1107/S160057751900897X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6JXQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature structure of lysozyme delivered in polyacrylamide by serial millisecond crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6K8G", "evidence_id": "EV-PDB-6K8G-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "6K8G", "doi": "10.1107/S1600576720005488", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6K8G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H/D exchanged Hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6KCB", "evidence_id": "EV-PDB-6KCB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "6KCB", "doi": "10.1038/s41598-019-56135-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6KCB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature structure of lysozyme delivered in shortening A by serial millisecond crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6KCD", "evidence_id": "EV-PDB-6KCD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "6KCD", "doi": "10.1038/s41598-019-56135-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6KCD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature structure of lysozyme delivered in shortening B by serial millisecond crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 25.0 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6KD1", "evidence_id": "EV-PDB-6KD1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "6KD1", "doi": "10.1107/S1600576719014985", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6KD1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature structure of lysozyme delivered in agarose by serial millisecond crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6LAV", "evidence_id": "EV-PDB-6LAV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.73 }, "provenance": { "deposit_id": "6LAV", "doi": "10.1016/j.jsb.2019.02.004", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6LAV" }, "reader": null, "source_kind": "deposit", "technique": "microed", "title": "MicroED structure of lysozyme at 1.73A determained using crystal lamellas prepared by focused ion beam milling" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 23.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6LL3", "evidence_id": "EV-PDB-6LL3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "6LL3", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6LL3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of lysozyme by fixed-target serial femtosecond crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -178.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6LT5", "evidence_id": "EV-PDB-6LT5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.32 }, "provenance": { "deposit_id": "6LT5", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6LT5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme protected by alginate gel" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6LYT", "evidence_id": "EV-PDB-6LYT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "6LYT", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6LYT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "COMPARISON OF RADIATION-INDUCED DECAY AND STRUCTURE REFINEMENT FROM X-RAY DATA COLLECTED FROM LYSOZYME CRYSTALS AT LOW AND AMBIENT TEMPERATURES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6LYZ", "evidence_id": "EV-PDB-6LYZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "6LYZ", "doi": "10.1016/0022-2836(74)90598-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6LYZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Real-space refinement of the structure of hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6MQV", "evidence_id": "EV-PDB-6MQV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "6MQV", "doi": "10.1063/1.5104298", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6MQV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of HEWL from LCP injector using synchrotron radiation" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BEN", "CL", "EDO", "K5V", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6MX9", "evidence_id": "EV-PDB-6MX9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "6MX9", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6MX9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme bound to 3-Aminophenol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6O2H", "evidence_id": "EV-PDB-6O2H-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.212 }, "provenance": { "deposit_id": "6O2H", "doi": "10.1038/s41467-020-14933-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6O2H" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen lysozyme in triclinic space group at ambient temperature - diffuse scattering dataset" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6P4A", "evidence_id": "EV-PDB-6P4A-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "6P4A", "doi": "10.1073/pnas.2005102117", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6P4A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HyHEL10 Fab complexed with hen egg lysozyme carrying two mutations (HEL2x-rigid): R21Q and R73E" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6P4D", "evidence_id": "EV-PDB-6P4D-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.05 }, "provenance": { "deposit_id": "6P4D", "doi": "10.1073/pnas.2005102117", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6P4D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg lysozyme (HEL) containing three point mutations (HEL3x): R21Q, R73E, and D101R" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "ORS", "R1N" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6PL9", "evidence_id": "EV-PDB-6PL9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "6PL9", "doi": "10.1002/anie.202106906", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6PL9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Adduct formed after 1 month in the reaction of dichlorido(1,3-dimethylbenzimidaz ol-2-ylidene)(eta5-pentamethylcyclopentadienyl)rhodium(III) with HEWL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "O1N", "OS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6PLA", "evidence_id": "EV-PDB-6PLA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "6PLA", "doi": "10.1002/anie.202106906", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6PLA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Adducts formed after 1 month in the reaction of dichlorido(1,3-dimethylbenzimidazol-2-ylidene)(eta6-p-cymene)osmium(II) with HEWL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "OT1" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6PLB", "evidence_id": "EV-PDB-6PLB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "6PLB", "doi": "10.1002/anie.202106906", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6PLB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Adducts formed after 1 month in the reaction of dichlorido(1,3-dimethylbenzimida zol-2-ylidene)(eta5-pentamethylcyclopentadienyl)iridium(III) with HEWL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "PEG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6Q88", "evidence_id": "EV-PDB-6Q88-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.74007062403 }, "provenance": { "deposit_id": "6Q88", "doi": "10.1073/pnas.1821522117", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6Q88" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "RT structure of HEWL at 5 kGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "AR", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6Q8R", "evidence_id": "EV-PDB-6Q8R-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "6Q8R", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6Q8R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEW Lysozyme under 2 kbar of argon" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "PEG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6Q8T", "evidence_id": "EV-PDB-6Q8T-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.74008663732 }, "provenance": { "deposit_id": "6Q8T", "doi": "10.1073/pnas.1821522117", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6Q8T" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Cryo structure of HEWL at 81 kGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QNB", "evidence_id": "EV-PDB-6QNB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "6QNB", "doi": "10.1038/s41592-019-0553-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QNB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Liquid Application Method for time-resolved Analyses (LAMA) by serial synchrotron crystallography, Lysozyme with GlcNAc3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": 20.85 }, "construct": { "description": "Lysozyme C (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QQ3", "evidence_id": "EV-PDB-6QQ3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.53 }, "provenance": { "deposit_id": "6QQ3", "doi": "10.1038/s41598-019-48612-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QQ3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The room temperature structure of lysozyme via the acoustic levitation of a droplet" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QQC", "evidence_id": "EV-PDB-6QQC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.42 }, "provenance": { "deposit_id": "6QQC", "doi": "10.1107/S205225251900616X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QQC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Cryogenic temperature structure of Hen Egg White Lysozyme recorded after an accumulated dose of 110 kGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QQD", "evidence_id": "EV-PDB-6QQD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.92 }, "provenance": { "deposit_id": "6QQD", "doi": "10.1107/S205225251900616X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QQD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Cryogenic temperature structure of Hen Egg White Lysozyme recorded after an accumulated dose of 10 MGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QQF", "evidence_id": "EV-PDB-6QQF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "6QQF", "doi": "10.1107/S205225251900616X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QQF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature structure of Hen Egg White Lysozyme recorded after an accumulated dose of 100 kGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QWW", "evidence_id": "EV-PDB-6QWW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "6QWW", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QWW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL lysozyme, crystallized from CuCl2 solution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NI" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QWX", "evidence_id": "EV-PDB-6QWX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "6QWX", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QWX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL lysozyme, crystallized from NiCl2 solution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QWY", "evidence_id": "EV-PDB-6QWY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "6QWY", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QWY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL lysozyme, crystallized from NaCl solution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QWZ", "evidence_id": "EV-PDB-6QWZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "6QWZ", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QWZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL lysozyme, crystallized from KCl solution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QQE", "evidence_id": "EV-PDB-6QQE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.37 }, "provenance": { "deposit_id": "6QQE", "doi": "10.1107/S205225251900616X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QQE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature structure of Hen Egg White Lysozyme recorded after an accumulated dose of 20 kGy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DMS", "J9H", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.4, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QEA", "evidence_id": "EV-PDB-6QEA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.96 }, "provenance": { "deposit_id": "6QEA", "doi": "10.3390/ijms20030520", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QEA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The X-ray structure of the adduct formed in the reaction between hen egg white lysozyme and complex I, a pentacoordinate Pt(II) compound containing 2,9-dimethyl-1,10-phenanthroline, dimethylfumarate, methyl and iodine as ligands" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "I3C" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.1, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6PBB", "evidence_id": "EV-PDB-6PBB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.89151078799 }, "provenance": { "deposit_id": "6PBB", "doi": "10.1107/S2059798319009008", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6PBB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Hen Egg White Lysozyme in complex with I3C" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains C,D)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6P4B", "evidence_id": "EV-PDB-6P4B-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "6P4B", "doi": "10.1073/pnas.2005102117", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6P4B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HyHEL10 fab variant HyHEL10-4x (heavy chain mutations L4F, Y33H, S56N, and Y58F) bound to hen egg lysozyme variant HEL2x-flex (mutations R21Q, R73E, C76S, and C94S)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6MUZ", "evidence_id": "EV-PDB-6MUZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.839 }, "provenance": { "deposit_id": "6MUZ", "doi": "10.1107/S2052252519001453", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6MUZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme, room temperature structure solved by serial 3 degree oscillation crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "D2L", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6K5Q", "evidence_id": "EV-PDB-6K5Q-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.177 }, "provenance": { "deposit_id": "6K5Q", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6K5Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of lysozyme complexed with a bioactive compound from Jatropha gossypiifolia" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6JZI", "evidence_id": "EV-PDB-6JZI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "6JZI", "doi": "10.1107/S1600576719012846", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6JZI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of hen egg-white lysozyme obtained from SFX experiments under atmospheric pressure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6JB5", "evidence_id": "EV-PDB-6JB5-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "6JB5", "doi": "10.1038/s41598-019-50722-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6JB5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of nanobody D3-L11 mutant Y102A in complex with hen egg-white lysozyme (form II)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6IRJ", "evidence_id": "EV-PDB-6IRJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "6IRJ", "doi": "10.1038/s41598-019-43485-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6IRJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of lysozyme by fixed-target serial femtosecond crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GXW", "K", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6HY8", "evidence_id": "EV-PDB-6HY8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.22 }, "provenance": { "deposit_id": "6HY8", "doi": "10.1002/ejic.201801113", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6HY8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Cu(II)-substituted Wells-Dawson binding to Hen Egg-White Lysozyme (HEWL)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6HU5", "evidence_id": "EV-PDB-6HU5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "6HU5", "doi": "10.1107/S2052252518017657", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6HU5" }, "reader": null, "source_kind": "deposit", "technique": "microed", "title": "STRUCTURE OF HEWL BY ELECTRON DIFFRACTION AND MICROFOCUS DIFFRACTION" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6H79", "evidence_id": "EV-PDB-6H79-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "6H79", "doi": "10.1107/S1600577519000304", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6H79" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SSX structure of Lysozyme in flow - metal-kapton microfluidic device" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QX0", "evidence_id": "EV-PDB-6QX0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "6QX0", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QX0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL lysozyme, crystallized from LiCl solution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QXW", "evidence_id": "EV-PDB-6QXW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "6QXW", "doi": "10.1107/S205225251900914X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QXW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Pink beam serial crystallography: Lysozyme, 5 us exposure, 24344 patterns merged (3 chips)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QXX", "evidence_id": "EV-PDB-6QXX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "6QXX", "doi": "10.1107/S205225251900914X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QXX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Pink beam serial crystallography: Lysozyme, 5 us exposure, 14793 patterns merged" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QXY", "evidence_id": "EV-PDB-6QXY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "6QXY", "doi": "10.1107/S205225251900914X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QXY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Pink beam serial crystallography: Lysozyme, 5 us exposure, 8813 patterns merged (1 chip)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QY0", "evidence_id": "EV-PDB-6QY0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "6QY0", "doi": "10.1107/S205225251900914X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QY0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Pink beam serial crystallography: Lysozyme, 5 us exposure, 3000 patterns merged" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QY2", "evidence_id": "EV-PDB-6QY2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "6QY2", "doi": "10.1107/S205225251900914X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QY2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Pink beam serial crystallography: Lysozyme, 5 us exposure, 750 patterns merged" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QY5", "evidence_id": "EV-PDB-6QY5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.84 }, "provenance": { "deposit_id": "6QY5", "doi": "10.1107/S205225251900914X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QY5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Pink beam serial crystallography: Lysozyme, 1 us exposure, 4448 patterns merged (1 chip)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6RNB", "evidence_id": "EV-PDB-6RNB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.699 }, "provenance": { "deposit_id": "6RNB", "doi": "10.1038/s41592-019-0553-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6RNB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Liquid Application Method for time-resolved Analyses (LAMA) by serial synchrotron crystallography, Lysozyme with GlcNAc3 50ms diffusion time" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6RNC", "evidence_id": "EV-PDB-6RNC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.799 }, "provenance": { "deposit_id": "6RNC", "doi": "10.1038/s41592-019-0553-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6RNC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Liquid Application Method for time-resolved Analyses (LAMA) by serial synchrotron crystallography, Lysozyme with GlcNAc3 - 100ms diffusion time." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6RT1", "evidence_id": "EV-PDB-6RT1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.336 }, "provenance": { "deposit_id": "6RT1", "doi": "10.1039/d0cp02469d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6RT1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Native tetragonal lysozyme - home source data" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6RT3", "evidence_id": "EV-PDB-6RT3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.05 }, "provenance": { "deposit_id": "6RT3", "doi": "10.1039/d0cp02469d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6RT3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Native tetragonal lysozyme - synchrotron data" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "branched: beta-D-fructofuranose-(2-1)-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6RT9", "evidence_id": "EV-PDB-6RT9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "6RT9", "doi": "10.1039/d0cp02469d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6RT9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Orthorhombic lysozyme grown with 300g/L sucrose" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6RTA", "evidence_id": "EV-PDB-6RTA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "6RTA", "doi": "10.1039/d0cp02469d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6RTA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Tetragonal lysozyme grown with 300g/L Ficoll" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6S7N", "evidence_id": "EV-PDB-6S7N-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "6S7N", "doi": "10.1107/S2053230X19013189", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6S7N" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of orthorhombic lysozyme grown at pH 5.5 with a 26% of solvent content" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AU", "EDO", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6SEW", "evidence_id": "EV-PDB-6SEW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.12 }, "provenance": { "deposit_id": "6SEW", "doi": "10.1039/c9dt02729g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6SEW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the gold/lysozyme adduct formed upon 24h exposure of protein crystals to compound 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "AU", "DMS", "EDO", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6SEX", "evidence_id": "EV-PDB-6SEX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.78 }, "provenance": { "deposit_id": "6SEX", "doi": "10.1039/c9dt02729g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6SEX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the gold/lysozyme adduct formed upon 21h exposure of protein crystals to compound 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AU", "EDO", "NA", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6SEZ", "evidence_id": "EV-PDB-6SEZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.22 }, "provenance": { "deposit_id": "6SEZ", "doi": "10.1039/c9dt02729g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6SEZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the gold/lysozyme adduct formed upon 24h exposure of protein crystals to compound 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6SIJ", "evidence_id": "EV-PDB-6SIJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6101802385 }, "provenance": { "deposit_id": "6SIJ", "doi": "10.1107/S2053273319011446", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6SIJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SAD structure of Hen Egg White Lysozyme recovered by continuous rotation data collection and multivariate analysis of Friedel pairs" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6SIK", "evidence_id": "EV-PDB-6SIK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.61007015159 }, "provenance": { "deposit_id": "6SIK", "doi": "10.1107/S2053273319011446", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6SIK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SAD structure of Hen Egg White Lysozyme recovered by continuous rotation data collection and univariate analysis" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DO3", "GD", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6SR1", "evidence_id": "EV-PDB-6SR1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "6SR1", "doi": "10.1038/s41467-020-15610-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6SR1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray pump X-ray probe on lysozyme.Gd nanocrystals: 35 fs time delay" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DO3", "GD", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6SR3", "evidence_id": "EV-PDB-6SR3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "6SR3", "doi": "10.1038/s41467-020-15610-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6SR3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray pump X-ray probe on lysozyme.Gd nanocrystals: 62 fs time delay" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DO3", "GD", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6SR4", "evidence_id": "EV-PDB-6SR4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "6SR4", "doi": "10.1038/s41467-020-15610-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6SR4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray pump X-ray probe on lysozyme.Gd nanocrystals: 112 fs time delay" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "IMD", "LYE", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6SYC", "evidence_id": "EV-PDB-6SYC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.38 }, "provenance": { "deposit_id": "6SYC", "doi": "10.1107/S2059798320008803", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6SYC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the lysozyme in presence of bromophenol blue at pH 6.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "LYE", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6SYD", "evidence_id": "EV-PDB-6SYD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "6SYD", "doi": "10.1107/S2059798320008803", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6SYD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the lysozyme in presence of bromophenol blue at pH 5.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NYN", "TFS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6TVL", "evidence_id": "EV-PDB-6TVL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.395 }, "provenance": { "deposit_id": "6TVL", "doi": "10.1007/s00775-020-01786-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6TVL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme in complex with a \"half sandwich\"-type Ru(II) coordination compound" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "7MT", "CL", "NA", "TB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6TVY", "evidence_id": "EV-PDB-6TVY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.51 }, "provenance": { "deposit_id": "6TVY", "doi": "10.3390/cryst10020065", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6TVY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of hen egg white lysozyme crystallized in the presence of Tb-Xo4 crystallophore in the XtalController device" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6W7P", "evidence_id": "EV-PDB-6W7P-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "6W7P", "doi": "10.1038/s41526-020-0102-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6W7P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure Analysis of Space-grown Lysozyme - Ground experiment" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6WEB", "evidence_id": "EV-PDB-6WEB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "6WEB", "doi": "10.1038/s41467-022-32434-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6WEB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Multi-Hit SFX using MHz XFEL sources" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6WEC", "evidence_id": "EV-PDB-6WEC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "6WEC", "doi": "10.1038/s41467-022-32434-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6WEC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Multi-Hit SFX using MHz XFEL sources" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "NA", "U0J" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6WGO", "evidence_id": "EV-PDB-6WGO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "6WGO", "doi": "10.1021/acs.inorgchem.1c01675", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6WGO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The interaction of dichlorido(3-(anthracen-9-ylmethyl)-1-methylimidazol-2-ylidene)(eta6-p-cymene)ruthenium(II) with HEWL after 1 week" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "NA", "RH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6WRL", "evidence_id": "EV-PDB-6WRL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "6WRL", "doi": "10.1021/acs.inorgchem.0c02438", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6WRL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The interaction of chlorido(1,5-cyclooctadiene)([4-(2-((tert-butoxycarbonyl)amino)-3-methoxy-3-oxopropyl)-1,3-dimethyl-1H-imidazol-3-ide])rhodium(I) with HEWL after 1 week" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "RH", "U8G" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6WRM", "evidence_id": "EV-PDB-6WRM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "6WRM", "doi": "10.1021/acs.inorgchem.0c02438", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6WRM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The interaction of chlorido(1,5-cyclooctadiene)([4-(2-((tert-butoxycarbonyl)amino)-3-methoxy-3-oxopropyl)-1,3-dimethyl-1H-imidazol-3-ide])rhodium(I) with HEWL after 1 month" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 20.35 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6YBF", "evidence_id": "EV-PDB-6YBF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.13 }, "provenance": { "deposit_id": "6YBF", "doi": "10.1107/S2059798320008475", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6YBF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "RT structure of HEW Lysozyme obtained at 1.13 A resolution from crystal grown in a Kapton microchip." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 20.35 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6YBI", "evidence_id": "EV-PDB-6YBI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.12 }, "provenance": { "deposit_id": "6YBI", "doi": "10.1107/S2059798320008475", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6YBI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "RT structure of HEW Lysozyme obtained at 1.12 A resolution from crystal grown in a Mylar microchip." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "NA", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6WX5", "evidence_id": "EV-PDB-6WX5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "6WX5", "doi": "10.1021/acs.inorgchem.0c03317", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6WX5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Adducts formed after 3 weeks in the reaction of chlorido[chlorido(2,2'-((2-([2,2':6',2''-Terpyridin]-4'-yloxy)ethyl)azanediyl)bis(ethan-1-ol))platinum(II)] with HEWL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6W8E", "evidence_id": "EV-PDB-6W8E-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.68 }, "provenance": { "deposit_id": "6W8E", "doi": "10.1038/s41526-020-0102-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6W8E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal Structure Analysis of Space-grown Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "LYE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6SYE", "evidence_id": "EV-PDB-6SYE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.97 }, "provenance": { "deposit_id": "6SYE", "doi": "10.1107/S2059798320008803", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6SYE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of orthorhombic lysozyme in presence of the dye bromophenol blue at pH 7.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DO3", "GD", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6SR5", "evidence_id": "EV-PDB-6SR5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "6SR5", "doi": "10.1038/s41467-020-15610-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6SR5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray pump X-ray probe on lysozyme.Gd nanocrystals: 102 fs time delay" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DO3", "GD", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6SR2", "evidence_id": "EV-PDB-6SR2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "6SR2", "doi": "10.1038/s41467-020-15610-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6SR2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray pump X-ray probe on lysozyme.Gd nanocrystals: 37 fs time delay" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DO3", "GD", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6SR0", "evidence_id": "EV-PDB-6SR0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "6SR0", "doi": "10.1038/s41467-020-15610-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6SR0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray pump X-ray probe on lysozyme.Gd nanocrystals: single colour reference data" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6SIM", "evidence_id": "EV-PDB-6SIM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6101802385 }, "provenance": { "deposit_id": "6SIM", "doi": "10.1107/S2053273319011446", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6SIM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SAD structure of Hen Egg White Lysozyme recovered by inverse beam geometry data collection and univariate analysis" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6SIL", "evidence_id": "EV-PDB-6SIL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6101802385 }, "provenance": { "deposit_id": "6SIL", "doi": "10.1107/S2053273319011446", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6SIL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SAD structure of Hen Egg White Lysozyme recovered by inverse beam geometry data collection and multivariate analysis of Friedel pairs" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AU", "EDO", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6SEU", "evidence_id": "EV-PDB-6SEU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "6SEU", "doi": "10.1039/c9dt02729g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6SEU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the gold/lysozyme adduct formed upon 21h exposure of protein crystals to compound 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AU", "CL", "DMS", "EDO", "NA", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6SET", "evidence_id": "EV-PDB-6SET-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "6SET", "doi": "10.1039/c9dt02729g", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6SET" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the gold/lysozyme adduct formed upon 3 days exposure of protein crystals to compound 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6S2N", "evidence_id": "EV-PDB-6S2N-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "6S2N", "doi": "10.1038/s41467-020-14793-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6S2N" }, "reader": null, "source_kind": "deposit", "technique": "microed", "title": "Hen egg-white lysozyme by serial electron diffraction" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "PEG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6RXI", "evidence_id": "EV-PDB-6RXI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "6RXI", "doi": "10.1107/S2052252519016865", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6RXI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "In-flow serial synchrotron crystallography using a 3D-printed microfluidic device (3D-MiXD): Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA", "QEB", "RE", "RRE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6RO5", "evidence_id": "EV-PDB-6RO5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.68 }, "provenance": { "deposit_id": "6RO5", "doi": "10.1107/S2052252519006651", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6RO5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "1Yr-Y: Lysozyme with Re Cluster 1 year on shelf" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "BR", "CL", "KBW", "NA", "RE", "RRE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6RO3", "evidence_id": "EV-PDB-6RO3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.03 }, "provenance": { "deposit_id": "6RO3", "doi": "10.1107/S2052252519006651", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6RO3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "2Yr-X: Lysozyme with Re Cluster 2 year on shelf" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QY4", "evidence_id": "EV-PDB-6QY4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.84 }, "provenance": { "deposit_id": "6QY4", "doi": "10.1107/S205225251900914X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QY4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Pink beam serial crystallography: Lysozyme, 1 us exposure, 14793 patterns merged" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6QY1", "evidence_id": "EV-PDB-6QY1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "6QY1", "doi": "10.1107/S205225251900914X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6QY1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Pink beam serial crystallography: Lysozyme, 5 us exposure, 1500 patterns merged" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6YJX", "evidence_id": "EV-PDB-6YJX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "6YJX", "doi": "10.1107/S2053230X20008328", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6YJX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Hen egg-white lysozyme crystallized with PAS polypeptide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACY", "BR", "NA", "PG0" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6YOB", "evidence_id": "EV-PDB-6YOB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "6YOB", "doi": "10.1107/S2052252520013238", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6YOB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Lysozyme from COC IMISX setup collected by rotation serial crystallography on crystals prelocated by 2D X-ray phase-contrast imaging" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACY", "BR", "NA", "PE5" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6YOC", "evidence_id": "EV-PDB-6YOC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.86 }, "provenance": { "deposit_id": "6YOC", "doi": "10.1107/S2052252520013238", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6YOC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Lysozyme from COC IMISX setup collected by still serial crystallography on crystals prelocated by 2D X-ray phase-contrast imaging" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACY", "AE3", "BR", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6YOE", "evidence_id": "EV-PDB-6YOE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "6YOE", "doi": "10.1107/S2052252520013238", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6YOE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Lysozyme from SiN IMISX setup collected by still serial crystallography on crystals prelocated by 2D X-ray phase-contrast imaging" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A6R", "DMS", "EDO", "NA", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6ZS8", "evidence_id": "EV-PDB-6ZS8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.153 }, "provenance": { "deposit_id": "6ZS8", "doi": "10.1039/d0dt04068a", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6ZS8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon treating lysozyme with an aged solution of arsenoplatin-1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA", "R3H" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7A70", "evidence_id": "EV-PDB-7A70-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "7A70", "doi": "10.3390/biom11010043", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7A70" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEW lysozyme in complex with Ti(OH)4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7AC2", "evidence_id": "EV-PDB-7AC2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.507 }, "provenance": { "deposit_id": "7AC2", "doi": "10.1107/S2059798321007324", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7AC2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Hen Egg White Lysozyme collected by rotation serial crystallography on a COC membrane at a synchrotron source" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7AVE", "evidence_id": "EV-PDB-7AVE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.98 }, "provenance": { "deposit_id": "7AVE", "doi": "10.1107/S2052252521001299", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7AVE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Perdeuterated refolded hen egg-white lysozyme at 100 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7AVG", "evidence_id": "EV-PDB-7AVG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.0 }, "provenance": { "deposit_id": "7AVG", "doi": "10.1107/S2052252521001299", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7AVG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Perdeuterated hen egg-white lysozyme at 100 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CHT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BAZ", "evidence_id": "EV-PDB-7BAZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "7BAZ", "doi": "10.1021/acssuschemeng.1c01230", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BAZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme crystallized in the presence of the hydrated deep eutectic solvent Choline chloride-Glycerol 1:2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CHT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BB1", "evidence_id": "EV-PDB-7BB1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "7BB1", "doi": "10.1021/acssuschemeng.1c01230", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BB1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme crystallized in the presence of the hydrated deep eutectic solvent Choline chloride-Glutamic acid 2:1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DMS", "IMD", "NA", "RU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BCU", "evidence_id": "EV-PDB-7BCU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.98 }, "provenance": { "deposit_id": "7BCU", "doi": "10.1021/acs.inorgchem.1c01441", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BCU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The adduct of NAMI-A with Hen Egg White Lysozyme at 1.5 hours." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "IMD", "NA", "RU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BD0", "evidence_id": "EV-PDB-7BD0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.06 }, "provenance": { "deposit_id": "7BD0", "doi": "10.1021/acs.inorgchem.1c01441", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BD0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The adduct of NAMI-A with Hen Egg White Lysozyme at 26 hours." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA", "RU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BDM", "evidence_id": "EV-PDB-7BDM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.07 }, "provenance": { "deposit_id": "7BDM", "doi": "10.1021/acs.inorgchem.1c01441", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BDM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The adduct of NAMI-A with Hen Egg White Lysozyme at 98 hours." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "EDO", "NO3", "RH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BDZ", "evidence_id": "EV-PDB-7BDZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.94 }, "provenance": { "deposit_id": "7BDZ", "doi": "10.3390/ijms22031496", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BDZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of Hen Egg White Lysozyme with dirhodium tetraacetate (1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "EDO", "NO3", "RH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BE0", "evidence_id": "EV-PDB-7BE0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.62 }, "provenance": { "deposit_id": "7BE0", "doi": "10.3390/ijms22031496", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BE0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of Hen Egg White Lysozyme with dirhodium tetraacetate (2)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "EDO", "NA", "NO3", "RH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BE1", "evidence_id": "EV-PDB-7BE1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "7BE1", "doi": "10.3390/ijms22031496", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BE1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of Hen Egg White Lysozyme with dirhodium tetraacetate (3)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "GOL", "NA", "RH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BE2", "evidence_id": "EV-PDB-7BE2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "7BE2", "doi": "10.3390/ijms22031496", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BE2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of Hen Egg White Lysozyme with dirhodium tetraacetate (6)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "EDO", "NA", "NO3", "RH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BEB", "evidence_id": "EV-PDB-7BEB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.32 }, "provenance": { "deposit_id": "7BEB", "doi": "10.3390/ijms22031496", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BEB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Unusual structural features in the adduct of dirhodium tetraacetate with lysozyme (4)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "EDO", "NA", "NO3", "RH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BEC", "evidence_id": "EV-PDB-7BEC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.74 }, "provenance": { "deposit_id": "7BEC", "doi": "10.3390/ijms22031496", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BEC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Unusual structural features in the adduct of dirhodium tetraacetate with lysozyme (5)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 34.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BHK", "evidence_id": "EV-PDB-7BHK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "7BHK", "doi": "10.1038/s41467-021-24757-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BHK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme using drop-on-drop SFX method." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 34.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BHL", "evidence_id": "EV-PDB-7BHL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "7BHL", "doi": "10.1038/s41467-021-24757-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BHL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme using drop-on-drop SFX method - 0.2 s mixing with N-acetyl-D-glucosamine." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 34.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BHM", "evidence_id": "EV-PDB-7BHM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "7BHM", "doi": "10.1038/s41467-021-24757-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BHM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme using drop-on-drop SFX method - 0.7 s mixing with N-acetyl-D-glucosamine." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 34.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BHN", "evidence_id": "EV-PDB-7BHN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "7BHN", "doi": "10.1038/s41467-021-24757-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BHN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme using drop-on-drop SFX method - 2 s mixing with N-acetyl-D-glucosamine." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Hen egg white lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BMO", "evidence_id": "EV-PDB-7BMO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "7BMO", "doi": "10.1038/s41598-021-95186-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BMO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL in cesium chloride (0.25 M CsCl in protein buffer)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CS", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BMP", "evidence_id": "EV-PDB-7BMP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "7BMP", "doi": "10.1038/s41598-021-95186-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BMP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL in cesium chloride (0.25 M CsCl in protein buffer and cryo protectant)." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CS", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BMQ", "evidence_id": "EV-PDB-7BMQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.79 }, "provenance": { "deposit_id": "7BMQ", "doi": "10.1038/s41598-021-95186-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BMQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL in cesium chloride (1.71 M CsCl in cryo protectant)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CS", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BMS", "evidence_id": "EV-PDB-7BMS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "7BMS", "doi": "10.1038/s41598-021-95186-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BMS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL in cesium chloride (1.5 M CsCl in crystallization condition and cryo protectant)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BMT", "evidence_id": "EV-PDB-7BMT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.47 }, "provenance": { "deposit_id": "7BMT", "doi": "10.1038/s41598-021-95186-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BMT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL in sodium chloride" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BR5", "evidence_id": "EV-PDB-7BR5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.0 }, "provenance": { "deposit_id": "7BR5", "doi": "10.1107/S2059798321000346", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BR5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme-sugar complex in H2O" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 25.0 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BVM", "evidence_id": "EV-PDB-7BVM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "7BVM", "doi": "10.3390/ijms21093332", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BVM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of lysozyme delivered in wheat starch" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 25.0 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BVO", "evidence_id": "EV-PDB-7BVO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "7BVO", "doi": "10.3390/ijms21093332", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BVO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of lysozyme delivered in alginate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BYO", "evidence_id": "EV-PDB-7BYO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7BYO", "doi": "10.1038/s41566-021-00777-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BYO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme structure SS1 from SS mode" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BYP", "evidence_id": "EV-PDB-7BYP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7BYP", "doi": "10.1038/s41566-021-00777-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BYP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme structure SASE1 from SASE mode" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7C09", "evidence_id": "EV-PDB-7C09-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "7C09", "doi": "10.1039/d0lc00443j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7C09" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of lysozyme obtained in SSRF using serial crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MLI", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7CDM", "evidence_id": "EV-PDB-7CDM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "7CDM", "doi": "10.1107/S2059798321001686", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7CDM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme room-temperature structure determined by SS-ROX combined with HAG method, 42 kGy (4500 images from 2nd half of data set)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MLI", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7CDN", "evidence_id": "EV-PDB-7CDN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "7CDN", "doi": "10.1107/S2059798321001686", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7CDN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme room-temperature structure determined by SS-ROX combined with HAG method, 42 kGy (9000 images)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MLI", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7CDO", "evidence_id": "EV-PDB-7CDO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "7CDO", "doi": "10.1107/S2059798321001686", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7CDO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme room-temperature structure determined by SS-ROX combined with HAG method, 21 kGy (3000 images)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MLI", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7CDP", "evidence_id": "EV-PDB-7CDP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "7CDP", "doi": "10.1107/S2059798321001686", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7CDP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme room-temperature structure determined by SS-ROX combined with HAG method, 42 kGy (3000 images)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MLI", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7CDQ", "evidence_id": "EV-PDB-7CDQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "7CDQ", "doi": "10.1107/S2059798321001686", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7CDQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme room-temperature structure determined by SS-ROX combined with HAG method, 83 kGy (3000 images)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MLI", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7CDR", "evidence_id": "EV-PDB-7CDR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "7CDR", "doi": "10.1107/S2059798321001686", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7CDR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme room-temperature structure determined by SS-ROX combined with HAG method, 210 kGy (3000 images)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MLI", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7CDS", "evidence_id": "EV-PDB-7CDS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "7CDS", "doi": "10.1107/S2059798321001686", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7CDS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme room-temperature structure determined by SS-ROX combined with HAG method, 420 kGy (3000 images)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MLI", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7CDT", "evidence_id": "EV-PDB-7CDT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "7CDT", "doi": "10.1107/S2059798321001686", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7CDT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme room-temperature structure determined by SS-ROX combined with HAG method, 830 kGy (3000 images)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MLI", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7CDU", "evidence_id": "EV-PDB-7CDU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "7CDU", "doi": "10.1107/S2059798321001686", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7CDU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme room-temperature structure determined by SS-ROX combined with HAG method, 1700 kGy (3000 images)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "MLI", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7CDK", "evidence_id": "EV-PDB-7CDK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "7CDK", "doi": "10.1107/S2059798321001686", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7CDK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme room-temperature structure determined by SS-ROX combined with HAG method, 42 kGy (4500 images from 1st half of data set)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "CS", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BMR", "evidence_id": "EV-PDB-7BMR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.78 }, "provenance": { "deposit_id": "7BMR", "doi": "10.1038/s41598-021-95186-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BMR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL in cesium chloride (0.25 M CsCl in protein buffer and 1.71 M CsCl in cryo protectant)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DMS", "IMD", "NA", "RU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7BCX", "evidence_id": "EV-PDB-7BCX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.06 }, "provenance": { "deposit_id": "7BCX", "doi": "10.1021/acs.inorgchem.1c01441", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7BCX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The adduct of NAMI-A with Hen Egg White Lysozyme at 8 hours." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CHT", "CL", "NA", "URE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7B9J", "evidence_id": "EV-PDB-7B9J-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "7B9J", "doi": "10.1021/acssuschemeng.1c01230", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7B9J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme crystallized in the presence of the hydrated deep eutectic solvent Choline chloride-Urea 1:2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7AVF", "evidence_id": "EV-PDB-7AVF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.0 }, "provenance": { "deposit_id": "7AVF", "doi": "10.1107/S2052252521001299", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7AVF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Triclinic hydrogenated hen egg-white lysozyme at 100 K (control)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACY", "AE3", "BR", "NA", "PG0" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/6YOD", "evidence_id": "EV-PDB-6YOD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.601 }, "provenance": { "deposit_id": "6YOD", "doi": "10.1107/S2052252520013238", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/6YOD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of Lysozyme from SiN IMISX setup collected by rotation serial crystallography on crystals prelocated by 2D X-ray phase-contrast imaging" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 25.0 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7CJZ", "evidence_id": "EV-PDB-7CJZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "7CJZ", "doi": "10.3390/ijms21175977", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7CJZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature structure of lysozyme delivered in lard by serial millisecond crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "SEY" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7CQO", "evidence_id": "EV-PDB-7CQO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.71 }, "provenance": { "deposit_id": "7CQO", "doi": "10.3390/cryst12070976", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7CQO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme grown in LCP soaked with selenourea for 6 min" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 25.0 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7CVJ", "evidence_id": "EV-PDB-7CVJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "7CVJ", "doi": "10.3390/cryst10090803", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7CVJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of lysozyme by fixed-target serial synchrotron crystallography (100 ms)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7D01", "evidence_id": "EV-PDB-7D01-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "7D01", "doi": "10.1038/s41566-021-00777-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7D01" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme structure SS2 from SS mode" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7D02", "evidence_id": "EV-PDB-7D02-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "7D02", "doi": "10.1038/s41566-021-00777-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7D02" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme structure SASE2 from SASE mode" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7D04", "evidence_id": "EV-PDB-7D04-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "7D04", "doi": "10.1038/s41566-021-00777-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7D04" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme structure SS3 from SS mode" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7D05", "evidence_id": "EV-PDB-7D05-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "7D05", "doi": "10.1038/s41566-021-00777-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7D05" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme structure SASE3 from SASE mode" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7D0W", "evidence_id": "EV-PDB-7D0W-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "7D0W", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7D0W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Hen Egg White Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7DEQ", "evidence_id": "EV-PDB-7DEQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.03 }, "provenance": { "deposit_id": "7DEQ", "doi": "10.1107/S2059798321000346", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7DEQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme-sugar complex in D2O" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7DER", "evidence_id": "EV-PDB-7DER-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.03 }, "provenance": { "deposit_id": "7DER", "doi": "10.1107/S2059798321000346", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7DER" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme alone in H2O" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7DLN", "evidence_id": "EV-PDB-7DLN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.15 }, "provenance": { "deposit_id": "7DLN", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7DLN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Structure of lysozyme obtained on SSRF using serial synchrotron crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 25.0 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7DTB", "evidence_id": "EV-PDB-7DTB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "7DTB", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7DTB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room tempeature structure of lysozyme by fixed-target serial crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 25.0 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7DTF", "evidence_id": "EV-PDB-7DTF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "7DTF", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7DTF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature structure of lysozyme by serial millisecond crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7E02", "evidence_id": "EV-PDB-7E02-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "7E02", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7E02" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature structure of lysozyme delivered in beef tallow by serial millisecond crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 23.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7F26", "evidence_id": "EV-PDB-7F26-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "7F26", "doi": "10.1107/S2053230X21008104", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7F26" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NI" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7FCU", "evidence_id": "EV-PDB-7FCU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.42 }, "provenance": { "deposit_id": "7FCU", "doi": "10.1107/S2059798322004521", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7FCU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of D2O-solvent lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NI" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7FCW", "evidence_id": "EV-PDB-7FCW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.43 }, "provenance": { "deposit_id": "7FCW", "doi": "10.1107/S2059798322004521", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7FCW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of H2O-solvent lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7FGV", "evidence_id": "EV-PDB-7FGV-1", "mappings": [], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "7FGV", "doi": "10.1007/s12033-022-00447-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7FGV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H/D exchanged Hen egg-white lysozyme denatured in heat condition and refolded in solution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "WE4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7KH5", "evidence_id": "EV-PDB-7KH5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.295 }, "provenance": { "deposit_id": "7KH5", "doi": "10.1107/S2053230X21004052", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7KH5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme in complex with tetrabromoterephthalic acid" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7KNK", "evidence_id": "EV-PDB-7KNK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "7KNK", "doi": "10.1107/S1600576723006805", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7KNK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "STRUCTURE OF HEN EGG-WHITE LYSOZYME grown with Kitchen recipe" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LLP", "evidence_id": "EV-PDB-7LLP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.13 }, "provenance": { "deposit_id": "7LLP", "doi": "10.1107/S2059798322005939", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LLP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray radiation damage series on Lysozyme at 277K, crystal structure, dataset 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LN9", "evidence_id": "EV-PDB-7LN9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.13 }, "provenance": { "deposit_id": "7LN9", "doi": "10.1107/S2059798322005939", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LN9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray radiation damage series on Lysozyme at 277K, multi-conformer model, dataset 1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LOR", "evidence_id": "EV-PDB-7LOR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.52 }, "provenance": { "deposit_id": "7LOR", "doi": "10.1107/S2059798322005939", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LOR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray radiation damage series on Lysozyme at 277K, multi-conformer model, dataset 3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LPL", "evidence_id": "EV-PDB-7LPL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.14 }, "provenance": { "deposit_id": "7LPL", "doi": "10.1107/S2059798322005939", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LPL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray radiation damage series on Lysozyme at 277K, multi-conformer model, dataset 3 (merged)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LPM", "evidence_id": "EV-PDB-7LPM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "7LPM", "doi": "10.1107/S2059798322005939", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LPM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray radiation damage series on Lysozyme at 277K, multi-conformer model, crystal 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LYZ", "evidence_id": "EV-PDB-7LYZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "7LYZ", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LYZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "PROTEIN MODEL BUILDING BY THE USE OF A CONSTRAINED-RESTRAINED LEAST-SQUARES PROCEDURE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7MRP", "evidence_id": "EV-PDB-7MRP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "7MRP", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7MRP" }, "reader": null, "source_kind": "deposit", "technique": "microed", "title": "MicroED structure of lysozyme from milled crystals at 1.75A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7NJF", "evidence_id": "EV-PDB-7NJF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "7NJF", "doi": "10.1107/S2059798321003855", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7NJF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg white lysozyme (HEWL) grown inside HARE serial crystallography chip" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7NKF", "evidence_id": "EV-PDB-7NKF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "7NKF", "doi": "10.1107/S2059798321003855", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7NKF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg white lysozyme (HEWL) Grown inside (Not centrifuged) HARE serial crystallography chip." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 25.0 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7O2O", "evidence_id": "EV-PDB-7O2O-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.833 }, "provenance": { "deposit_id": "7O2O", "doi": "10.3390/mi13081365", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7O2O" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme structure from microfluidic-based in situ data collection" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EPE", "IPA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7OL5", "evidence_id": "EV-PDB-7OL5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.94 }, "provenance": { "deposit_id": "7OL5", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7OL5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Lysozyme in complex with Hepes" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "IMD", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7OL6", "evidence_id": "EV-PDB-7OL6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "7OL6", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7OL6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Lysozyme in complex with Imidazole" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "ETF", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7OL7", "evidence_id": "EV-PDB-7OL7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.15 }, "provenance": { "deposit_id": "7OL7", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7OL7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Lysozyme in complex with trifluoroethanol: tetragonal form" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "ETF", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7OL8", "evidence_id": "EV-PDB-7OL8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.15 }, "provenance": { "deposit_id": "7OL8", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7OL8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Lysozyme in complex with trifluoroethanol: orthorhombic form" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7P6M", "evidence_id": "EV-PDB-7P6M-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.89 }, "provenance": { "deposit_id": "7P6M", "doi": "10.1107/S2059798321010950", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7P6M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hydrogenated refolded hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DMS", "GOL", "IMD", "NO3", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7PNH", "evidence_id": "EV-PDB-7PNH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.22 }, "provenance": { "deposit_id": "7PNH", "doi": "10.3390/ijms221910551", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7PNH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of Pt(II) complex 2c with lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FE", "FES", "SO4", "UB7" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains H)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7Q05", "evidence_id": "EV-PDB-7Q05-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.08 }, "provenance": { "deposit_id": "7Q05", "doi": "10.1073/pnas.2121426119", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7Q05" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of TPADO in complex with TPA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "8IB", "FE", "FES", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains H)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7Q06", "evidence_id": "EV-PDB-7Q06-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.95 }, "provenance": { "deposit_id": "7Q06", "doi": "10.1073/pnas.2121426119", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7Q06" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of TPADO in complex with 2-OH-TPA" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "0BP", "ACT", "CL", "NA", "O", "V" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7Q0U", "evidence_id": "EV-PDB-7Q0U-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.19 }, "provenance": { "deposit_id": "7Q0U", "doi": "10.1002/chem.202200105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7Q0U" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme soaked with V(IV)OSO4 and bipy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA", "O", "PHN", "V" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7Q0V", "evidence_id": "EV-PDB-7Q0V-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.12 }, "provenance": { "deposit_id": "7Q0V", "doi": "10.1002/chem.202200105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7Q0V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme soaked with V(IV)OSO4 and phen" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "GOL", "NA", "O", "V" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7Q0T", "evidence_id": "EV-PDB-7Q0T-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.34 }, "provenance": { "deposit_id": "7Q0T", "doi": "10.1002/chem.202200105", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7Q0T" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme soaked with V(IV)OSO4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "FE", "FES" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains H)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7Q04", "evidence_id": "EV-PDB-7Q04-3", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.281 }, "provenance": { "deposit_id": "7Q04", "doi": "10.1073/pnas.2121426119", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7Q04" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of TPADO in a substrate-free state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LP6", "evidence_id": "EV-PDB-7LP6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.13 }, "provenance": { "deposit_id": "7LP6", "doi": "10.1107/S2059798322005939", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LP6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray radiation damage series on Lysozyme at 277K, multi-conformer model, dataset 2 (merged)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LOQ", "evidence_id": "EV-PDB-7LOQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "7LOQ", "doi": "10.1107/S2059798322005939", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LOQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray radiation damage series on Lysozyme at 277K, multi-conformer model, dataset 2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 3.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7LN8", "evidence_id": "EV-PDB-7LN8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.52 }, "provenance": { "deposit_id": "7LN8", "doi": "10.1107/S2059798322005939", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7LN8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray radiation damage series on Lysozyme at 277K, crystal structure, dataset 3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7L84", "evidence_id": "EV-PDB-7L84-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "7L84", "doi": "10.1107/S2059798322006799", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7L84" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme by Native S-SAD at Room Temperature" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7JMU", "evidence_id": "EV-PDB-7JMU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "7JMU", "doi": "10.1016/j.jcis.2020.10.024", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7JMU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme with ionic liquid ethylammonium nitrate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7FGU", "evidence_id": "EV-PDB-7FGU-1", "mappings": [], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "7FGU", "doi": "10.1007/s12033-022-00447-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7FGU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H/D exchanged Hen egg-white lysozyme denatured in basic conditions and refolded in solution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7FG8", "evidence_id": "EV-PDB-7FG8-1", "mappings": [], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "7FG8", "doi": "10.1007/s12033-022-00447-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7FG8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "H/D exchanged Hen egg-white lysozyme denatured in acidic conditions and refolded in solution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 25.0 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7CVL", "evidence_id": "EV-PDB-7CVL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7CVL", "doi": "10.3390/cryst10090803", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7CVL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of lysozyme by fixed-target serial synchrotron crystallography (500 ms)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DIO", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains BBB)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7QNP", "evidence_id": "EV-PDB-7QNP-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.586 }, "provenance": { "deposit_id": "7QNP", "doi": "10.1021/acs.biochem.2c00083", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7QNP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Designed Armadillo repeat protein N(A4)M4C(AII) co-crystallized with hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EPE", "NA", "RH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7QQ1", "evidence_id": "EV-PDB-7QQ1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.48 }, "provenance": { "deposit_id": "7QQ1", "doi": "10.1039/d2dt00082b", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7QQ1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct obtained upon reaction of [cis-Rh2(OCOCH3)2(OCOCF3)2] with HEWL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "AU", "DMS" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7R1Q", "evidence_id": "EV-PDB-7R1Q-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "7R1Q", "doi": "10.1039/d2dt00423b", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7R1Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of the gold(I) N-heterocyclic carbene complex Au2 with lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA,BBB)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7RXY", "evidence_id": "EV-PDB-7RXY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7RXY", "doi": "10.1016/j.jcis.2023.07.045", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7RXY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme with ionic liquid ethylammonium nitrate 5 mol%" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA,BBB)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7RYD", "evidence_id": "EV-PDB-7RYD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.18 }, "provenance": { "deposit_id": "7RYD", "doi": "10.1016/j.jcis.2023.07.045", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7RYD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme with ionic liquid butylammonium nitrate 1 mol%" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA,BBB)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7RYK", "evidence_id": "EV-PDB-7RYK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.76 }, "provenance": { "deposit_id": "7RYK", "doi": "10.1016/j.jcis.2023.07.045", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7RYK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme with ionic liquid ethanolammonium nitrate 1 mol%" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ETA", "FMT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7RZ0", "evidence_id": "EV-PDB-7RZ0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.38 }, "provenance": { "deposit_id": "7RZ0", "doi": "10.1016/j.jcis.2023.07.045", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7RZ0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme with ionic liquid ethanolammonium formate 6.7 mol%" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7S27", "evidence_id": "EV-PDB-7S27-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7S27", "doi": "10.1016/j.ab.2022.114594", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7S27" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7S28", "evidence_id": "EV-PDB-7S28-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7S28", "doi": "10.1016/j.ab.2022.114594", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7S28" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7S29", "evidence_id": "EV-PDB-7S29-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7S29", "doi": "10.1016/j.ab.2022.114594", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7S29" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7S2A", "evidence_id": "EV-PDB-7S2A-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7S2A", "doi": "10.1016/j.ab.2022.114594", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7S2A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7S2B", "evidence_id": "EV-PDB-7S2B-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7S2B", "doi": "10.1016/j.ab.2022.114594", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7S2B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7S2C", "evidence_id": "EV-PDB-7S2C-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7S2C", "doi": "10.1016/j.ab.2022.114594", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7S2C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7S2E", "evidence_id": "EV-PDB-7S2E-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7S2E", "doi": "10.1016/j.ab.2022.114594", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7S2E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7S2F", "evidence_id": "EV-PDB-7S2F-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.58 }, "provenance": { "deposit_id": "7S2F", "doi": "10.1016/j.ab.2022.114594", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7S2F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7S2G", "evidence_id": "EV-PDB-7S2G-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7S2G", "doi": "10.1016/j.ab.2022.114594", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7S2G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7S2Q", "evidence_id": "EV-PDB-7S2Q-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7S2Q", "doi": "10.1016/j.ab.2022.114594", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7S2Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7S2U", "evidence_id": "EV-PDB-7S2U-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7S2U", "doi": "10.1016/j.ab.2022.114594", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7S2U" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7S2W", "evidence_id": "EV-PDB-7S2W-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7S2W", "doi": "10.1016/j.ab.2022.114594", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7S2W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7S30", "evidence_id": "EV-PDB-7S30-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7S30", "doi": "10.1016/j.ab.2022.114594", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7S30" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7S31", "evidence_id": "EV-PDB-7S31-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7S31", "doi": "10.1016/j.ab.2022.114594", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7S31" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7S33", "evidence_id": "EV-PDB-7S33-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7S33", "doi": "10.1016/j.ab.2022.114594", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7S33" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NI" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7VEI", "evidence_id": "EV-PDB-7VEI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "7VEI", "doi": "10.1107/S2059798322004521", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7VEI" }, "reader": null, "source_kind": "deposit", "technique": "neutron", "title": "Neutron structure of D2O-solvent lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7VGO", "evidence_id": "EV-PDB-7VGO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "7VGO", "doi": "10.1007/s10930-021-10036-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7VGO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7WBD", "evidence_id": "EV-PDB-7WBD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "7WBD", "doi": "10.3390/cryst12010103", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7WBD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of lysozyme (multilcrystal diffraction, CrystFEL/XGANDALF)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7WBE", "evidence_id": "EV-PDB-7WBE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "7WBE", "doi": "10.3390/cryst12010103", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7WBE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of lysozyme (multilcrystal diffraction, CrystFEL/MOSFLM)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7WBF", "evidence_id": "EV-PDB-7WBF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7WBF", "doi": "10.3390/cryst12010103", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7WBF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7WKR", "evidence_id": "EV-PDB-7WKR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7WKR", "doi": "10.1107/S1600576722005556", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7WKR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature structure of lysozyme solved by serial synchrotron crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 25.0 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7WUC", "evidence_id": "EV-PDB-7WUC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "7WUC", "doi": "10.1107/S1600576722005556", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7WUC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room-temperature structure of lysozyme by serial femtosecond crystallography (BITS)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -178.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7WXS", "evidence_id": "EV-PDB-7WXS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "7WXS", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7WXS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme protected by polyacrylamide gel" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.6, "salt_mM": null, "temperature_c": -180.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7YNV", "evidence_id": "EV-PDB-7YNV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.39 }, "provenance": { "deposit_id": "7YNV", "doi": "10.3390/ijms231810399", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7YNV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of photolysed Hen Egg white LYSOZYME introduced with O-(2-nitrobenzyl)-L-tyrosine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "JI6", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7YRK", "evidence_id": "EV-PDB-7YRK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.92 }, "provenance": { "deposit_id": "7YRK", "doi": "10.1038/s41598-023-33926-1", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7YRK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of the hen egg lysozyme-2-oxidobenzylidene-threoninato-copper (II) complex" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EPE", "NA", "RH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7Z6J", "evidence_id": "EV-PDB-7Z6J-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.53 }, "provenance": { "deposit_id": "7Z6J", "doi": "10.1039/D2DT00082B", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7Z6J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct obtained upon reaction of [Rh2(OCOCH3)(OCOCF3)3] with HEWL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EPE", "NA", "V4O", "VVB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7ZU6", "evidence_id": "EV-PDB-7ZU6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.183 }, "provenance": { "deposit_id": "7ZU6", "doi": "10.1002/anie.202310655", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7ZU6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Polyoxidovanadate interaction with proteins: crystal structure of lysozyme bound to tetra-vanadate ion (structure 1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8A9D", "evidence_id": "EV-PDB-8A9D-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "8A9D", "doi": "10.1107/S2052252523003810", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8A9D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Multicrystal room temperature structure of Lysozyme collected using a double multilayer monochromator." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "DO3", "GD" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8A9E", "evidence_id": "EV-PDB-8A9E-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.665 }, "provenance": { "deposit_id": "8A9E", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8A9E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme, 9-11 fs FEL pulses as determined by XTCAV" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.6, "salt_mM": null, "temperature_c": -180.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7YNU", "evidence_id": "EV-PDB-7YNU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.44 }, "provenance": { "deposit_id": "7YNU", "doi": "10.3390/ijms231810399", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7YNU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Hen Egg white LYSOZYME introduced with O-(2-nitrobenzyl)-L-tyrosine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7Y6A", "evidence_id": "EV-PDB-7Y6A-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "7Y6A", "doi": "10.55730/1300-0152.2637", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7Y6A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Chicken Egg Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7VGP", "evidence_id": "EV-PDB-7VGP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.91 }, "provenance": { "deposit_id": "7VGP", "doi": "10.1007/s10930-021-10036-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7VGP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg lysozyme refolded after denaturation at acidic pH" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7ULY", "evidence_id": "EV-PDB-7ULY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.87 }, "provenance": { "deposit_id": "7ULY", "doi": "10.1016/j.yjsbx.2022.100078", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7ULY" }, "reader": null, "source_kind": "deposit", "technique": "microed", "title": "MicroED structure of triclinic lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7TUM", "evidence_id": "EV-PDB-7TUM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.202 }, "provenance": { "deposit_id": "7TUM", "doi": "10.1038/s41467-022-32434-6", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7TUM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Multi-Hit SFX using MHz XFEL sources- first hit" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7SKW", "evidence_id": "EV-PDB-7SKW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.87 }, "provenance": { "deposit_id": "7SKW", "doi": "10.1038/s41592-022-01485-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7SKW" }, "reader": null, "source_kind": "deposit", "technique": "microed", "title": "Ab initio structure of triclinic lysozyme from electron-counted MicroED data" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7S4W", "evidence_id": "EV-PDB-7S4W-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "7S4W", "doi": "10.1107/S1600577522002508", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7S4W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Serial Macromolecular Crystallography at ALBA Synchrotron Light Source - Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7S35", "evidence_id": "EV-PDB-7S35-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7S35", "doi": "10.1016/j.ab.2022.114594", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7S35" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7S34", "evidence_id": "EV-PDB-7S34-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7S34", "doi": "10.1016/j.ab.2022.114594", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7S34" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7S32", "evidence_id": "EV-PDB-7S32-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7S32", "doi": "10.1016/j.ab.2022.114594", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7S32" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7S2V", "evidence_id": "EV-PDB-7S2V-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7S2V", "doi": "10.1016/j.ab.2022.114594", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7S2V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7S2D", "evidence_id": "EV-PDB-7S2D-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "7S2D", "doi": "10.1016/j.ab.2022.114594", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7S2D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ETA", "FMT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7RZ2", "evidence_id": "EV-PDB-7RZ2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.07 }, "provenance": { "deposit_id": "7RZ2", "doi": "10.1016/j.jcis.2023.07.045", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7RZ2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme with ionic liquid ethanolammonium formate 4 mol%" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ETA", "FMT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/7RZ1", "evidence_id": "EV-PDB-7RZ1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.046 }, "provenance": { "deposit_id": "7RZ1", "doi": "10.1016/j.jcis.2023.07.045", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/7RZ1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme with ionic liquid ethanolammonium formate 14.4 mol%" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8A9R", "evidence_id": "EV-PDB-8A9R-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8A9R", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8A9R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Tetragonal Hen Egg-White (HEW) Lysozyme soaked in reduced resazurin in a glovebox and flash-cooled using a miniature-airlock" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ATP" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8AAZ", "evidence_id": "EV-PDB-8AAZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.27 }, "provenance": { "deposit_id": "8AAZ", "doi": "10.1021/jacs.2c09615", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8AAZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "High resolution X-ray analysis of ATP lysozyme complex in the presence of 80 mM ATP" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EPE", "H1W", "MKO", "MNW", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8AJ3", "evidence_id": "EV-PDB-8AJ3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.13 }, "provenance": { "deposit_id": "8AJ3", "doi": "10.1021/acs.inorgchem.2c02690", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8AJ3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of lysozyme obtained upon reaction with [VIVO(malt)2] (Structure A)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EPE", "MKO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8AJ4", "evidence_id": "EV-PDB-8AJ4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.22 }, "provenance": { "deposit_id": "8AJ4", "doi": "10.1021/acs.inorgchem.2c02690", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8AJ4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of lysozyme obtained upon reaction with [VIVO(malt)2] (Structure A')" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "NA", "NO3", "VO4", "VVB", "VVO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8AJ5", "evidence_id": "EV-PDB-8AJ5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.31 }, "provenance": { "deposit_id": "8AJ5", "doi": "10.1021/acs.inorgchem.2c02690", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8AJ5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of lysozyme obtained upon reaction with [VIVO(malt)2] (Structure B)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8B3U", "evidence_id": "EV-PDB-8B3U-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.71 }, "provenance": { "deposit_id": "8B3U", "doi": "10.1107/S2052252523001653", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8B3U" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme 6s in situ crystallization" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3", "PT", "R0I" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8BOY", "evidence_id": "EV-PDB-8BOY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.33 }, "provenance": { "deposit_id": "8BOY", "doi": "10.3390/ijms24032369", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8BOY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of the five-coordinate Pt(II) complex, 1-Me,Me, with HEWL at pH 4.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "R3D", "SIN" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8BPH", "evidence_id": "EV-PDB-8BPH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.07 }, "provenance": { "deposit_id": "8BPH", "doi": "10.1021/acs.inorgchem.2c04103", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8BPH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of Lysozyme with [Ru2Cl(D-p-FPhF)(O2CCH3)3] (Structure 3)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "NO3", "TZ6" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8BPJ", "evidence_id": "EV-PDB-8BPJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.38 }, "provenance": { "deposit_id": "8BPJ", "doi": "10.1021/acs.inorgchem.2c04103", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8BPJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of Lysozyme with [Ru2Cl(D-p-FPhF)(O2CCH3)3] (Structure 1)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA", "R2U" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8BQM", "evidence_id": "EV-PDB-8BQM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.17 }, "provenance": { "deposit_id": "8BQM", "doi": "10.1021/acs.inorgchem.2c04103", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8BQM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of Lysozyme with [Ru2Cl(D-p-FPhF)(O2CCH3)3] (Structure 4)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "U7U" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8BQP", "evidence_id": "EV-PDB-8BQP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.24 }, "provenance": { "deposit_id": "8BQP", "doi": "10.1039/d2fd00161f", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8BQP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg-White Lysozyme (HEWL) complexed with methyl-functionalised Anderson-Evans polyoxometalate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "RJU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8BQQ", "evidence_id": "EV-PDB-8BQQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.57 }, "provenance": { "deposit_id": "8BQQ", "doi": "10.1039/d2fd00161f", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8BQQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg-White Lysozyme (HEWL) complexed with amine-functionalised Anderson-Evans polyoxometalate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CA", "R9H" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8BQR", "evidence_id": "EV-PDB-8BQR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.32 }, "provenance": { "deposit_id": "8BQR", "doi": "10.1039/d2fd00161f", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8BQR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg-White Lysozyme (HEWL) complexed with biotin-functionalised Anderson-Evans polyoxometalate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "U7U" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8BQT", "evidence_id": "EV-PDB-8BQT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.47 }, "provenance": { "deposit_id": "8BQT", "doi": "10.1039/d2fd00161f", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8BQT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg-White Lysozyme (HEWL) complexed with two methyl-functionalised Anderson-Evans polyoxometalates" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1PE", "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "LYSOZYME, Chain A (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8CL6", "evidence_id": "EV-PDB-8CL6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.32 }, "provenance": { "deposit_id": "8CL6", "doi": "10.1038/s41467-023-43523-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8CL6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme in matrix of hydroxyethylcellulose (HEC)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8CPC", "evidence_id": "EV-PDB-8CPC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.91 }, "provenance": { "deposit_id": "8CPC", "doi": "10.1016/j.ultramic.2023.113834", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8CPC" }, "reader": null, "source_kind": "deposit", "technique": "microed", "title": "3D electron diffraction structure of Hen Egg-White Lysozyme from nano-crystals obtained by high pressure freezing and cryo-sectioning" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 17.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8CVU", "evidence_id": "EV-PDB-8CVU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.57 }, "provenance": { "deposit_id": "8CVU", "doi": "10.1038/s41557-023-01329-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8CVU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "20ns Temperature-Jump (Light) XFEL structure of Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 17.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8CVV", "evidence_id": "EV-PDB-8CVV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.57 }, "provenance": { "deposit_id": "8CVV", "doi": "10.1038/s41557-023-01329-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8CVV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "20ns Temperature-Jump (Dark1) XFEL structure of Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 17.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8CVW", "evidence_id": "EV-PDB-8CVW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.57 }, "provenance": { "deposit_id": "8CVW", "doi": "10.1038/s41557-023-01329-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8CVW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "20ns Temperature-Jump (Dark2) XFEL structure of Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 17.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8CW0", "evidence_id": "EV-PDB-8CW0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.57 }, "provenance": { "deposit_id": "8CW0", "doi": "10.1038/s41557-023-01329-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8CW0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "20us Temperature-Jump (Light) XFEL structure of Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 17.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8CW1", "evidence_id": "EV-PDB-8CW1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.57 }, "provenance": { "deposit_id": "8CW1", "doi": "10.1038/s41557-023-01329-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8CW1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "20us Temperature-Jump (Dark1) XFEL structure of Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 17.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8CW3", "evidence_id": "EV-PDB-8CW3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.57 }, "provenance": { "deposit_id": "8CW3", "doi": "10.1038/s41557-023-01329-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8CW3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "20us Temperature-Jump (Dark2) XFEL structure of Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 17.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8CW6", "evidence_id": "EV-PDB-8CW6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "8CW6", "doi": "10.1038/s41557-023-01329-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8CW6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "200us Temperature-Jump (Dark1) XFEL structure of Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 17.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8CW7", "evidence_id": "EV-PDB-8CW7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.57 }, "provenance": { "deposit_id": "8CW7", "doi": "10.1038/s41557-023-01329-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8CW7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "200us Temperature-Jump (Dark2) XFEL structure of Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 17.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8CW8", "evidence_id": "EV-PDB-8CW8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.57 }, "provenance": { "deposit_id": "8CW8", "doi": "10.1038/s41557-023-01329-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8CW8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Laser Off Temperature-Jump XFEL structure of Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 17.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8CWB", "evidence_id": "EV-PDB-8CWB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.51 }, "provenance": { "deposit_id": "8CWB", "doi": "10.1038/s41557-023-01329-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8CWB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Laser Off Temperature-Jump XFEL structure of Lysozyme Bound to N,N'-diacetylchitobiose" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 17.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8CWC", "evidence_id": "EV-PDB-8CWC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.48 }, "provenance": { "deposit_id": "8CWC", "doi": "10.1038/s41557-023-01329-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8CWC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "20ns Temperature-Jump (Light) XFEL structure of Lysozyme Bound to N,N'-diacetylchitobiose" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 17.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8CWD", "evidence_id": "EV-PDB-8CWD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.48 }, "provenance": { "deposit_id": "8CWD", "doi": "10.1038/s41557-023-01329-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8CWD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "20ns Temperature-Jump (Dark1) XFEL structure of Lysozyme Bound to N,N'-diacetylchitobiose" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 17.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8CWE", "evidence_id": "EV-PDB-8CWE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.48 }, "provenance": { "deposit_id": "8CWE", "doi": "10.1038/s41557-023-01329-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8CWE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "20ns Temperature-Jump (Dark2) XFEL structure of Lysozyme Bound to N,N'-diacetylchitobiose" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 17.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8CWG", "evidence_id": "EV-PDB-8CWG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8CWG", "doi": "10.1038/s41557-023-01329-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8CWG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "200us Temperature-Jump (Dark1) XFEL structure of Lysozyme Bound to N,N'-diacetylchitobiose" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 17.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8CWH", "evidence_id": "EV-PDB-8CWH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8CWH", "doi": "10.1038/s41557-023-01329-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8CWH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "200us Temperature-Jump (Dark2) XFEL structure of Lysozyme Bound to N,N'-diacetylchitobiose" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D5S", "evidence_id": "EV-PDB-8D5S-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D5S", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D5S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D5T", "evidence_id": "EV-PDB-8D5T-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D5T", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D5T" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin (Duplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D5U", "evidence_id": "EV-PDB-8D5U-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.498 }, "provenance": { "deposit_id": "8D5U", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D5U" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin (Triplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D5W", "evidence_id": "EV-PDB-8D5W-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.499 }, "provenance": { "deposit_id": "8D5W", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D5W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 125 Kelvin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D5X", "evidence_id": "EV-PDB-8D5X-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D5X", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D5X" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 125 Kelvin (Duplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D5Z", "evidence_id": "EV-PDB-8D5Z-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D5Z", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D5Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 125 Kelvin (Triplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -123.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D60", "evidence_id": "EV-PDB-8D60-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D60", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D60" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 150 Kelvin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -123.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D61", "evidence_id": "EV-PDB-8D61-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D61", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D61" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 150 Kelvin (Duplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -123.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D62", "evidence_id": "EV-PDB-8D62-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D62", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D62" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 150 Kelvin (Triplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -98.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D69", "evidence_id": "EV-PDB-8D69-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D69", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D69" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 175 Kelvin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-alpha-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 17.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8CWF", "evidence_id": "EV-PDB-8CWF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8CWF", "doi": "10.1038/s41557-023-01329-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8CWF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "200us Temperature-Jump (Light) XFEL structure of Lysozyme Bound to N,N'-diacetylchitobiose" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 17.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8CW5", "evidence_id": "EV-PDB-8CW5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.57 }, "provenance": { "deposit_id": "8CW5", "doi": "10.1038/s41557-023-01329-4", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8CW5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "200us Temperature-Jump (Light) XFEL structure of Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1PE", "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "LYSOZYME, Chain A (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8CL5", "evidence_id": "EV-PDB-8CL5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.31 }, "provenance": { "deposit_id": "8CL5", "doi": "10.1038/s41467-023-43523-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8CL5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme in matrix of lipidic cubic phase of monoolein (LCP)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NO3", "T8K" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8C39", "evidence_id": "EV-PDB-8C39-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "8C39", "doi": "10.1021/acs.organomet.3c00128", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8C39" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of HEWL upon reaction with a Ruthenium(II)-arene Complexed with Glycosylated Carbene Ligands (5)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EPE", "NA", "R2I", "R2U" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8BPU", "evidence_id": "EV-PDB-8BPU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.81 }, "provenance": { "deposit_id": "8BPU", "doi": "10.1021/acs.inorgchem.2c04103", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8BPU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of Lysozyme with [Ru2Cl(D-p-FPhF)(O2CCH3)3] (Structure 2)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "DMS", "EPE", "R0I" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8BOV", "evidence_id": "EV-PDB-8BOV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "8BOV", "doi": "10.3390/ijms24032369", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8BOV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of the five-coordinate Pt(II) complex, 1-Me,Me, with HEWL at pH 7.5" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8B3V", "evidence_id": "EV-PDB-8B3V-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.74 }, "provenance": { "deposit_id": "8B3V", "doi": "10.1107/S2052252523001653", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8B3V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme 8s in situ crystallization" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8B3T", "evidence_id": "EV-PDB-8B3T-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.78 }, "provenance": { "deposit_id": "8B3T", "doi": "10.1107/S2052252523001653", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8B3T" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme 4s in situ crystallization" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8B3L", "evidence_id": "EV-PDB-8B3L-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.71 }, "provenance": { "deposit_id": "8B3L", "doi": "10.1107/S2052252523001653", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8B3L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme 2s in situ crystallization" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -98.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D6B", "evidence_id": "EV-PDB-8D6B-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D6B", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D6B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 175 Kelvin (Duplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -98.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D6I", "evidence_id": "EV-PDB-8D6I-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D6I", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D6I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 175 Kelvin (Triplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -73.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D75", "evidence_id": "EV-PDB-8D75-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D75", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D75" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 200 Kelvin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -73.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D77", "evidence_id": "EV-PDB-8D77-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D77", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D77" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 200 Kelvin (Duplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -73.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D7A", "evidence_id": "EV-PDB-8D7A-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D7A", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D7A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 200 Kelvin (Triplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -48.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D7B", "evidence_id": "EV-PDB-8D7B-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D7B", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D7B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 225 Kelvin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -48.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D7C", "evidence_id": "EV-PDB-8D7C-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D7C", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D7C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 225 Kelvin (Duplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -48.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D7D", "evidence_id": "EV-PDB-8D7D-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D7D", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D7D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 225 Kelvin (Triplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -23.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D7J", "evidence_id": "EV-PDB-8D7J-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D7J", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D7J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 250 Kelvin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -23.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D7L", "evidence_id": "EV-PDB-8D7L-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D7L", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D7L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 250 Kelvin (Duplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -23.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D7Q", "evidence_id": "EV-PDB-8D7Q-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D7Q", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D7Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 250 Kelvin (Triplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 1.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D7S", "evidence_id": "EV-PDB-8D7S-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D7S", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D7S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 275 Kelvin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 1.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D8A", "evidence_id": "EV-PDB-8D8A-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D8A", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D8A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 275 Kelvin (Duplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 1.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D8B", "evidence_id": "EV-PDB-8D8B-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D8B", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D8B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 275 Kelvin (Triplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D8C", "evidence_id": "EV-PDB-8D8C-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D8C", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D8C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 300 Kelvin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D8D", "evidence_id": "EV-PDB-8D8D-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D8D", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D8D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 300 Kelvin (Duplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D8E", "evidence_id": "EV-PDB-8D8E-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D8E", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D8E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 300 Kelvin (Triplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 51.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D8F", "evidence_id": "EV-PDB-8D8F-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D8F", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D8F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 325 Kelvin" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 51.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D8G", "evidence_id": "EV-PDB-8D8G-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D8G", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D8G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 325 Kelvin (Duplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 51.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8D8H", "evidence_id": "EV-PDB-8D8H-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8D8H", "doi": "10.1016/j.bpc.2023.107027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8D8H" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 325 Kelvin (Triplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BEN", "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8DCT", "evidence_id": "EV-PDB-8DCT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "8DCT", "doi": "10.1107/S2053230X22006422", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8DCT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme cluster 3 dual apo structure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BEN", "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8DCU", "evidence_id": "EV-PDB-8DCU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "8DCU", "doi": "10.1107/S2053230X22006422", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8DCU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme cluster 0028 (benzamidine ligand)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BEN", "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8DCV", "evidence_id": "EV-PDB-8DCV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "8DCV", "doi": "10.1107/S2053230X22006422", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8DCV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme cluster 0043, NAG ligand" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BEN", "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8DCW", "evidence_id": "EV-PDB-8DCW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "8DCW", "doi": "10.1107/S2053230X22006422", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8DCW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme cluster 0062 (NAG and benzamidine ligands)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8DYZ", "evidence_id": "EV-PDB-8DYZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.272 }, "provenance": { "deposit_id": "8DYZ", "doi": "10.1038/s41467-023-36734-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8DYZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen lysozyme in tetragonal space group at ambient temperature - diffuse scattering dataset" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8DZ7", "evidence_id": "EV-PDB-8DZ7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.34 }, "provenance": { "deposit_id": "8DZ7", "doi": "10.1038/s41467-023-36734-3", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8DZ7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen lysozyme in orthorhombic space group at ambient temperature - diffuse scattering dataset" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8E54", "evidence_id": "EV-PDB-8E54-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "8E54", "doi": "10.1016/j.jsb.2022.107886", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8E54" }, "reader": null, "source_kind": "deposit", "technique": "microed", "title": "MicroED structure of triclinic lysozyme recorded on K3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -53.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8EZO", "evidence_id": "EV-PDB-8EZO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "8EZO", "doi": "10.1107/S205979832300089X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8EZO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme Anomalous Dataset at 220 K and 7.1 keV" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -13.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8EZP", "evidence_id": "EV-PDB-8EZP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "8EZP", "doi": "10.1107/S205979832300089X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8EZP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme Anomalous Dataset at 260 K and 7.1 keV" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -0.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8EZU", "evidence_id": "EV-PDB-8EZU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.901 }, "provenance": { "deposit_id": "8EZU", "doi": "10.1107/S205979832300089X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8EZU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme Anomalous Dataset at 273 K and 7.1 keV" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8EZX", "evidence_id": "EV-PDB-8EZX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "8EZX", "doi": "10.1107/S205979832300089X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8EZX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme Anomalous Dataset at 293 K and 7.1 keV" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8F00", "evidence_id": "EV-PDB-8F00-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "8F00", "doi": "10.1107/S205979832300089X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8F00" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme Anomalous Dataset at 293 K and 12 keV" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -33.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8F0B", "evidence_id": "EV-PDB-8F0B-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "8F0B", "doi": "10.1107/S205979832300089X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8F0B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme Anomalous Dataset at 240 K and 7.1 keV" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8F28", "evidence_id": "EV-PDB-8F28-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "8F28", "doi": "10.1021/acs.analchem.3c00175", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8F28" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme Structures from Single-Entity Crystallization Method NanoAC" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8F2G", "evidence_id": "EV-PDB-8F2G-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.84 }, "provenance": { "deposit_id": "8F2G", "doi": "10.1107/S160057752300406X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8F2G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Hen Egg White Lysozyme at 0.44 GPa" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FP6", "evidence_id": "EV-PDB-8FP6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FP6", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FP6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FP7", "evidence_id": "EV-PDB-8FP7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FP7", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FP7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FP8", "evidence_id": "EV-PDB-8FP8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FP8", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FP8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FPB", "evidence_id": "EV-PDB-8FPB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FPB", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FPB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FPD", "evidence_id": "EV-PDB-8FPD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FPD", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FPD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FPM", "evidence_id": "EV-PDB-8FPM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FPM", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FPM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FPN", "evidence_id": "EV-PDB-8FPN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FPN", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FPN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FPP", "evidence_id": "EV-PDB-8FPP-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FPP", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FPP" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FPR", "evidence_id": "EV-PDB-8FPR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FPR", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FPR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FPU", "evidence_id": "EV-PDB-8FPU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FPU", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FPU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FS0", "evidence_id": "EV-PDB-8FS0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FS0", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FS0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FS9", "evidence_id": "EV-PDB-8FS9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FS9", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FS9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FSA", "evidence_id": "EV-PDB-8FSA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FSA", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FSA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FSC", "evidence_id": "EV-PDB-8FSC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FSC", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FSC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FRY", "evidence_id": "EV-PDB-8FRY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FRY", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FRY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FSF", "evidence_id": "EV-PDB-8FSF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FSF", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FSF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FSM", "evidence_id": "EV-PDB-8FSM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FSM", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FSM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FSN", "evidence_id": "EV-PDB-8FSN-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FSN", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FSN" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FST", "evidence_id": "EV-PDB-8FST-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FST", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FST" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FSV", "evidence_id": "EV-PDB-8FSV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FSV", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FSV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FSW", "evidence_id": "EV-PDB-8FSW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FSW", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FSW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FSX", "evidence_id": "EV-PDB-8FSX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FSX", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FSX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FSY", "evidence_id": "EV-PDB-8FSY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FSY", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FSY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FT1", "evidence_id": "EV-PDB-8FT1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FT1", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FT1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FT3", "evidence_id": "EV-PDB-8FT3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FT3", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FT3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8GMV", "evidence_id": "EV-PDB-8GMV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "8GMV", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8GMV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "1PE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains C)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8GQ1", "evidence_id": "EV-PDB-8GQ1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.13 }, "provenance": { "deposit_id": "8GQ1", "doi": "10.1002/pro.4745", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8GQ1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HyHEL10 Fab complexed with hen egg lysozyme carrying arginine cluster in framework region of light chain." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8H3W", "evidence_id": "EV-PDB-8H3W-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.39 }, "provenance": { "deposit_id": "8H3W", "doi": "10.1038/s41598-023-33989-0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8H3W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of chicken egg lysozyme at ambient temperature" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 26.35 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8H8T", "evidence_id": "EV-PDB-8H8T-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "8H8T", "doi": "10.1016/j.dib.2023.109811", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8H8T" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room-temperature structure of lysozyme by pink-beam serial crystallography (50 ms, edge)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 26.35 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8H8U", "evidence_id": "EV-PDB-8H8U-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "8H8U", "doi": "10.1016/j.dib.2023.109811", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8H8U" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room-temperature structure of lysozyme by pink-beam serial crystallography (50 ms, center)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 26.0 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8H8V", "evidence_id": "EV-PDB-8H8V-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "8H8V", "doi": "10.1016/j.dib.2023.109811", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8H8V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room-temperature structure of lysozyme by pink-beam serial crystallography (100 ms, edge)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8K8M", "evidence_id": "EV-PDB-8K8M-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8K8M", "doi": "10.1002/smll.202510977", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8K8M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystallographic structure of Lysozyme C from chicken" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8LYZ", "evidence_id": "EV-PDB-8LYZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "8LYZ", "doi": "10.1016/S0022-2836(75)80064-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8LYZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "AN X-RAY STUDY OF THE STRUCTURE AND BINDING PROPERTIES OF IODINE-INACTIVATED LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "VTU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8OMS", "evidence_id": "EV-PDB-8OMS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "8OMS", "doi": "10.1021/acs.inorgchem.3c01041", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8OMS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of lysozyme obtained upon reaction with [VIVO(empp)2] (Structure B)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EPE", "NA", "VTU", "VTZ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8OMT", "evidence_id": "EV-PDB-8OMT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.097 }, "provenance": { "deposit_id": "8OMT", "doi": "10.1021/acs.inorgchem.3c01041", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8OMT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of lysozyme obtained upon reaction with [VIVO(empp)2] (Structure C)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "7MT", "CL", "NA", "TB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8OWC", "evidence_id": "EV-PDB-8OWC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "8OWC", "doi": "10.1002/chem.202400900", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8OWC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Hen Egg White Lysozyme co-crystallized with 10 mM TbXo4" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8P1A", "evidence_id": "EV-PDB-8P1A-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.05 }, "provenance": { "deposit_id": "8P1A", "doi": "10.1107/S2052252523008618", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8P1A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme structure solved from serial crystallography data collected at 2 kHz for 5 seconds with JUNGFRAU detector at MAXIV" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8P1C", "evidence_id": "EV-PDB-8P1C-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.58 }, "provenance": { "deposit_id": "8P1C", "doi": "10.1107/S2052252523008618", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8P1C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme structure solved from serial crystallography data collected at 1 kHz with JUNGFRAU detector at MAXIV" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8P1D", "evidence_id": "EV-PDB-8P1D-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8P1D", "doi": "10.1107/S2052252523008618", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8P1D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme structure solved from serial crystallography data collected at 100 Hz with JUNGFRAU detector at MAXIV" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "WRT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8P2Q", "evidence_id": "EV-PDB-8P2Q-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.69 }, "provenance": { "deposit_id": "8P2Q", "doi": "10.1002/chem.202400900", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8P2Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Hen Egg White Lysozyme co-crystallized with 10 mM TbXo4-OH" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EPE", "FMT", "NA", "YJT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8PFX", "evidence_id": "EV-PDB-8PFX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.03 }, "provenance": { "deposit_id": "8PFX", "doi": "10.1039/D3QI01192E", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8PFX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of Lysozyme with K2[Ru2(D-p-FPhF)(CO3)3] in condition B" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EPE", "NA", "RU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8PFY", "evidence_id": "EV-PDB-8PFY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.19 }, "provenance": { "deposit_id": "8PFY", "doi": "10.1039/D3QI01192E", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8PFY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of Lysozyme with K2[Ru2(DAniF)(CO3)3] in condition B" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EPE", "ZJK" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8PH5", "evidence_id": "EV-PDB-8PH5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.29 }, "provenance": { "deposit_id": "8PH5", "doi": "10.1016/j.ijbiomac.2023.126666", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8PH5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of Lysozyme with [Ru2Cl(DPhF)2(O2CCH3)2] in condition B" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EPE", "YWV", "ZWL", "ZWO", "ZXE" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8PH6", "evidence_id": "EV-PDB-8PH6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.07 }, "provenance": { "deposit_id": "8PH6", "doi": "10.1016/j.ijbiomac.2023.126666", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8PH6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of Lysozyme with K2[Ru2(DPhF)(CO3)3] in condition B" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "TB", "ZHT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8PIW", "evidence_id": "EV-PDB-8PIW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.72 }, "provenance": { "deposit_id": "8PIW", "doi": "10.1002/chem.202400900", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8PIW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Hen Egg White Lysozyme co-crystallized with 10 mM TbXo4-NMet2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "TB", "ZW0" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8POB", "evidence_id": "EV-PDB-8POB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.74 }, "provenance": { "deposit_id": "8POB", "doi": "10.1002/chem.202400900", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8POB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Hen Egg White Lysozyme co-crystallized with 10 mM TbXo4-SO3" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "BR", "CL", "IMD", "NA", "RE", "REI", "VHL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8QCU", "evidence_id": "EV-PDB-8QCU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.15 }, "provenance": { "deposit_id": "8QCU", "doi": "10.1107/S2052252524002598", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8QCU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme covalently bound to fac-[Re(CO)3-imidazole] complex, incubated for 38 weeks." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A,C,E,G,I)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8QV8", "evidence_id": "EV-PDB-8QV8-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as an amyloid fibril; a fibril entry shows the cross-beta fibril fold, not the native fold. Polymorphs are pooled.", "rule": "hewl-fibril-structures", "state_id": "HEWL-fibril", "who": "rule:hewl-fibril-structures" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.26 }, "provenance": { "deposit_id": "8QV8", "doi": "10.1038/s41467-024-52681-z", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8QV8" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of the heat-irreversible amyloid fibrils of hen egg-white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "H1W", "JQJ", "NA", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8PTE", "evidence_id": "EV-PDB-8PTE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.797 }, "provenance": { "deposit_id": "8PTE", "doi": "10.1002/anie.202310655", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8PTE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Polyoxidovanadate interaction with proteins: crystal structure of lysozyme bound to octadecavanadate ion (structure B)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "SIN", "ZJO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8PH8", "evidence_id": "EV-PDB-8PH8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.29 }, "provenance": { "deposit_id": "8PH8", "doi": "10.1016/j.ijbiomac.2023.126666", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8PH8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of Lysozyme with [Ru2Cl(DPhF)2(O2CCH3)2] in condition A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "SIN", "ZQ2", "ZWH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8PH7", "evidence_id": "EV-PDB-8PH7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.406 }, "provenance": { "deposit_id": "8PH7", "doi": "10.1016/j.ijbiomac.2023.126666", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8PH7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of Lysozyme with [Ru2Cl(DPhF)(O2CCH3)3] in condition A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NO3", "YWR" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8PFW", "evidence_id": "EV-PDB-8PFW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.12 }, "provenance": { "deposit_id": "8PFW", "doi": "10.1039/D3QI01192E", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8PFW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of Lysozyme with K2[Ru2(DAniF)(CO3)3] in condition A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NO3", "YMQ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8PFV", "evidence_id": "EV-PDB-8PFV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.46 }, "provenance": { "deposit_id": "8PFV", "doi": "10.1039/D3QI01192E", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8PFV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of Lysozyme with [Ru2Cl(DAniF)(O2CCH3)3] in condition A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CO3", "NA", "NO3", "YJT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8PFU", "evidence_id": "EV-PDB-8PFU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.18 }, "provenance": { "deposit_id": "8PFU", "doi": "10.1039/D3QI01192E", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8PFU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of Lysozyme with K3[Ru2(CO3)4] in condition A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NO3", "YJT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8PFT", "evidence_id": "EV-PDB-8PFT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.304 }, "provenance": { "deposit_id": "8PFT", "doi": "10.1039/D3QI01192E", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8PFT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of Lysozyme with K2[Ru2(D-p-FPhF)(CO3)3] in condition A" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8P1B", "evidence_id": "EV-PDB-8P1B-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "8P1B", "doi": "10.1107/S2052252523008618", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8P1B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme structure solved from serial crystallography data collected at 2 kHz with JUNGFRAU detector at MAXIV" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA", "VSU", "VTZ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8OM8", "evidence_id": "EV-PDB-8OM8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.08 }, "provenance": { "deposit_id": "8OM8", "doi": "10.1021/acs.inorgchem.3c01041", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8OM8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of lysozyme obtained upon reaction with [VIVO(empp)2] (Structure A)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8JQV", "evidence_id": "EV-PDB-8JQV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.83 }, "provenance": { "deposit_id": "8JQV", "doi": "10.3390/photonics11010095", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8JQV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme solved from 1D fixed target delivery system" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 26.0 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8H8W", "evidence_id": "EV-PDB-8H8W-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "8H8W", "doi": "10.1016/j.dib.2023.109811", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8H8W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room-temperature structure of lysozyme by pink-beam serial crystallography (100 ms, center)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8GMW", "evidence_id": "EV-PDB-8GMW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.35 }, "provenance": { "deposit_id": "8GMW", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8GMW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FT2", "evidence_id": "EV-PDB-8FT2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FT2", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FT2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FT0", "evidence_id": "EV-PDB-8FT0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FT0", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FT0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FSU", "evidence_id": "EV-PDB-8FSU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FSU", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FSU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FSH", "evidence_id": "EV-PDB-8FSH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FSH", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FSH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -148.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8FSG", "evidence_id": "EV-PDB-8FSG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8FSG", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8FSG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8REG", "evidence_id": "EV-PDB-8REG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "8REG", "doi": "10.1016/j.xcrp.2024.101987", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8REG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme measured via serial crystallography from a kapton HARE-chip (50 micron)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8RLF", "evidence_id": "EV-PDB-8RLF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.96 }, "provenance": { "deposit_id": "8RLF", "doi": "10.1016/j.str.2024.10.030", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8RLF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hydrogenated hen egg-white lysozyme at room temperature" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8RLH", "evidence_id": "EV-PDB-8RLH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "8RLH", "doi": "10.1016/j.str.2024.10.030", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8RLH" }, "reader": null, "source_kind": "deposit", "technique": "neutron", "title": "Neutron structure of hydrogenated hen egg-white lysozyme at room temperature" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8RLI", "evidence_id": "EV-PDB-8RLI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.91 }, "provenance": { "deposit_id": "8RLI", "doi": "10.1016/j.str.2024.10.030", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8RLI" }, "reader": null, "source_kind": "deposit", "technique": "neutron", "title": "Neutron structure of perdeuterated hen egg-white lysozyme at room temperature" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "EDO", "NA", "RU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8RNV", "evidence_id": "EV-PDB-8RNV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.08 }, "provenance": { "deposit_id": "8RNV", "doi": "10.3389/fchem.2024.1371637", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8RNV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme soaked with cis-Ru(DMSO)4Cl2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA", "RU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8RNW", "evidence_id": "EV-PDB-8RNW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.12 }, "provenance": { "deposit_id": "8RNW", "doi": "10.3389/fchem.2024.1371637", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8RNW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme soaked with trans-Ru(DMSO)4Cl2" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8RSH", "evidence_id": "EV-PDB-8RSH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "8RSH", "doi": "10.1016/j.xcrp.2024.101987", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8RSH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme measured via serial crystallography from a silicon HARE chip" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "I3Y", "NA", "NO3", "V" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8RTJ", "evidence_id": "EV-PDB-8RTJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.27 }, "provenance": { "deposit_id": "8RTJ", "doi": "10.1002/chem.202401712", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8RTJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of lysozyme obtained upon reaction with [VIVO(8-HQ)2] in ethylene glycol" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1H23", "EPE", "VVB", "VVO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8RTK", "evidence_id": "EV-PDB-8RTK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.21 }, "provenance": { "deposit_id": "8RTK", "doi": "10.1002/chem.202401712", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8RTK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of lysozyme obtained upon reaction with [VIVO(8-HQ)2] in sodium formate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA", "PEG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8RUS", "evidence_id": "EV-PDB-8RUS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.38 }, "provenance": { "deposit_id": "8RUS", "doi": "10.1063/4.0000248", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8RUS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme (HEWL) structure from EuXFEL FXE, multi-hit Droplet-on-Demand (DoD) injection, 9.3 keV photon energy, space group P432121" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8S2U", "evidence_id": "EV-PDB-8S2U-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "8S2U", "doi": "10.1107/S2052252524001799", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8S2U" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SSX structure of Lysozyme grown in batch conditions" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SCY", "evidence_id": "EV-PDB-8SCY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "8SCY", "doi": "10.1107/S2059798323007027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SCY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme crystallized in cyclic olefin copolymer-based microfluidic chips" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8SIL", "evidence_id": "EV-PDB-8SIL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "8SIL", "doi": "10.1107/S2059798323007027", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8SIL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme crystallized in cyclic olefin copolymer-based microfluidic chips" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8WDI", "evidence_id": "EV-PDB-8WDI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "8WDI", "doi": "10.3390/cryst13111544", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8WDI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of lysozyme by fixed-target pink-beam serial synchrotron crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "XTX" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8WZF", "evidence_id": "EV-PDB-8WZF-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8WZF", "doi": "10.1038/s41467-024-49814-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8WZF" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Dark state SFX structure of hen egg white lysozyme microcrystals immobilized with a Mn carbonyl complex at RT." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "XTX" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8WZG", "evidence_id": "EV-PDB-8WZG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8WZG", "doi": "10.1038/s41467-024-49814-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8WZG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SFX structure of an Mn-carbonyl complex immobilized in hen egg white lysozyme microcrystals, 10 ns after photoexcitation at RT." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "XTX" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8WZR", "evidence_id": "EV-PDB-8WZR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8WZR", "doi": "10.1038/s41467-024-49814-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8WZR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SFX structure of an Mn-carbonyl complex immobilized in hen egg white lysozyme microcrystals, 100 ns after photoexcitation at RT." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "XTX" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8WZT", "evidence_id": "EV-PDB-8WZT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8WZT", "doi": "10.1038/s41467-024-49814-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8WZT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SFX structure of an Mn-carbonyl complex immobilized in hen egg white lysozyme microcrystals, 1 microsecond after photoexcitation at RT." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "XTX" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8WZV", "evidence_id": "EV-PDB-8WZV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "8WZV", "doi": "10.1038/s41467-024-49814-9", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8WZV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SFX structure of an Mn-carbonyl complex immobilized in hen egg white lysozyme microcrystals, 1 microsecond after photoexcitation with 40 microJoules laser intensity at RT." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8Y1R", "evidence_id": "EV-PDB-8Y1R-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "8Y1R", "doi": "10.1107/S1600576725005023", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8Y1R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "in situ room temperature Laue crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8Y9W", "evidence_id": "EV-PDB-8Y9W-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "8Y9W", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8Y9W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "CRYSTAL STRUCTURE OF A LYSOZYME FROM HEN EGG WHITE" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8YA4", "evidence_id": "EV-PDB-8YA4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "8YA4", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8YA4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of a lysozyme form hen egg white" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 25.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8YBG", "evidence_id": "EV-PDB-8YBG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "8YBG", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8YBG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of lysozyme by serial synchrotron crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8YBH", "evidence_id": "EV-PDB-8YBH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "8YBH", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8YBH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of lysozyme by macromolecular crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "34G" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8Z51", "evidence_id": "EV-PDB-8Z51-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "8Z51", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8Z51" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg-White Lysozyme (HEWL) complexed with Emetine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "TEP" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8Z52", "evidence_id": "EV-PDB-8Z52-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.48 }, "provenance": { "deposit_id": "8Z52", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8Z52" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg-White Lysozyme (HEWL) complexed with Theophylline" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DO3", "GD", "NA", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8ZST", "evidence_id": "EV-PDB-8ZST-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.8 }, "provenance": { "deposit_id": "8ZST", "doi": "10.1038/s41526-025-00477-w", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8ZST" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme Crystallized with Bioassembler on Earth" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL", "IOD", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9B7C", "evidence_id": "EV-PDB-9B7C-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.1 }, "provenance": { "deposit_id": "9B7C", "doi": "10.1126/sciadv.adj2921", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9B7C" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "high-resolution ambient temperature structure of lysozyme soaked with sodium iodide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9B7F", "evidence_id": "EV-PDB-9B7F-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "9B7F", "doi": "10.1107/S160057752400359X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9B7F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "S_SAD structure of HEWL using lossless default compression" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1AVD", "ACY", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.7, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9C9H", "evidence_id": "EV-PDB-9C9H-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "9C9H", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9C9H" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Interaction of chlorido(8-aminoquinoline)(pentamethylcyclopentadiene)rhodium(III) with HEWL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "NH3", "NO3", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9ENZ", "evidence_id": "EV-PDB-9ENZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "9ENZ", "doi": "10.1039/d4dt00773e", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9ENZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of picoplatin with lysozyme (structure A)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "GOL", "NO3", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9EO2", "evidence_id": "EV-PDB-9EO2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.36 }, "provenance": { "deposit_id": "9EO2", "doi": "10.1039/d4dt00773e", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9EO2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of picoplatin with lysozyme (structure B)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9EVU", "evidence_id": "EV-PDB-9EVU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "9EVU", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9EVU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEN EGG-WHITE Lysozyme incubated at 99% relative humidity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1ICR", "CL", "NA", "VO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9EX0", "evidence_id": "EV-PDB-9EX0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "9EX0", "doi": "10.1002/anie.202406669", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9EX0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of a polyoxidovanadate/lysozyme adduct obtained when the protein is treated with [VIVO(acac)2] in 1.1 M NaCl, 0.1 M sodium acetate at pH 4.0 (Structure A)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1H8D", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9EX1", "evidence_id": "EV-PDB-9EX1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.785 }, "provenance": { "deposit_id": "9EX1", "doi": "10.1002/anie.202406669", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9EX1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of a polyoxidovanadate/lysozyme adduct obtained when the protein is treated with [VIVO(acac)2] in 1.1 M NaCl, 0.1 M sodium acetate at pH 4.0 (Structure B)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1H8D", "CL", "NA", "VO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9EX2", "evidence_id": "EV-PDB-9EX2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.172 }, "provenance": { "deposit_id": "9EX2", "doi": "10.1002/anie.202406669", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9EX2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of a polyoxidovanadate/lysozyme adduct obtained when the protein is treated with [VIVO(acac)2] in 1.1 M NaCl, 0.1 M sodium acetate at pH 4.0 (Structure C)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "PEG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9FA5", "evidence_id": "EV-PDB-9FA5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "9FA5", "doi": "10.1021/acs.analchem.4c03484", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9FA5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme structure at room temperature by serial synchrotron crystallography with COC chips" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9FC3", "evidence_id": "EV-PDB-9FC3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "9FC3", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9FC3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEN EGG-WHITE Lysozyme incubated at 99% relative humidity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9B7E", "evidence_id": "EV-PDB-9B7E-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "9B7E", "doi": "10.1107/S160057752400359X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9B7E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "S_SAD structure of HEWL using lossy compression data with a compression ratio of 422" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "DO3", "GD", "NA", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.8, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8ZSU", "evidence_id": "EV-PDB-8ZSU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.09 }, "provenance": { "deposit_id": "8ZSU", "doi": "10.1038/s41526-025-00477-w", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8ZSU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme Crystallized with Bioassembler in Space Microgravity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8YA1", "evidence_id": "EV-PDB-8YA1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.57 }, "provenance": { "deposit_id": "8YA1", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8YA1" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEN EGG WHITE LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8Y1S", "evidence_id": "EV-PDB-8Y1S-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.52 }, "provenance": { "deposit_id": "8Y1S", "doi": "doi.org/10.1107/S1600576725005023", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8Y1S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "in situ room temperature Laue crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8W6K", "evidence_id": "EV-PDB-8W6K-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "8W6K", "doi": "10.1007/s41365-024-01475-5", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8W6K" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "in situ room temperature Laue crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8S2V", "evidence_id": "EV-PDB-8S2V-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "8S2V", "doi": "10.1107/S2052252524001799", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8S2V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SSX structure of Lysozyme grown in microfluidic droplets" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8RPM", "evidence_id": "EV-PDB-8RPM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "8RPM", "doi": "10.1107/S2052252524011837", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8RPM" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme structure based on automated real-time serial crystallography data processing using CrystFEL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA", "RU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8RNY", "evidence_id": "EV-PDB-8RNY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.02 }, "provenance": { "deposit_id": "8RNY", "doi": "10.3389/fchem.2024.1371637", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8RNY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme soaked with with [H2Ind][trans-RuCl4(DMSO)(HInd)]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA", "RU" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8RNX", "evidence_id": "EV-PDB-8RNX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.25 }, "provenance": { "deposit_id": "8RNX", "doi": "10.3389/fchem.2024.1371637", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8RNX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme soaked with [HIsq][trans-RuCl4(DMSO)(Isq)]" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "NO3" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8RLG", "evidence_id": "EV-PDB-8RLG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.07 }, "provenance": { "deposit_id": "8RLG", "doi": "10.1016/j.str.2024.10.030", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8RLG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Perdeuterated hen egg-white lysozyme at room temperature" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8RGE", "evidence_id": "EV-PDB-8RGE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.88 }, "provenance": { "deposit_id": "8RGE", "doi": "10.1107/S2059798324001955", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8RGE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Serial synchrotron in plate room temperature structure of Lysozyme." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/8REH", "evidence_id": "EV-PDB-8REH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "8REH", "doi": "10.1016/j.xcrp.2024.101987", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/8REH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme measured via serial crystallography from a kapton HARE-chip (125 micron)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9FC4", "evidence_id": "EV-PDB-9FC4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "9FC4", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9FC4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEN EGG-WHITE Lysozyme incubated at 94% relative humidity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9FC5", "evidence_id": "EV-PDB-9FC5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "9FC5", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9FC5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEN EGG-WHITE Lysozyme incubated at 99% relative humidity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9FC6", "evidence_id": "EV-PDB-9FC6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "9FC6", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9FC6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEN EGG-WHITE Lysozyme incubated at 87% relative humidity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9FC7", "evidence_id": "EV-PDB-9FC7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "9FC7", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9FC7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEN EGG-WHITE Lysozyme incubated at 99% relative humidity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9FC8", "evidence_id": "EV-PDB-9FC8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "9FC8", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9FC8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEN EGG-WHITE Lysozyme incubated at 60% relative humidity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9FC9", "evidence_id": "EV-PDB-9FC9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "9FC9", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9FC9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEN EGG-WHITE Lysozyme incubated at 50% relative humidity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9FCA", "evidence_id": "EV-PDB-9FCA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "9FCA", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9FCA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEN EGG-WHITE Lysozyme incubated at 40% relative humidity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9FCB", "evidence_id": "EV-PDB-9FCB-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "9FCB", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9FCB" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEN EGG-WHITE Lysozyme incubated at 34% relative humidity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9FCC", "evidence_id": "EV-PDB-9FCC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "9FCC", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9FCC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEN EGG-WHITE Lysozyme incubated at 80% relative humidity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains D,F)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9FGX", "evidence_id": "EV-PDB-9FGX-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.53 }, "provenance": { "deposit_id": "9FGX", "doi": "10.1038/s41589-025-01972-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9FGX" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of Lysozyme homo-dimer assembled by homo Di-Gluebody" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1IE3", "A1IE4", "CL", "NA", "VVB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9FMY", "evidence_id": "EV-PDB-9FMY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.09 }, "provenance": { "deposit_id": "9FMY", "doi": "10.1039/D4QI01528B", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9FMY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct of bis(maltolato)oxidovanadium(IV) with lysozyme upon the breakage of the maltolate ring" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1IMF", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9GI7", "evidence_id": "EV-PDB-9GI7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.76 }, "provenance": { "deposit_id": "9GI7", "doi": "10.1002/anie.202423078", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9GI7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg-White Lysozyme (HEWL) complexed with a Lindqvist-type hexavanadate (V6-OH) polyoxometalate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1IOM", "ACT", "CL", "NA", "VVB" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9GOG", "evidence_id": "EV-PDB-9GOG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.24 }, "provenance": { "deposit_id": "9GOG", "doi": "10.1016/j.jinorgbio.2024.112787", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9GOG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of lysozyme obtained upon reaction with the dioxidovanadium(V) complex with furan-2-carboxylic acid (3-ethoxy-2-hydroxybenzylidene)hydrazide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1ION", "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9GOK", "evidence_id": "EV-PDB-9GOK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.18 }, "provenance": { "deposit_id": "9GOK", "doi": "10.1016/j.jinorgbio.2024.112787", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9GOK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of lysozyme obtained upon reaction with the dioxidovanadium(V) complex with (E)-N'-(1-(2-hydroxy-5-methoxyphenyl)ethylidene)furan-2-carbohydrazide)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9H3E", "evidence_id": "EV-PDB-9H3E-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "9H3E", "doi": "10.1002/2211-5463.13932", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9H3E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg white lysozyme crystallization and structure determination at room temperature in the CrystalChip" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1ISW", "CL", "EDO", "IMD", "NA", "PEG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9H7W", "evidence_id": "EV-PDB-9H7W-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.13 }, "provenance": { "deposit_id": "9H7W", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9H7W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg White Lysozyme in Complex with Imidizole" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "EDO", "GTQ" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9HC2", "evidence_id": "EV-PDB-9HC2-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.27 }, "provenance": { "deposit_id": "9HC2", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9HC2" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of Lysozyme in complex with Gentisic Acid" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "IOD", "NH3", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9HLK", "evidence_id": "EV-PDB-9HLK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.96 }, "provenance": { "deposit_id": "9HLK", "doi": "10.1021/acs.inorgchem.4c05424", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9HLK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of the diiodido analogue of picoplatin with lysozyme (structure A)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "IOD", "NH3", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9HMQ", "evidence_id": "EV-PDB-9HMQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.25 }, "provenance": { "deposit_id": "9HMQ", "doi": "10.1021/acs.inorgchem.4c05424", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9HMQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-structure of the adduct formed upon reaction of the diiodido analogue of picoplatin with lysozyme (structure C)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1IXG", "MES", "SO4" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 6.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9HRU", "evidence_id": "EV-PDB-9HRU-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.88 }, "provenance": { "deposit_id": "9HRU", "doi": "10.1021/jacs.5c08121", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9HRU" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "The Lysozyme - pctx complex in space group P3121" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1IXJ", "ACT", "CL", "DMS", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9HTI", "evidence_id": "EV-PDB-9HTI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.17 }, "provenance": { "deposit_id": "9HTI", "doi": "10.1039/d5sc05555e", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9HTI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Adduct formed during the incubation of dichloro(3-benzylbenzoselenazol-2-ylidene)(eta6-p-cymene)ruthenium(II) with HEWL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1IXK", "ACT", "CL", "DMS", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9HTJ", "evidence_id": "EV-PDB-9HTJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.49 }, "provenance": { "deposit_id": "9HTJ", "doi": "10.1039/d5sc05555e", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9HTJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Adduct formed during the incubation of dichloro(3-benzylbenzothiazol-2-ylidene)(eta6-p-cymene)ruthenium(II) with HEWL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 23.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9I6K", "evidence_id": "EV-PDB-9I6K-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "9I6K", "doi": "10.1038/s41598-025-25449-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9I6K" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme structure at 85% relative humidity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 23.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9I6N", "evidence_id": "EV-PDB-9I6N-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "9I6N", "doi": "10.1038/s41598-025-25449-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9I6N" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme structure collected at EuXFEL SPB/SFX with HVE injection method" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": 23.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9I6P", "evidence_id": "EV-PDB-9I6P-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "9I6P", "doi": "10.1038/s41598-025-25449-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9I6P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme structure embedded in LCP medium at 85% relative humidity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1H8D", "A1ICR", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": 36.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9I8L", "evidence_id": "EV-PDB-9I8L-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.831 }, "provenance": { "deposit_id": "9I8L", "doi": "10.1002/chem.202500488", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9I8L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of a polyoxidovanadate/lysozyme adduct obtained when the protein is treated with [VIVO(acac)2] at 310 K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9IG6", "evidence_id": "EV-PDB-9IG6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.8 }, "provenance": { "deposit_id": "9IG6", "doi": "10.1107/S2059798325011258", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9IG6" }, "reader": null, "source_kind": "deposit", "technique": "microed", "title": "Hen egg-white lysozyme structure determined by 3DED/MicroED on a 200 keV microscope" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9J0M", "evidence_id": "EV-PDB-9J0M-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as an amyloid fibril; a fibril entry shows the cross-beta fibril fold, not the native fold. Polymorphs are pooled.", "rule": "hewl-fibril-structures", "state_id": "HEWL-fibril", "who": "rule:hewl-fibril-structures" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.21 }, "provenance": { "deposit_id": "9J0M", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9J0M" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM Structure of Lysozyme Type 2 Amyloid Fibrils" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 25.35 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9K9Z", "evidence_id": "EV-PDB-9K9Z-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "9K9Z", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9K9Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room-temperature structure of lysozyme determined by serial synchrotron crystallography (MOSFLM)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9KJ7", "evidence_id": "EV-PDB-9KJ7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "9KJ7", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9KJ7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Real-space refinement for the hen egg-white lysozyme structure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9L71", "evidence_id": "EV-PDB-9L71-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "9L71", "doi": "10.1080/07391102.2025.2475230", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9L71" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL crystal soaked in buffer of pH12.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 25.35 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9L9R", "evidence_id": "EV-PDB-9L9R-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.45 }, "provenance": { "deposit_id": "9L9R", "doi": "10.3390/cryst15020104", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9L9R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room-temperature structure of lysozyme determined by serial synchrotron crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9LMK", "evidence_id": "EV-PDB-9LMK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "9LMK", "doi": "10.3390/cryst15020185", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9LMK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature structure of lysozyme by serial synchrotron crystallography (XDS)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "branched: N-acetyl-beta-muramic acid-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-N-acetyl-beta-muramic acid" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "HEN EGG WHITE LYSOZYME (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9LYZ", "evidence_id": "EV-PDB-9LYZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.5 }, "provenance": { "deposit_id": "9LYZ", "doi": "10.1038/282875a0", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9LYZ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-RAY CRYSTALLOGRAPHY OF THE BINDING OF THE BACTERIAL CELL WALL TRISACCHARIDE NAM-NAG-NAM TO LYSOZYME" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9LML", "evidence_id": "EV-PDB-9LML-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "9LML", "doi": "10.3390/cryst15020185", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9LML" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature structure of lysozyme by serial synchrotron crystallography (MOSFLM)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains P)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9L1L", "evidence_id": "EV-PDB-9L1L-5", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.09 }, "provenance": { "deposit_id": "9L1L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9L1L" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Structure of anti-HEL AiTab" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9KOT", "evidence_id": "EV-PDB-9KOT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "9KOT", "doi": "10.1080/07391102.2025.2475230", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9KOT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEWL crystal soaked in buffer of pH2.0" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 25.35 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9KA0", "evidence_id": "EV-PDB-9KA0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "9KA0", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9KA0" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room-temperature structure of lysozyme determined by serial synchrotron crystallography (XGANDALF)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9J0L", "evidence_id": "EV-PDB-9J0L-1", "mappings": [ { "confidence": "medium", "justification": "Structure titled as an amyloid fibril; a fibril entry shows the cross-beta fibril fold, not the native fold. Polymorphs are pooled.", "rule": "hewl-fibril-structures", "state_id": "HEWL-fibril", "who": "rule:hewl-fibril-structures" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.29 }, "provenance": { "deposit_id": "9J0L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9J0L" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM Structure of Lysozyme Type 1 Amyloid Fibrils" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 23.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9I6O", "evidence_id": "EV-PDB-9I6O-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "9I6O", "doi": "10.1038/s41598-025-25449-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9I6O" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme structure embedded in LCP medium at 95% relative humidity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 23.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9I6M", "evidence_id": "EV-PDB-9I6M-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "9I6M", "doi": "10.1038/s41598-025-25449-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9I6M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme structure at 65% relative humidity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 23.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9I6L", "evidence_id": "EV-PDB-9I6L-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "9I6L", "doi": "10.1038/s41598-025-25449-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9I6L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme structure at 75% relative humidity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "EDO", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 23.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9I6J", "evidence_id": "EV-PDB-9I6J-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "9I6J", "doi": "10.1038/s41598-025-25449-8", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9I6J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme structure embedded in LCP medium at 95% relative humidity" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "IOD", "PT" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9HMK", "evidence_id": "EV-PDB-9HMK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.48 }, "provenance": { "deposit_id": "9HMK", "doi": "10.1021/acs.inorgchem.4c05424", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9HMK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of the diiodido analogue of picoplatin with lysozyme (structure B)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A,B)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9GYH", "evidence_id": "EV-PDB-9GYH-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "9GYH", "doi": "10.1107/S2053230X2500010X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9GYH" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "HEW Lysozyme with His 15 functionalized with iodoacetamide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "IMD", "NA", "RE", "REI", "VHL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 37.0 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9GHX", "evidence_id": "EV-PDB-9GHX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.19 }, "provenance": { "deposit_id": "9GHX", "doi": "10.1039/d4cc04245j", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9GHX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme covalently bound to fac-[Re(CO)3-imidazole] complex, incubated for 112 weeks. Data collection done at mammalian body temperature." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -193.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9GCV", "evidence_id": "EV-PDB-9GCV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.703 }, "provenance": { "deposit_id": "9GCV", "doi": "10.1107/S2059798324008659", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9GCV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Identification of chloride ions in lysozyme at long wavelengths" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9FUE", "evidence_id": "EV-PDB-9FUE-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.05 }, "provenance": { "deposit_id": "9FUE", "doi": "10.1038/s42004-024-01404-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9FUE" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Serial microseconds crystallography at ID29 using fixed-target (Si Chip): Lysozyme - with ligand GlcNAc" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9FUD", "evidence_id": "EV-PDB-9FUD-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.05 }, "provenance": { "deposit_id": "9FUD", "doi": "10.1038/s42004-024-01404-y", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9FUD" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Serial microseconds crystallography at ID29 using fixed-target (Si Chip): Lysozyme - without ligand GlcNAc (apo)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "GOL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains D)", "labels": [] }, "data_format": "mmCIF + EMDB map", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9FGY", "evidence_id": "EV-PDB-9FGY-2", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 3.16 }, "provenance": { "deposit_id": "9FGY", "doi": "10.1038/s41589-025-01972-7", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9FGY" }, "reader": null, "source_kind": "deposit", "technique": "cryoem", "title": "Cryo-EM structure of Lysozyme homo-dimer assembled by homo Di-Gluebody - Local refinement" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9MP3", "evidence_id": "EV-PDB-9MP3-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "9MP3", "doi": "10.1107/S205225252500288X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9MP3" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mix & Quench Time Resolved Lysozyme - NAG1 Complex (0 ms)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9MP4", "evidence_id": "EV-PDB-9MP4-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.82 }, "provenance": { "deposit_id": "9MP4", "doi": "10.1107/S205225252500288X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9MP4" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mix & Quench Time Resolved Lysozyme - NAG1 Complex (8 ms)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9MP9", "evidence_id": "EV-PDB-9MP9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.9 }, "provenance": { "deposit_id": "9MP9", "doi": "10.1107/S205225252500288X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9MP9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mix & Quench Time Resolved Lysozyme - NAG1 Complex (1000 ms)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9MPA", "evidence_id": "EV-PDB-9MPA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "9MPA", "doi": "10.1107/S205225252500288X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9MPA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mix & Quench Time Resolved Lysozyme - NAG1 Complex (2000 ms)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9ORV", "evidence_id": "EV-PDB-9ORV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.6 }, "provenance": { "deposit_id": "9ORV", "doi": "10.1073/pnas.2503780122", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9ORV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray diffraction structure of lysozyme co-crystallized with N,N',N\"-triacetylchitotriose" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9ORW", "evidence_id": "EV-PDB-9ORW-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "9ORW", "doi": "10.1073/pnas.2503780122", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9ORW" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray diffraction structure of apo-form lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9ORX", "evidence_id": "EV-PDB-9ORX-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "9ORX", "doi": "10.1073/pnas.2503780122", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9ORX" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray diffraction structure of lysozyme complexed with N,N',N\"-triacetylchitotriose from a cocktail-soaked crystal" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9ORY", "evidence_id": "EV-PDB-9ORY-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "9ORY", "doi": "10.1073/pnas.2503780122", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9ORY" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray diffraction structure of lysozyme soaked with N,N',N\"-triacetylchitotriose" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9ORZ", "evidence_id": "EV-PDB-9ORZ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "9ORZ", "doi": "10.1073/pnas.2503780122", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9ORZ" }, "reader": null, "source_kind": "deposit", "technique": "microed", "title": "MicroED structure of apo-form lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9OS0", "evidence_id": "EV-PDB-9OS0-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.4 }, "provenance": { "deposit_id": "9OS0", "doi": "10.1073/pnas.2503780122", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9OS0" }, "reader": null, "source_kind": "deposit", "technique": "microed", "title": "MicroED structure of lysozyme complexed with N,N',N\"-triacetylchitotriose from cocktail-soaked crystals" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9OS1", "evidence_id": "EV-PDB-9OS1-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "9OS1", "doi": "10.1073/pnas.2503780122", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9OS1" }, "reader": null, "source_kind": "deposit", "technique": "microed", "title": "MicroED structure of lysozyme co-crystallized with N,N',N\"-triacetylchitotriose" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 20.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9OZ5", "evidence_id": "EV-PDB-9OZ5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.3 }, "provenance": { "deposit_id": "9OZ5", "doi": "10.1107/S2053230X25008398", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9OZ5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Gradient equilibration of tetragonal lysozyme from 8% NaCl to 3% NaCl over 40 minutes" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P0Y", "evidence_id": "EV-PDB-9P0Y-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.499 }, "provenance": { "deposit_id": "9P0Y", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P0Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin with Apiezon N" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P0Z", "evidence_id": "EV-PDB-9P0Z-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.499 }, "provenance": { "deposit_id": "9P0Z", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P0Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin with Apiezon N (Duplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P10", "evidence_id": "EV-PDB-9P10-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.496 }, "provenance": { "deposit_id": "9P10", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P10" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin with Apiezon N (Triplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P12", "evidence_id": "EV-PDB-9P12-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.57 }, "provenance": { "deposit_id": "9P12", "doi": "10.1101/2025.06.12.659325", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P12" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme Room-Temperature In-Situ, Shipped" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P13", "evidence_id": "EV-PDB-9P13-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.73 }, "provenance": { "deposit_id": "9P13", "doi": "10.1101/2025.06.12.659325", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P13" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme Room-Temperature In-Situ, Grown On-Site" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P1W", "evidence_id": "EV-PDB-9P1W-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.497 }, "provenance": { "deposit_id": "9P1W", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P1W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin with Lard (Triplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P56", "evidence_id": "EV-PDB-9P56-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.497 }, "provenance": { "deposit_id": "9P56", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P56" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin with Apiezon T" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P57", "evidence_id": "EV-PDB-9P57-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.497 }, "provenance": { "deposit_id": "9P57", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P57" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin with Apiezon T (Duplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P58", "evidence_id": "EV-PDB-9P58-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.492 }, "provenance": { "deposit_id": "9P58", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P58" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin with Apiezon T (Triplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P59", "evidence_id": "EV-PDB-9P59-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.498 }, "provenance": { "deposit_id": "9P59", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P59" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin with Glycerol 30%" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P5A", "evidence_id": "EV-PDB-9P5A-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.498 }, "provenance": { "deposit_id": "9P5A", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P5A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin with Glycerol 30% (Duplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P5D", "evidence_id": "EV-PDB-9P5D-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.498 }, "provenance": { "deposit_id": "9P5D", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P5D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin with Lard (Duplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P5E", "evidence_id": "EV-PDB-9P5E-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.498 }, "provenance": { "deposit_id": "9P5E", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P5E" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin with Glycerol 30% (Triplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P5F", "evidence_id": "EV-PDB-9P5F-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.498 }, "provenance": { "deposit_id": "9P5F", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P5F" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin with Mineral Oil" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P5G", "evidence_id": "EV-PDB-9P5G-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.499 }, "provenance": { "deposit_id": "9P5G", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P5G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin with Mineral Oil (Duplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P5Q", "evidence_id": "EV-PDB-9P5Q-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.499 }, "provenance": { "deposit_id": "9P5Q", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P5Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin with PEG 400 (Duplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P5R", "evidence_id": "EV-PDB-9P5R-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "9P5R", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P5R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin with PEG 400 (Triplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P5S", "evidence_id": "EV-PDB-9P5S-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.499 }, "provenance": { "deposit_id": "9P5S", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P5S" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin with PEG 6000" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P5T", "evidence_id": "EV-PDB-9P5T-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.499 }, "provenance": { "deposit_id": "9P5T", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P5T" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin with PEG 6000 (Duplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P5U", "evidence_id": "EV-PDB-9P5U-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.499 }, "provenance": { "deposit_id": "9P5U", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P5U" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin with PEG 6000 (Triplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P5V", "evidence_id": "EV-PDB-9P5V-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "9P5V", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P5V" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin with Silicone Oil" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P5W", "evidence_id": "EV-PDB-9P5W-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.499 }, "provenance": { "deposit_id": "9P5W", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P5W" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin with Silicone Oil (Duplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P5X", "evidence_id": "EV-PDB-9P5X-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.498 }, "provenance": { "deposit_id": "9P5X", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P5X" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin with Silicone Oil (Triplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P5Y", "evidence_id": "EV-PDB-9P5Y-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.497 }, "provenance": { "deposit_id": "9P5Y", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P5Y" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin with Vaseline" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P5Z", "evidence_id": "EV-PDB-9P5Z-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.497 }, "provenance": { "deposit_id": "9P5Z", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P5Z" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin with Vaseline (Duplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P60", "evidence_id": "EV-PDB-9P60-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.499 }, "provenance": { "deposit_id": "9P60", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P60" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin with Vaseline (Triplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P61", "evidence_id": "EV-PDB-9P61-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.497 }, "provenance": { "deposit_id": "9P61", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P61" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 300 Kelvin with Apiezon N" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P62", "evidence_id": "EV-PDB-9P62-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.499 }, "provenance": { "deposit_id": "9P62", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P62" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 300 Kelvin with Apiezon N (Duplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P64", "evidence_id": "EV-PDB-9P64-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.468 }, "provenance": { "deposit_id": "9P64", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P64" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 300 Kelvin with Apiezon T" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P65", "evidence_id": "EV-PDB-9P65-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.472 }, "provenance": { "deposit_id": "9P65", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P65" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 300 Kelvin with Apiezon T (Duplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P66", "evidence_id": "EV-PDB-9P66-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.499 }, "provenance": { "deposit_id": "9P66", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P66" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 300 Kelvin with Apiezon T (Triplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P63", "evidence_id": "EV-PDB-9P63-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.479 }, "provenance": { "deposit_id": "9P63", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P63" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 300 Kelvin with Apiezon N (Triplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P5B", "evidence_id": "EV-PDB-9P5B-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.499 }, "provenance": { "deposit_id": "9P5B", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P5B" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 100 Kelvin with Lard" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9OS8", "evidence_id": "EV-PDB-9OS8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.3 }, "provenance": { "deposit_id": "9OS8", "doi": "10.1073/pnas.2503780122", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9OS8" }, "reader": null, "source_kind": "deposit", "technique": "microed", "title": "MicroED structure of lysozyme soaked with N,N',N\"-triacetylchitotriose" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9MP8", "evidence_id": "EV-PDB-9MP8-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.83 }, "provenance": { "deposit_id": "9MP8", "doi": "10.1107/S205225252500288X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9MP8" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mix & Quench Time Resolved Lysozyme - NAG1 Complex (750 ms)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9MP7", "evidence_id": "EV-PDB-9MP7-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.15 }, "provenance": { "deposit_id": "9MP7", "doi": "10.1107/S205225252500288X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9MP7" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mix & Quench Time Resolved Lysozyme - NAG1 Complex (300 ms)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9MP6", "evidence_id": "EV-PDB-9MP6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.22 }, "provenance": { "deposit_id": "9MP6", "doi": "10.1107/S205225252500288X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9MP6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mix & Quench Time Resolved Lysozyme - NAG1 Complex (150 ms)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9MP5", "evidence_id": "EV-PDB-9MP5-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.97 }, "provenance": { "deposit_id": "9MP5", "doi": "10.1107/S205225252500288X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9MP5" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mix & Quench Time Resolved Lysozyme - NAG1 Complex (50 ms)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1JFD", "ACT", "CL", "DVT", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RBT", "evidence_id": "EV-PDB-9RBT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.18 }, "provenance": { "deposit_id": "9RBT", "doi": "10.1039/d5qi01384d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RBT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of decavanadate/lysozyme adduct obtained when the protein is treated with Cs2[V(V)2O4(mal)2]2H2O (structure B)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "PEG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RRK", "evidence_id": "EV-PDB-9RRK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.85 }, "provenance": { "deposit_id": "9RRK", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RRK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme (HEWL) collected at the European XFEL, SPB/SFX at the Interaction Region Downstream with 9.6 keV photon energy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "PEG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RRL", "evidence_id": "EV-PDB-9RRL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.7 }, "provenance": { "deposit_id": "9RRL", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RRL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme (HEWL) collected at the European XFEL, SPB/SFX at the Interaction Region Downstream with 12.25 keV photon energy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RV6", "evidence_id": "EV-PDB-9RV6-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.55 }, "provenance": { "deposit_id": "9RV6", "doi": "10.1107/S2052252523007595", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RV6" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "5 micrometer HEWL crystals solved at room-temperature using fixed-target serial crystallography." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RVI", "evidence_id": "EV-PDB-9RVI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.47 }, "provenance": { "deposit_id": "9RVI", "doi": "10.1107/S2052252523007595", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RVI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "10 micrometer HEWL crystals solved at room-temperature using fixed-target serial crystallography." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RZL", "evidence_id": "EV-PDB-9RZL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.9 }, "provenance": { "deposit_id": "9RZL", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RZL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen egg-white lysozyme (HEWL)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1JKF", "MLI", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RZR", "evidence_id": "EV-PDB-9RZR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.27 }, "provenance": { "deposit_id": "9RZR", "doi": "10.1002/anie.202518349", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RZR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg-White Lysozyme (HEWL) complexed with a Lindqvist-type hexavanadate (V6-Hex) polyoxometalate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1JKB", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RZS", "evidence_id": "EV-PDB-9RZS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.68 }, "provenance": { "deposit_id": "9RZS", "doi": "10.1002/anie.202518349", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RZS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg-White Lysozyme (HEWL) complexed with a Lindqvist-type hexavanadate (V6-N3) polyoxometalate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1JKC" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 8.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RZT", "evidence_id": "EV-PDB-9RZT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.73 }, "provenance": { "deposit_id": "9RZT", "doi": "10.1002/anie.202518349", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RZT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg-White Lysozyme (HEWL) complexed with a Lindqvist-type hexavanadate (V6-Man) polyoxometalate" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.5, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9SM9", "evidence_id": "EV-PDB-9SM9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.96 }, "provenance": { "deposit_id": "9SM9", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9SM9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Acoustofluidic Serial Crystallography - On, same number of indexed crystals as Off" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 21.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9SMC", "evidence_id": "EV-PDB-9SMC-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.96 }, "provenance": { "deposit_id": "9SMC", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9SMC" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Acoustofluidic Serial Crystallography - Off, no acoustic focusing" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9TEK", "evidence_id": "EV-PDB-9TEK-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.0 }, "provenance": { "deposit_id": "9TEK", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9TEK" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme crystal structure by beam sweeping serial crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9TOQ", "evidence_id": "EV-PDB-9TOQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.65 }, "provenance": { "deposit_id": "9TOQ", "doi": "10.1107/S2052252526003489", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9TOQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature serial crystal structure of hen egg white lysozyme uncomplexed resting state at DLS I24 on silicon chips" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9TOR", "evidence_id": "EV-PDB-9TOR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.69 }, "provenance": { "deposit_id": "9TOR", "doi": "10.1107/S2052252526003489", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9TOR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Drop on fixed target room temperature serial crystal structure of hen egg white lysozyme, drop on fixed target at DLS, 1.9 s mix with N-acetyl glucosamine." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9TOS", "evidence_id": "EV-PDB-9TOS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.67 }, "provenance": { "deposit_id": "9TOS", "doi": "10.1107/S2052252526003489", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9TOS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Drop on fixed target room temperature serial crystal structure of hen egg white lysozyme, drop on fixed target at DLS, 1.9 s checkerboard control (N-acetyl glucosamine)." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9TOT", "evidence_id": "EV-PDB-9TOT-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.64 }, "provenance": { "deposit_id": "9TOT", "doi": "10.1107/S2052252526003489", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9TOT" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Fixed target room temperature serial crystal structure of hen egg white lysozyme at DLS I24, 600 s mix with N-acetyl glucosamine." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 25.35 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9UGI", "evidence_id": "EV-PDB-9UGI-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "9UGI", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9UGI" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Room temperature structure of lysozyme by serial synchrotron crystallography" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.5, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9UYR", "evidence_id": "EV-PDB-9UYR-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.59 }, "provenance": { "deposit_id": "9UYR", "doi": "10.1107/S1600576725011513", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9UYR" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "In situ structure of egg-white lysozyme using a goniometer-compatible chip-based platform" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9V3D", "evidence_id": "EV-PDB-9V3D-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.68 }, "provenance": { "deposit_id": "9V3D", "doi": "10.1107/S1600576726000063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9V3D" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SFX structure of 3-5 micrometers Lysozyme microcrystals" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9V3J", "evidence_id": "EV-PDB-9V3J-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.68 }, "provenance": { "deposit_id": "9V3J", "doi": "10.1107/S1600576726000063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9V3J" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Time-Resolved mixing crystallography structure of 3-5 micrometers Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 9.7 seconds delay" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9V3K", "evidence_id": "EV-PDB-9V3K-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.72 }, "provenance": { "deposit_id": "9V3K", "doi": "10.1107/S1600576726000063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9V3K" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 1.3 seconds delay" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9V3M", "evidence_id": "EV-PDB-9V3M-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.77 }, "provenance": { "deposit_id": "9V3M", "doi": "10.1107/S1600576726000063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9V3M" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 7.5 seconds delay" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9V3N", "evidence_id": "EV-PDB-9V3N-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.78 }, "provenance": { "deposit_id": "9V3N", "doi": "10.1107/S1600576726000063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9V3N" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 9.7 seconds delay" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9V3P", "evidence_id": "EV-PDB-9V3P-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.81 }, "provenance": { "deposit_id": "9V3P", "doi": "10.1107/S1600576726000063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9V3P" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 452 mM N-Acetyl-D-glucosamine at 2.5 seconds delay" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9V3Q", "evidence_id": "EV-PDB-9V3Q-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "9V3Q", "doi": "10.1107/S1600576726000063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9V3Q" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 452 mM N-Acetyl-D-glucosamine at 4 seconds delay" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.2, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9WKS", "evidence_id": "EV-PDB-9WKS-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.2 }, "provenance": { "deposit_id": "9WKS", "doi": "10.1107/S2059798325011234", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9WKS" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg-white lysozyme determined in the commissioning of NanoTerasu MX-ES" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CFF", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9XUA", "evidence_id": "EV-PDB-9XUA-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.4 }, "provenance": { "deposit_id": "9XUA", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9XUA" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Hen Egg-White Lysozyme (HEWL) complexed with Caffeine" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9V3R", "evidence_id": "EV-PDB-9V3R-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.82 }, "provenance": { "deposit_id": "9V3R", "doi": "10.1107/S1600576726000063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9V3R" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 452 mM N-Acetyl-D-glucosamine at 5.0 seconds delay" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9V3O", "evidence_id": "EV-PDB-9V3O-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.8 }, "provenance": { "deposit_id": "9V3O", "doi": "10.1107/S1600576726000063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9V3O" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 452 mM N-Acetyl-D-glucosamine at 1.3 seconds delay" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9V3L", "evidence_id": "EV-PDB-9V3L-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "9V3L", "doi": "10.1107/S1600576726000063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9V3L" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Time-Resolved mixing crystallography structure of 1 micrometer Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 5.0 seconds delay" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9V3I", "evidence_id": "EV-PDB-9V3I-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.68 }, "provenance": { "deposit_id": "9V3I", "doi": "10.1107/S1600576726000063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9V3I" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Time-Resolved mixing crystallography structure of 3-5 micrometers Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 5 seconds delay" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "NDG" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9V3H", "evidence_id": "EV-PDB-9V3H-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.68 }, "provenance": { "deposit_id": "9V3H", "doi": "10.1107/S1600576726000063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9V3H" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Time-Resolved mixing crystallography structure of 3-5 micrometers Lysozyme microcrystals with 226 mM N-Acetyl-D-glucosamine at 2 seconds delay" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9V3G", "evidence_id": "EV-PDB-9V3G-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.74 }, "provenance": { "deposit_id": "9V3G", "doi": "10.1107/S1600576726000063", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9V3G" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SFX structure of 1 micrometer Lysozyme microcrystals" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9TEJ", "evidence_id": "EV-PDB-9TEJ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.1 }, "provenance": { "deposit_id": "9TEJ", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9TEJ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme crystal structure by beam sweeping serial crystallography with pink beam" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9TBL", "evidence_id": "EV-PDB-9TBL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "9TBL", "doi": "10.1107/S1600576725011513", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9TBL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SSX Lysozyme at 100K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1JLF", "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9S2A", "evidence_id": "EV-PDB-9S2A-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.37 }, "provenance": { "deposit_id": "9S2A", "doi": "10.1021/acs.inorgchem.5c05201", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9S2A" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of lysozyme obtained upon reaction with the dioxidovanadium(V) complex with thiophene-2-carboxylic acid (3-ethoxy-2-hydroxybenzylidene)hydrazide" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 3.0, "salt_mM": null, "temperature_c": 19.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RVO", "evidence_id": "EV-PDB-9RVO-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.33 }, "provenance": { "deposit_id": "9RVO", "doi": "10.1107/S2052252523007595", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RVO" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "25 micrometer HEWL crystals solved at room-temperature using fixed-target serial crystallography." }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "NA", "RH" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 7.5, "salt_mM": null, "temperature_c": 36.85 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RUV", "evidence_id": "EV-PDB-9RUV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.12 }, "provenance": { "deposit_id": "9RUV", "doi": "10.3390/ijms26146582", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RUV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of the adduct formed upon reaction of dirhodium-tetraacetate with lysozyme at body temperature" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "VVO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": 36.85 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RBV", "evidence_id": "EV-PDB-9RBV-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.09 }, "provenance": { "deposit_id": "9RBV", "doi": "10.1039/d5qi01384d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RBV" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of lysozyme when is treated with Cs2[V(V)2O4(mal)2]2H2O at 310K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1JFD", "CL", "DVT", "NA", "VVO" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains AAA)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9RBG", "evidence_id": "EV-PDB-9RBG-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.46 }, "provenance": { "deposit_id": "9RBG", "doi": "10.1039/d5qi01384d", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9RBG" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "X-ray structure of decavanadate/lysozyme adduct obtained when the protein is treated with Cs2[V(V)2O4(mal)2]2H2O (structure A)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "ACT", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9QUM", "evidence_id": "EV-PDB-9QUM-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 0.83 }, "provenance": { "deposit_id": "9QUM", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9QUM" }, "reader": null, "source_kind": "deposit", "technique": "microed", "title": "Structure of lysozyme by continuous serial electron diffraction (SerialED)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9QTL", "evidence_id": "EV-PDB-9QTL-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.75 }, "provenance": { "deposit_id": "9QTL", "doi": "10.1107/S1600576725011276", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9QTL" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "SFX crystal structure of hen egg-white lysozyme (HEWL) using a guanosine derivative hydrogel as crystal matrix" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "A1JAD", "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.0, "salt_mM": null, "temperature_c": -173.15 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9QSQ", "evidence_id": "EV-PDB-9QSQ-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.87 }, "provenance": { "deposit_id": "9QSQ", "doi": "10.1039/D5QI01454A", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9QSQ" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Mn(III)-substituted Wells-Dawson binding to Hen Egg-White Lysozyme (HEWL)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 5.0, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9QA9", "evidence_id": "EV-PDB-9QA9-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.56 }, "provenance": { "deposit_id": "9QA9", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9QA9" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Lysozyme in-situ room temperature" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA", "branched: 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P6R", "evidence_id": "EV-PDB-9P6R-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 2.2 }, "provenance": { "deposit_id": "9P6R", "doi": "10.1021/jacs.5c10751", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P6R" }, "reader": null, "source_kind": "deposit", "technique": "microed", "title": "Structure of lysozyme-N,N',N\"-triacetylchitotriose complex determined using REyes for automated MicroED" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P69", "evidence_id": "EV-PDB-9P69-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.497 }, "provenance": { "deposit_id": "9P69", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P69" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 300 Kelvin with Vaseline (Triplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": null, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P68", "evidence_id": "EV-PDB-9P68-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.499 }, "provenance": { "deposit_id": "9P68", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P68" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 300 Kelvin with Vaseline (Duplicate)" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [ "CL", "GOL", "NA" ], "notes": "Entry-level ligand list; oligosaccharides appear as branched entities. pH and temperature are null when not deposited in machine-readable fields.", "ph": 4.6, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "Lysozyme C (chains A)", "labels": [] }, "data_format": "mmCIF + structure factors", "data_level": "processed", "data_link": "https://www.rcsb.org/structure/9P67", "evidence_id": "EV-PDB-9P67-1", "mappings": [ { "confidence": "medium", "justification": "Experimental structure of this small single-domain protein; deposited structures show the native fold unless the title says otherwise.", "rule": "hewl-structures-native", "state_id": "HEWL-native", "who": "rule:hewl-structures-native" } ], "molecule_id": "P00698", "observable": { "type": "resolution", "uncertainty": null, "unit": "Å", "value": 1.5 }, "provenance": { "deposit_id": "9P67", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://www.rcsb.org/structure/9P67" }, "reader": null, "source_kind": "deposit", "technique": "xray", "title": "Crystal structure of hen egg white lysozyme at 300 Kelvin with Vaseline" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 3.8, "salt_mM": null, "temperature_c": 34.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1093", "evidence_id": "EV-BMRB-1093", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1093", "doi": "10.13018/BMR1093", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1093" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Sequential 1H NMR Assignments and Secondary Structure of Hen Egg White Lysozyme in Solution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 3.05, "salt_mM": null, "temperature_c": 41.85 }, "construct": { "description": "BMRB data: 13C chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1104", "evidence_id": "EV-BMRB-1104", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1104", "doi": "10.13018/BMR1104", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1104" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Studies of Individual Carbon Sites of Proteins in Solution by Natural Abundance Carbon 13 Nuclear Magnetic Resonance Spectroscopy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 3.08, "salt_mM": null, "temperature_c": 41.85 }, "construct": { "description": "BMRB data: 13C chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1105", "evidence_id": "EV-BMRB-1105", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1105", "doi": "10.13018/BMR1105", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1105" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Studies of Individual Carbon Sites of Proteins in Solution by Natural Abundance Carbon 13 Nuclear Magnetic Resonance Spectroscopy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 3.8, "salt_mM": null, "temperature_c": 74.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1650", "evidence_id": "EV-BMRB-1650", "mappings": [ { "confidence": "medium", "justification": "NMR data titled as unfolded or denatured describe the unfolded ensemble.", "rule": "hewl-denatured-nmr", "state_id": "HEWL-unfolded", "who": "rule:hewl-denatured-nmr" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1650", "doi": "10.13018/BMR1650", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1650" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Hydrophobic Clustering in Nonnative States of a Protein: Interpretation of Chemical Shifts in NMR Spectra of Denatured States of Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 3.8, "salt_mM": null, "temperature_c": 74.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1651", "evidence_id": "EV-BMRB-1651", "mappings": [ { "confidence": "medium", "justification": "NMR data titled as unfolded or denatured describe the unfolded ensemble.", "rule": "hewl-denatured-nmr", "state_id": "HEWL-unfolded", "who": "rule:hewl-denatured-nmr" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1651", "doi": "10.13018/BMR1651", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1651" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Hydrophobic Clustering in Nonnative States of a Protein: Interpretation of Chemical Shifts in NMR Spectra of Denatured States of Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 3.8, "salt_mM": null, "temperature_c": 74.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1653", "evidence_id": "EV-BMRB-1653", "mappings": [ { "confidence": "medium", "justification": "NMR data titled as unfolded or denatured describe the unfolded ensemble.", "rule": "hewl-denatured-nmr", "state_id": "HEWL-unfolded", "who": "rule:hewl-denatured-nmr" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1653", "doi": "10.13018/BMR1653", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1653" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Hydrophobic Clustering in Nonnative States of a Protein: Interpretation of Chemical Shifts in NMR Spectra of Denatured States of Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.8, "salt_mM": null, "temperature_c": 55.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1770", "evidence_id": "EV-BMRB-1770", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1770", "doi": "10.13018/BMR1770", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1770" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H-NMR Study of the Intramolecular Interaction of a Substrate Analogue Covalently Attached to Aspartic Acid-101 in Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 3.8, "salt_mM": null, "temperature_c": 34.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1772", "evidence_id": "EV-BMRB-1772", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1772", "doi": "10.13018/BMR1772", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1772" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H-NMR Study of the Intramolecular Interaction of a Substrate Analogue Covalently Attached to Aspartic Acid-101 in Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.75, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "BMRB data: 13C chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1798", "evidence_id": "EV-BMRB-1798", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1798", "doi": "10.13018/BMR1798", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1798" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Effect of inhibitors on conformational changes in hen lysozyme around thermal transition point in solution and solid state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.75, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "BMRB data: 13C chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1799", "evidence_id": "EV-BMRB-1799", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1799", "doi": "10.13018/BMR1799", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1799" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Effect of inhibitors on conformational changes in hen lysozyme around thermal transition point in solution and solid state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.75, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "BMRB data: 13C chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1800", "evidence_id": "EV-BMRB-1800", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1800", "doi": "10.13018/BMR1800", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1800" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Effect of inhibitors on conformational changes in hen lysozyme around thermal transition point in solution and solid state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.75, "salt_mM": null, "temperature_c": 37.85 }, "construct": { "description": "BMRB data: 13C chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1801", "evidence_id": "EV-BMRB-1801", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1801", "doi": "10.13018/BMR1801", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1801" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Effect of inhibitors on conformational changes in hen lysozyme around thermal transition point in solution and solid state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.75, "salt_mM": null, "temperature_c": 37.85 }, "construct": { "description": "BMRB data: 13C chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1802", "evidence_id": "EV-BMRB-1802", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1802", "doi": "10.13018/BMR1802", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1802" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Effect of inhibitors on conformational changes in hen lysozyme around thermal transition point in solution and solid state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.75, "salt_mM": null, "temperature_c": 37.85 }, "construct": { "description": "BMRB data: 13C chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1803", "evidence_id": "EV-BMRB-1803", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1803", "doi": "10.13018/BMR1803", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1803" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Effect of inhibitors on conformational changes in hen lysozyme around thermal transition point in solution and solid state" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.7, "salt_mM": null, "temperature_c": 35.0 }, "construct": { "description": "BMRB data: order parameters", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=18304", "evidence_id": "EV-BMRB-18304", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "relaxation_rate", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr18304", "doi": "10.13018/BMR18304", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=18304" }, "reader": null, "source_kind": "deposit", "technique": "nmr_dynamics", "title": "Order parameters for HEWL" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.7, "salt_mM": null, "temperature_c": 35.0 }, "construct": { "description": "BMRB data: order parameters", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=18305", "evidence_id": "EV-BMRB-18305", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "relaxation_rate", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr18305", "doi": "10.13018/BMR18305", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=18305" }, "reader": null, "source_kind": "deposit", "technique": "nmr_dynamics", "title": "Order parameters for HEWL-chitotriose" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 3.1, "salt_mM": null, "temperature_c": 43.85 }, "construct": { "description": "BMRB data: 13C chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1865", "evidence_id": "EV-BMRB-1865", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1865", "doi": "10.13018/BMR1865", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1865" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Studies of Individual Carbon Sites of Hen Egg White Lysozyme by Natural Abundance Carbon 13 Nuclear Magnetic Resonance Spectroscopy" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 3.8, "salt_mM": null, "temperature_c": 74.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1881", "evidence_id": "EV-BMRB-1881", "mappings": [ { "confidence": "medium", "justification": "NMR data titled as unfolded or denatured describe the unfolded ensemble.", "rule": "hewl-denatured-nmr", "state_id": "HEWL-unfolded", "who": "rule:hewl-denatured-nmr" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1881", "doi": "10.13018/BMR1881", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1881" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Hydrophobic Clustering in Nonnative States of a Protein: Interpretation of Chemical Shifts in NMR Spectra of Denatured States of Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 3.8, "salt_mM": null, "temperature_c": 74.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1882", "evidence_id": "EV-BMRB-1882", "mappings": [ { "confidence": "medium", "justification": "NMR data titled as unfolded or denatured describe the unfolded ensemble.", "rule": "hewl-denatured-nmr", "state_id": "HEWL-unfolded", "who": "rule:hewl-denatured-nmr" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1882", "doi": "10.13018/BMR1882", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1882" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Hydrophobic Clustering in Nonnative States of a Protein: Interpretation of Chemical Shifts in NMR Spectra of Denatured States of Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 3.8, "salt_mM": null, "temperature_c": 74.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1883", "evidence_id": "EV-BMRB-1883", "mappings": [ { "confidence": "medium", "justification": "NMR data titled as unfolded or denatured describe the unfolded ensemble.", "rule": "hewl-denatured-nmr", "state_id": "HEWL-unfolded", "who": "rule:hewl-denatured-nmr" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1883", "doi": "10.13018/BMR1883", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1883" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Hydrophobic Clustering in Nonnative States of a Protein: Interpretation of Chemical Shifts in NMR Spectra of Denatured States of Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 3.8, "salt_mM": null, "temperature_c": 74.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1884", "evidence_id": "EV-BMRB-1884", "mappings": [ { "confidence": "medium", "justification": "NMR data titled as unfolded or denatured describe the unfolded ensemble.", "rule": "hewl-denatured-nmr", "state_id": "HEWL-unfolded", "who": "rule:hewl-denatured-nmr" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1884", "doi": "10.13018/BMR1884", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1884" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Hydrophobic Clustering in Nonnative States of a Protein: Interpretation of Chemical Shifts in NMR Spectra of Denatured States of Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.76, "salt_mM": null, "temperature_c": 22.85 }, "construct": { "description": "BMRB data: 13C chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1975", "evidence_id": "EV-BMRB-1975", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1975", "doi": "10.13018/BMR1975", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1975" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "N.m.r. study of conformational changes in lysozyme around the thermal transition point" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.76, "salt_mM": null, "temperature_c": 37.85 }, "construct": { "description": "BMRB data: 13C chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=1977", "evidence_id": "EV-BMRB-1977", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr1977", "doi": "10.13018/BMR1977", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=1977" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "N.m.r. study of conformational changes in lysozyme around the thermal transition point" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 3.8, "salt_mM": null, "temperature_c": 34.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=2231", "evidence_id": "EV-BMRB-2231", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr2231", "doi": "10.13018/BMR2231", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=2231" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Preparation of a Lysozyme Derivative in Which Two Domains Are Cross-Linked Intramolecularly between Trp62 and Asp101" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 3.8, "salt_mM": null, "temperature_c": 54.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=2446", "evidence_id": "EV-BMRB-2446", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr2446", "doi": "10.13018/BMR2446", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=2446" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Studies of beta-Sheet Structure in Lysozyme by Proton Nuclear Magnetic Resonance. Assignments and Analysis of Spin-Spin Coupling Constants" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 5.3, "salt_mM": null, "temperature_c": 53.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=2786", "evidence_id": "EV-BMRB-2786", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr2786", "doi": "10.13018/BMR2786", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=2786" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Complete Assignment of Aromatic 1H Nuclear Magnetic Resonances of the Tyrosine Residues of Hen Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 4.7, "salt_mM": null, "temperature_c": 53.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=2858", "evidence_id": "EV-BMRB-2858", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr2858", "doi": "10.13018/BMR2858", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=2858" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Comparisons of Ring-Current Shifts Calculated from the Crystal Structure of Egg White Lysozyme of Hen with the Proton Nuclear Magnetic Resonance Spectrum of Lysozyme in Solution" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 5.3, "salt_mM": null, "temperature_c": 53.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=2917", "evidence_id": "EV-BMRB-2917", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr2917", "doi": "10.13018/BMR2917", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=2917" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Study of Tryptophan Residues of Lysozyme Using 1H Nuclear Magnetic Resonance" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 5.3, "salt_mM": null, "temperature_c": 56.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=2957", "evidence_id": "EV-BMRB-2957", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr2957", "doi": "10.13018/BMR2957", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=2957" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Complete Assignment of the 1H NMR Spectrum of the Aromatic Residues of Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 3.6, "salt_mM": null, "temperature_c": 44.85 }, "construct": { "description": "BMRB data: 1H chemical shifts, 13C chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=4562", "evidence_id": "EV-BMRB-4562", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr4562", "doi": "10.13018/BMR4562", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=4562" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H and 13C chemical shift assignments of native hen egg white lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 3.8, "salt_mM": null, "temperature_c": 34.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=4943", "evidence_id": "EV-BMRB-4943", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr4943", "doi": "10.13018/BMR4943", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=4943" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H Chemical shift Assignments for Lysozymes marketed by Seikagaku and Sigma companies at pH 3.8, 308K" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 3.8, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=5068", "evidence_id": "EV-BMRB-5068", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr5068", "doi": "10.13018/BMR5068", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=5068" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Recombinant hen lysozyme containing the extra N-terminal Met as the standard reference for the study of hen lysozyme variants" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 3.8, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=5069", "evidence_id": "EV-BMRB-5069", "mappings": [ { "confidence": "medium", "justification": "NMR data titled as unfolded or denatured describe the unfolded ensemble.", "rule": "hewl-denatured-nmr", "state_id": "HEWL-unfolded", "who": "rule:hewl-denatured-nmr" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr5069", "doi": "10.13018/BMR5069", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=5069" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "NMR Structural Study of Two-Disulfide Variant of hen Lysozyme: 2SS[6-127, 30-115]-A Disulfide Intermediate with a Partly Unfolded Structure" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 3.4, "salt_mM": null, "temperature_c": 37.85 }, "construct": { "description": "BMRB data: 13C chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=568", "evidence_id": "EV-BMRB-568", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr568", "doi": "10.13018/BMR568", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=568" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Applications of Natural-Abundance Carbon-13 NMR to Studies of Proteins and Glycoproteins" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 5.3, "salt_mM": null, "temperature_c": 56.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=569", "evidence_id": "EV-BMRB-569", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr569", "doi": "10.13018/BMR569", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=569" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "A Structural Study of the Hydrophobic Box Region of Lysozyme in Solution Using Nuclear Overhauser Effects" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": null, "salt_mM": null, "temperature_c": 34.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=7144", "evidence_id": "EV-BMRB-7144", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr7144", "doi": "10.13018/BMR7144", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=7144" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Chemical shift changes upon ligand binding" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 3.8, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=7159", "evidence_id": "EV-BMRB-7159", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr7159", "doi": "10.13018/BMR7159", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=7159" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H chemical shift assignments of 2SS[6-127, 30-115] at pH 3.8 and 25 C" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 3.8, "salt_mM": null, "temperature_c": 24.85 }, "construct": { "description": "BMRB data: 1H chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=7160", "evidence_id": "EV-BMRB-7160", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr7160", "doi": "10.13018/BMR7160", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=7160" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "1H chemical shift assignments of metLYZ at pH 3.8 and 25 C" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_vitro", "ions": [], "ligands": [], "notes": "From the first sample condition list of the entry.", "ph": 7.0, "salt_mM": null, "temperature_c": 46.85 }, "construct": { "description": "BMRB data: 13C chemical shifts", "labels": [] }, "data_format": "NMR-STAR", "data_level": "processed", "data_link": "https://bmrb.io/data_library/summary/index.php?bmrbId=791", "evidence_id": "EV-BMRB-791", "mappings": [ { "confidence": "low", "justification": "Chemical shift assignment of the folded protein; shift-only entries rarely describe non-native states unless titled so.", "rule": "hewl-nmr-shifts-native", "state_id": "HEWL-native", "who": "rule:hewl-nmr-shifts-native" } ], "molecule_id": "P00698", "observable": { "type": "chemical_shift", "uncertainty": null, "unit": null, "value": null }, "provenance": { "deposit_id": "bmr791", "doi": "10.13018/BMR791", "licence": "CC0 1.0 (verify)", "retrieved": "2026-10-19", "source": "BMRB", "url": "https://bmrb.io/data_library/summary/index.php?bmrbId=791" }, "reader": null, "source_kind": "deposit", "technique": "nmr_shifts", "title": "Proton NMR Detection of Long-Range Heteronuclear Multiquantum Coherences in Proteins: The Complete Assignment of the Quaternary Aromatic 13C Shifts in Lysozyme" }, { "conditions": { "applied_force_pn": null, "buffer": "20 mM Sodium Acetate/HEPES", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 4.79 nm.", "ph": 6.8, "salt_mM": null, "temperature_c": 10.0 }, "construct": { "description": "Lysozyme C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDA96/", "evidence_id": "EV-SASBDB-SASDA96", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": null, "unit": "nm", "value": 1.5 }, "provenance": { "deposit_id": "SASDA96", "doi": "10.1038/nmeth.3358", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDA96/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Correlation Map, a goodness-of-fit test for one-dimensional X-ray scattering spectra." }, { "conditions": { "applied_force_pn": null, "buffer": "40 mM Sodium Acetate", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 4 nm.", "ph": 3.8, "salt_mM": null, "temperature_c": 10.0 }, "construct": { "description": "Lysozyme C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDAC2/", "evidence_id": "EV-SASBDB-SASDAC2", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": null, "unit": "nm", "value": 1.47 }, "provenance": { "deposit_id": "SASDAC2", "doi": null, "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDAC2/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Standard proteins" }, { "conditions": { "applied_force_pn": null, "buffer": "40 mM Sodium Acetate", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 4 nm.", "ph": 3.8, "salt_mM": null, "temperature_c": 10.0 }, "construct": { "description": "Lysozyme C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDAG2/", "evidence_id": "EV-SASBDB-SASDAG2", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": null, "unit": "nm", "value": 1.45 }, "provenance": { "deposit_id": "SASDAG2", "doi": null, "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDAG2/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Standard proteins" }, { "conditions": { "applied_force_pn": null, "buffer": "40 mM Sodium Acetate pH 4.0, 50 mM NaCl", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample.", "ph": 4.0, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "Lysozyme C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDCK8/", "evidence_id": "EV-SASBDB-SASDCK8", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.03, "unit": "nm", "value": 1.41 }, "provenance": { "deposit_id": "SASDCK8", "doi": null, "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDCK8/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "WAXS benchmark on standard proteins" }, { "conditions": { "applied_force_pn": null, "buffer": "40 mM sodium acetate, 150 mM NaCl, 100 mM 5-methyl uridine", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 4.2 nm.", "ph": 3.8, "salt_mM": null, "temperature_c": 25.0 }, "construct": { "description": "Lysozyme C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDJH3/", "evidence_id": "EV-SASBDB-SASDJH3", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.025, "unit": "nm", "value": 1.45 }, "provenance": { "deposit_id": "SASDJH3", "doi": "10.1107/S2059798320010700", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDJH3/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Improving data quality and expanding BioSAXS experiments to low-molecular-weight and low-concentration protein samples." }, { "conditions": { "applied_force_pn": null, "buffer": "0.2 M glycine-HCl, 80 mM NaCl", "environment": "in_vitro", "ions": [], "ligands": [ "partner: Fe3O4 nanoparticles; nominal diameter 10 nm (hydrodynamic diameter)" ], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 70 nm.", "ph": 2.2, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "lysozyme amyloid fibril with Fe3O4 nanoparticles; nominal diameter 10 nm (hydrodynamic diameter)", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDM44/", "evidence_id": "EV-SASBDB-SASDM44", "mappings": [], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.104, "unit": "nm", "value": 22.305 }, "provenance": { "deposit_id": "SASDM44", "doi": "10.3390/molecules26164864", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDM44/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Dependence of the Nanoscale Composite Morphology of Fe3O4 Nanoparticle-Infused Lysozyme Amyloid Fibrils on Timing of Infusion: A Combined SAXS and AFM Study" }, { "conditions": { "applied_force_pn": null, "buffer": "0.2 M glycine-HCl, 80 mM NaCl", "environment": "in_vitro", "ions": [], "ligands": [ "partner: Fe3O4 nanoparticles; nominal diameter 30 nm (hydrodynamic diameter)" ], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 95 nm.", "ph": 2.2, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "lysozyme amyloid fibril with Fe3O4 nanoparticles; nominal diameter 30 nm (hydrodynamic diameter)", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDM54/", "evidence_id": "EV-SASBDB-SASDM54", "mappings": [], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.248, "unit": "nm", "value": 22.537 }, "provenance": { "deposit_id": "SASDM54", "doi": "10.3390/molecules26164864", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDM54/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Dependence of the Nanoscale Composite Morphology of Fe3O4 Nanoparticle-Infused Lysozyme Amyloid Fibrils on Timing of Infusion: A Combined SAXS and AFM Study" }, { "conditions": { "applied_force_pn": null, "buffer": "0.2 M glycine-HCl, 80 mM NaCl", "environment": "in_vitro", "ions": [], "ligands": [ "partner: Fe3O4 nanoparticles; nominal diameter 20 nm (hydrodynamic diameter)" ], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 90 nm.", "ph": 2.2, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "lysozyme amyloid fibril with Fe3O4 nanoparticles; nominal diameter 20 nm (hydrodynamic diameter)", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDM64/", "evidence_id": "EV-SASBDB-SASDM64", "mappings": [], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.226, "unit": "nm", "value": 23.642 }, "provenance": { "deposit_id": "SASDM64", "doi": "10.3390/molecules26164864", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDM64/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Dependence of the Nanoscale Composite Morphology of Fe3O4 Nanoparticle-Infused Lysozyme Amyloid Fibrils on Timing of Infusion: A Combined SAXS and AFM Study" }, { "conditions": { "applied_force_pn": null, "buffer": "0.2 M glycine-HCl, 80 mM NaCl", "environment": "in_vitro", "ions": [], "ligands": [ "partner: Fe3O4 nanoparticles; nominal diameter 20 nm (hydrodynamic diameter)" ], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 75 nm.", "ph": 2.2, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "lysozyme amyloid fibril with Fe3O4 nanoparticles; nominal diameter 20 nm (hydrodynamic diameter)", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDM74/", "evidence_id": "EV-SASBDB-SASDM74", "mappings": [], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.169, "unit": "nm", "value": 30.97 }, "provenance": { "deposit_id": "SASDM74", "doi": "10.3390/molecules26164864", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDM74/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Dependence of the Nanoscale Composite Morphology of Fe3O4 Nanoparticle-Infused Lysozyme Amyloid Fibrils on Timing of Infusion: A Combined SAXS and AFM Study" }, { "conditions": { "applied_force_pn": null, "buffer": "100 mM HEPES pH 7.5, 20 %(v/v) jeffamine M-600", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample.", "ph": 7.5, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "Lysozyme C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDM79/", "evidence_id": "EV-SASBDB-SASDM79", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.015, "unit": "nm", "value": 1.75 }, "provenance": { "deposit_id": "SASDM79", "doi": "10.32607/actanaturae.11815", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDM79/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "The Relationship of Precursor Cluster Concentration in a Saturated Crystallization Solution to Long-Range Order During the Transition to the Solid Phase." }, { "conditions": { "applied_force_pn": null, "buffer": "100 mM sodium acetate, pH 4.6, 2.0 M sodium formate", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample.", "ph": 4.6, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "Lysozyme C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDM89/", "evidence_id": "EV-SASBDB-SASDM89", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.071, "unit": "nm", "value": 2.15 }, "provenance": { "deposit_id": "SASDM89", "doi": "10.32607/actanaturae.11815", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDM89/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "The Relationship of Precursor Cluster Concentration in a Saturated Crystallization Solution to Long-Range Order During the Transition to the Solid Phase." }, { "conditions": { "applied_force_pn": null, "buffer": "200 mM K/Na tartrate, 100 mM tri-sodium citrate pH 5.6, 2.0 M ammonium sulfate", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample.", "ph": 5.6, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "Lysozyme C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDM99/", "evidence_id": "EV-SASBDB-SASDM99", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.039, "unit": "nm", "value": 2.35 }, "provenance": { "deposit_id": "SASDM99", "doi": "10.32607/actanaturae.11815", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDM99/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "The Relationship of Precursor Cluster Concentration in a Saturated Crystallization Solution to Long-Range Order During the Transition to the Solid Phase." }, { "conditions": { "applied_force_pn": null, "buffer": "40 mM NaOAc pH 3.8, 150 mM NaCl", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 4.23 nm.", "ph": 3.8, "salt_mM": null, "temperature_c": 10.0 }, "construct": { "description": "Lysozyme C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDMC2/", "evidence_id": "EV-SASBDB-SASDMC2", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.054, "unit": "nm", "value": 1.322 }, "provenance": { "deposit_id": "SASDMC2", "doi": "10.1080/07391102.2021.1977704", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDMC2/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Visualizing how inclusion of higher reciprocal space in SWAXS data analysis improves shape restoration of biomolecules: case of lysozyme." }, { "conditions": { "applied_force_pn": null, "buffer": "40 mM NaOAc pH 3.8, 150 mM NaCl", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 4.29 nm.", "ph": 3.8, "salt_mM": null, "temperature_c": 10.0 }, "construct": { "description": "Lysozyme C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDMD2/", "evidence_id": "EV-SASBDB-SASDMD2", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.03, "unit": "nm", "value": 1.396 }, "provenance": { "deposit_id": "SASDMD2", "doi": "10.1080/07391102.2021.1977704", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDMD2/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Visualizing how inclusion of higher reciprocal space in SWAXS data analysis improves shape restoration of biomolecules: case of lysozyme." }, { "conditions": { "applied_force_pn": null, "buffer": "40 mM NaOAc pH 3.8, 150 mM NaCl", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 4.52 nm.", "ph": 3.8, "salt_mM": null, "temperature_c": 10.0 }, "construct": { "description": "Lysozyme C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDME2/", "evidence_id": "EV-SASBDB-SASDME2", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.027, "unit": "nm", "value": 1.418 }, "provenance": { "deposit_id": "SASDME2", "doi": "10.1080/07391102.2021.1977704", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDME2/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Visualizing how inclusion of higher reciprocal space in SWAXS data analysis improves shape restoration of biomolecules: case of lysozyme." }, { "conditions": { "applied_force_pn": null, "buffer": "40 mM NaOAc pH 3.8, 150 mM NaCl", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 4.95 nm.", "ph": 3.8, "salt_mM": null, "temperature_c": 10.0 }, "construct": { "description": "Lysozyme C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDMF2/", "evidence_id": "EV-SASBDB-SASDMF2", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.029, "unit": "nm", "value": 1.44 }, "provenance": { "deposit_id": "SASDMF2", "doi": "10.1080/07391102.2021.1977704", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDMF2/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Visualizing how inclusion of higher reciprocal space in SWAXS data analysis improves shape restoration of biomolecules: case of lysozyme." }, { "conditions": { "applied_force_pn": null, "buffer": "40 mM NaOAc pH 3.8, 150 mM NaCl", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 4.58 nm.", "ph": 3.8, "salt_mM": null, "temperature_c": 10.0 }, "construct": { "description": "Lysozyme C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDMG2/", "evidence_id": "EV-SASBDB-SASDMG2", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.046, "unit": "nm", "value": 1.454 }, "provenance": { "deposit_id": "SASDMG2", "doi": "10.1080/07391102.2021.1977704", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDMG2/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Visualizing how inclusion of higher reciprocal space in SWAXS data analysis improves shape restoration of biomolecules: case of lysozyme." }, { "conditions": { "applied_force_pn": null, "buffer": "40 mM NaOAc pH 3.8, 150 mM NaCl", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 4.19 nm.", "ph": 3.8, "salt_mM": null, "temperature_c": 10.0 }, "construct": { "description": "Lysozyme C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDMH2/", "evidence_id": "EV-SASBDB-SASDMH2", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.04, "unit": "nm", "value": 1.397 }, "provenance": { "deposit_id": "SASDMH2", "doi": "10.1080/07391102.2021.1977704", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDMH2/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Visualizing how inclusion of higher reciprocal space in SWAXS data analysis improves shape restoration of biomolecules: case of lysozyme." }, { "conditions": { "applied_force_pn": null, "buffer": "40 mM NaOAc pH 3.8, 150 mM NaCl", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 4.19 nm.", "ph": 3.8, "salt_mM": null, "temperature_c": 10.0 }, "construct": { "description": "Lysozyme C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDMJ2/", "evidence_id": "EV-SASBDB-SASDMJ2", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.026, "unit": "nm", "value": 1.398 }, "provenance": { "deposit_id": "SASDMJ2", "doi": "10.1080/07391102.2021.1977704", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDMJ2/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Visualizing how inclusion of higher reciprocal space in SWAXS data analysis improves shape restoration of biomolecules: case of lysozyme." }, { "conditions": { "applied_force_pn": null, "buffer": "0.2 M glycine-HCl, 80 mM NaCl", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 120 nm.", "ph": 2.2, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "lysozyme amyloid fibril", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDMJ4/", "evidence_id": "EV-SASBDB-SASDMJ4", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.131, "unit": "nm", "value": 30.226 }, "provenance": { "deposit_id": "SASDMJ4", "doi": "10.1002/bip.23342", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDMJ4/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Effect of the concentration of protein and nanoparticles on the structure of biohybrid nanocomposites." }, { "conditions": { "applied_force_pn": null, "buffer": "40 mM NaOAc pH 3.8, 150 mM NaCl", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 4.19 nm.", "ph": 3.8, "salt_mM": null, "temperature_c": 10.0 }, "construct": { "description": "Lysozyme C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDMK2/", "evidence_id": "EV-SASBDB-SASDMK2", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.101, "unit": "nm", "value": 1.389 }, "provenance": { "deposit_id": "SASDMK2", "doi": "10.1080/07391102.2021.1977704", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDMK2/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Visualizing how inclusion of higher reciprocal space in SWAXS data analysis improves shape restoration of biomolecules: case of lysozyme." }, { "conditions": { "applied_force_pn": null, "buffer": "40 mM NaOAc pH 3.8, 150 mM NaCl", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 4.19 nm.", "ph": 3.8, "salt_mM": null, "temperature_c": 10.0 }, "construct": { "description": "Lysozyme C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDML2/", "evidence_id": "EV-SASBDB-SASDML2", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.026, "unit": "nm", "value": 1.398 }, "provenance": { "deposit_id": "SASDML2", "doi": "10.1080/07391102.2021.1977704", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDML2/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Visualizing how inclusion of higher reciprocal space in SWAXS data analysis improves shape restoration of biomolecules: case of lysozyme." }, { "conditions": { "applied_force_pn": null, "buffer": "0.2 M glycine-HCl, 80 mM NaCl", "environment": "in_vitro", "ions": [], "ligands": [ "partner: Fe3O4 nanoparticles; radius 5.6 nm (AFM based)" ], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 80 nm.", "ph": 2.2, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "lysozyme amyloid fibril with Fe3O4 nanoparticles; radius 5.6 nm (AFM based)", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDML4/", "evidence_id": "EV-SASBDB-SASDML4", "mappings": [], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.014, "unit": "nm", "value": 29.366 }, "provenance": { "deposit_id": "SASDML4", "doi": "10.1002/bip.23342", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDML4/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Effect of the concentration of protein and nanoparticles on the structure of biohybrid nanocomposites." }, { "conditions": { "applied_force_pn": null, "buffer": "0.2 M glycine-HCl, 80 mM NaCl", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 80 nm.", "ph": 2.2, "salt_mM": null, "temperature_c": 20.0 }, "construct": { "description": "lysozyme amyloid fibril", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDMY3/", "evidence_id": "EV-SASBDB-SASDMY3", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.08, "unit": "nm", "value": 38.397 }, "provenance": { "deposit_id": "SASDMY3", "doi": "10.3390/molecules26164864", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDMY3/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Dependence of the Nanoscale Composite Morphology of Fe3O4 Nanoparticle-Infused Lysozyme Amyloid Fibrils on Timing of Infusion: A Combined SAXS and AFM Study" }, { "conditions": { "applied_force_pn": null, "buffer": "50 mM sodium citrate, 150 mM NaCl", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 4.8 nm.", "ph": 4.5, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDPT4/", "evidence_id": "EV-SASBDB-SASDPT4", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.054, "unit": "nm", "value": 1.464 }, "provenance": { "deposit_id": "SASDPT4", "doi": "10.1107/S2059798322009184", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDPT4/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "A round-robin approach provides a detailed assessment of biomolecular small-angle scattering data reproducibility and yields consensus curves for benchmarking" }, { "conditions": { "applied_force_pn": null, "buffer": "50 mM sodium citrate, 150 mM NaCl", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 3.8 nm.", "ph": 4.5, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDPV4/", "evidence_id": "EV-SASBDB-SASDPV4", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.052, "unit": "nm", "value": 1.244 }, "provenance": { "deposit_id": "SASDPV4", "doi": "10.1107/S2059798322009184", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDPV4/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "A round-robin approach provides a detailed assessment of biomolecular small-angle scattering data reproducibility and yields consensus curves for benchmarking" }, { "conditions": { "applied_force_pn": null, "buffer": "50 mM sodium citrate, 150 mM NaCl", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 4.8 nm.", "ph": 4.5, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDPZ4/", "evidence_id": "EV-SASBDB-SASDPZ4", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.012, "unit": "nm", "value": 1.428 }, "provenance": { "deposit_id": "SASDPZ4", "doi": "10.1107/S2059798322009184", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDPZ4/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "A round-robin approach provides a detailed assessment of biomolecular small-angle scattering data reproducibility and yields consensus curves for benchmarking" }, { "conditions": { "applied_force_pn": null, "buffer": "40 mM sodium acetate, 50 mM NaCl", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 4.64 nm.", "ph": 4.0, "salt_mM": null, "temperature_c": 10.0 }, "construct": { "description": "Lysozyme C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDRM8/", "evidence_id": "EV-SASBDB-SASDRM8", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.148, "unit": "nm", "value": 1.35 }, "provenance": { "deposit_id": "SASDRM8", "doi": null, "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDRM8/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "NSRRC TPS13A standard protein archive" }, { "conditions": { "applied_force_pn": null, "buffer": "1 mol% ethylammonium nitrate", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 6.2 nm.", "ph": 8.0, "salt_mM": null, "temperature_c": 25.0 }, "construct": { "description": "Lysozyme C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDSM9/", "evidence_id": "EV-SASBDB-SASDSM9", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.258, "unit": "nm", "value": 1.604 }, "provenance": { "deposit_id": "SASDSM9", "doi": "10.1016/j.cis.2024.103242", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDSM9/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Scattering approaches to unravel protein solution behaviors in ionic liquids and deep eutectic solvents: From basic principles to recent developments" }, { "conditions": { "applied_force_pn": null, "buffer": "1 mol% ethylammonium nitrate", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 6.2 nm.", "ph": 8.0, "salt_mM": null, "temperature_c": 25.0 }, "construct": { "description": "Lysozyme C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDSN9/", "evidence_id": "EV-SASBDB-SASDSN9", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.191, "unit": "nm", "value": 1.611 }, "provenance": { "deposit_id": "SASDSN9", "doi": "10.1016/j.cis.2024.103242", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDSN9/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Scattering approaches to unravel protein solution behaviors in ionic liquids and deep eutectic solvents: From basic principles to recent developments" }, { "conditions": { "applied_force_pn": null, "buffer": "1 mol% ethylammonium nitrate", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 6.2 nm.", "ph": 8.0, "salt_mM": null, "temperature_c": 25.0 }, "construct": { "description": "Lysozyme C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDSP9/", "evidence_id": "EV-SASBDB-SASDSP9", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.166, "unit": "nm", "value": 1.588 }, "provenance": { "deposit_id": "SASDSP9", "doi": "10.1016/j.cis.2024.103242", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDSP9/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Scattering approaches to unravel protein solution behaviors in ionic liquids and deep eutectic solvents: From basic principles to recent developments" }, { "conditions": { "applied_force_pn": null, "buffer": "50 mM sodium citrate, 150 mM NaCl", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 4.69 nm.", "ph": 4.5, "salt_mM": null, "temperature_c": null }, "construct": { "description": "Lysozyme C", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDUE4/", "evidence_id": "EV-SASBDB-SASDUE4", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.017, "unit": "nm", "value": 1.453 }, "provenance": { "deposit_id": "SASDUE4", "doi": "10.1107/S205225252400486X", "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDUE4/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Benchmarking predictive methods for small-angle X-ray scattering from atomic coordinates of proteins using maximum likelihood consensus data" }, { "conditions": { "applied_force_pn": null, "buffer": "20 mM HEPES, 150 mM NaCl", "environment": "in_vitro", "ions": [], "ligands": [], "notes": "Other molecules in the sample are listed as partners; Rg is of the whole sample. Dmax 59 nm.", "ph": 7.4, "salt_mM": null, "temperature_c": 15.0 }, "construct": { "description": "Hen egg white lysozyme", "labels": [] }, "data_format": "scattering curve", "data_level": "processed", "data_link": "https://www.sasbdb.org/data/SASDYJ2/", "evidence_id": "EV-SASBDB-SASDYJ2", "mappings": [ { "confidence": "low", "justification": "SAXS of the protein alone in solution under native conditions; samples with partners and denatured samples are excluded.", "rule": "hewl-saxs-native", "state_id": "HEWL-native", "who": "rule:hewl-saxs-native" } ], "molecule_id": "P00698", "observable": { "type": "radius_of_gyration", "uncertainty": 0.022, "unit": "nm", "value": 1.581 }, "provenance": { "deposit_id": "SASDYJ2", "doi": null, "licence": "CC BY 4.0 (verify)", "retrieved": "2026-10-19", "source": "SASBDB", "url": "https://www.sasbdb.org/data/SASDYJ2/" }, "reader": null, "source_kind": "deposit", "technique": "saxs_sans", "title": "Lysozyme pH 7.4 with models" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_silico", "ions": [], "ligands": [], "notes": "Computed prediction; no experimental conditions.", "ph": null, "salt_mM": null, "temperature_c": null }, "construct": { "description": "AlphaFold Monomer v2.0 pipeline, residues 1-147", "labels": [] }, "data_format": "mmCIF, PAE JSON", "data_level": "processed", "data_link": "https://alphafold.ebi.ac.uk/entry/P00698", "evidence_id": "EV-AFDB-AF-P00698-F1", "mappings": [ { "confidence": "low", "justification": "AlphaFold prediction of the native fold (prediction, not a measurement).", "rule": "hewl-af-native", "state_id": "HEWL-native", "who": "rule:hewl-af-native" } ], "molecule_id": "P00698", "observable": { "type": "plddt", "uncertainty": null, "unit": "pLDDT", "value": 93.88 }, "provenance": { "deposit_id": "AF-P00698-F1", "doi": null, "licence": "CC BY 4.0", "retrieved": "2026-10-19", "source": "AlphaFold DB", "url": "https://alphafold.ebi.ac.uk/entry/P00698" }, "reader": null, "source_kind": "computed", "technique": "af_prediction", "title": "AlphaFold DB prediction AF-P00698-F1" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_silico", "ions": [], "ligands": [], "notes": "Simulation; temperature is the thermostat setting.", "ph": null, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "start 1E8L; Amber Parm99", "labels": [] }, "data_format": "trajectory", "data_level": "processed", "data_link": "https://mmb.mddbr.eu/#/id/A00CM/overview", "evidence_id": "EV-MDDB-A00CM", "mappings": [ { "confidence": "low", "justification": "Simulation started from a native structure (prediction).", "rule": "hewl-md-native", "state_id": "HEWL-native", "who": "rule:hewl-md-native" } ], "molecule_id": "P00698", "observable": { "type": "trajectory", "uncertainty": null, "unit": "ns", "value": 10.0 }, "provenance": { "deposit_id": "A00CM", "doi": "10.1016/j.str.2010.07.013", "licence": "This trajectory dataset is released under a Creative Commons Attribution 4.0 International Public License", "retrieved": "2026-10-19", "source": "MDDB", "url": "https://mmb.mddbr.eu/#/id/A00CM/overview" }, "reader": null, "source_kind": "computed", "technique": "md", "title": "MoDEL 1E8L" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_silico", "ions": [], "ligands": [], "notes": "Simulation; temperature is the thermostat setting.", "ph": null, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "start 1LYS; Amber Parm99", "labels": [] }, "data_format": "trajectory", "data_level": "processed", "data_link": "https://mmb.mddbr.eu/#/id/A00O8/overview", "evidence_id": "EV-MDDB-A00O8", "mappings": [ { "confidence": "low", "justification": "Simulation started from a native structure (prediction).", "rule": "hewl-md-native", "state_id": "HEWL-native", "who": "rule:hewl-md-native" } ], "molecule_id": "P00698", "observable": { "type": "trajectory", "uncertainty": null, "unit": "ns", "value": 10.0 }, "provenance": { "deposit_id": "A00O8", "doi": "10.1016/j.str.2010.07.013", "licence": "This trajectory dataset is released under a Creative Commons Attribution 4.0 International Public License", "retrieved": "2026-10-19", "source": "MDDB", "url": "https://mmb.mddbr.eu/#/id/A00O8/overview" }, "reader": null, "source_kind": "computed", "technique": "md", "title": "MoDEL 1LYS" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_silico", "ions": [], "ligands": [], "notes": "Simulation; temperature is the thermostat setting.", "ph": null, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "start 1LSY; Amber Parm99", "labels": [] }, "data_format": "trajectory", "data_level": "processed", "data_link": "https://mmb.mddbr.eu/#/id/A00OV/overview", "evidence_id": "EV-MDDB-A00OV", "mappings": [ { "confidence": "low", "justification": "Simulation started from a native structure (prediction).", "rule": "hewl-md-native", "state_id": "HEWL-native", "who": "rule:hewl-md-native" } ], "molecule_id": "P00698", "observable": { "type": "trajectory", "uncertainty": null, "unit": "ns", "value": 10.0 }, "provenance": { "deposit_id": "A00OV", "doi": "10.1016/j.str.2010.07.013", "licence": "This trajectory dataset is released under a Creative Commons Attribution 4.0 International Public License", "retrieved": "2026-10-19", "source": "MDDB", "url": "https://mmb.mddbr.eu/#/id/A00OV/overview" }, "reader": null, "source_kind": "computed", "technique": "md", "title": "MoDEL 1LSY" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_silico", "ions": [], "ligands": [], "notes": "Simulation; temperature is the thermostat setting.", "ph": null, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "start 3LZT; Amber Parm99", "labels": [] }, "data_format": "trajectory", "data_level": "processed", "data_link": "https://mmb.mddbr.eu/#/id/A00P5/overview", "evidence_id": "EV-MDDB-A00P5", "mappings": [ { "confidence": "low", "justification": "Simulation started from a native structure (prediction).", "rule": "hewl-md-native", "state_id": "HEWL-native", "who": "rule:hewl-md-native" } ], "molecule_id": "P00698", "observable": { "type": "trajectory", "uncertainty": null, "unit": "ns", "value": 10.0 }, "provenance": { "deposit_id": "A00P5", "doi": "10.1016/j.str.2010.07.013", "licence": "This trajectory dataset is released under a Creative Commons Attribution 4.0 International Public License", "retrieved": "2026-10-19", "source": "MDDB", "url": "https://mmb.mddbr.eu/#/id/A00P5/overview" }, "reader": null, "source_kind": "computed", "technique": "md", "title": "MoDEL 3LZT" }, { "conditions": { "applied_force_pn": null, "buffer": null, "environment": "in_silico", "ions": [], "ligands": [], "notes": "Simulation; temperature is the thermostat setting.", "ph": null, "salt_mM": null, "temperature_c": 26.85 }, "construct": { "description": "start 2VB1; Amber Parm99", "labels": [] }, "data_format": "trajectory", "data_level": "processed", "data_link": "https://mmb.mddbr.eu/#/id/A014O/overview", "evidence_id": "EV-MDDB-A014O", "mappings": [ { "confidence": "low", "justification": "Simulation started from a native structure (prediction).", "rule": "hewl-md-native", "state_id": "HEWL-native", "who": "rule:hewl-md-native" } ], "molecule_id": "P00698", "observable": { "type": "trajectory", "uncertainty": null, "unit": "ns", "value": 10.0 }, "provenance": { "deposit_id": "A014O", "doi": "10.1016/j.str.2010.07.013", "licence": "This trajectory dataset is released under a Creative Commons Attribution 4.0 International Public License", "retrieved": "2026-10-19", "source": "MDDB", "url": "https://mmb.mddbr.eu/#/id/A014O/overview" }, "reader": null, "source_kind": "computed", "technique": "md", "title": "MoDEL 2VB1" } ], "models": [ { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-193L-1" ], "file": "models/P00698/HEWL-native.cif", "format": "mmCIF", "model_id": "HEWL-native-cif", "molecule_id": "P00698", "provenance": { "deposit_id": "193L", "doi": "10.1107/S090744499501674X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/193L.cif" }, "state_id": "HEWL-native" }, { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-193L-1" ], "file": "models/P00698/HEWL-native.pdb", "format": "PDB", "model_id": "HEWL-native-pdb", "molecule_id": "P00698", "provenance": { "deposit_id": "193L", "doi": "10.1107/S090744499501674X", "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/193L.pdb" }, "state_id": "HEWL-native" }, { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-9J0L-1" ], "file": "models/P00698/HEWL-fibril.cif", "format": "mmCIF", "model_id": "HEWL-fibril-cif", "molecule_id": "P00698", "provenance": { "deposit_id": "9J0L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/9J0L.cif" }, "state_id": "HEWL-fibril" }, { "assumptions": null, "basis": "observed", "constraints_used": [ "EV-PDB-9J0L-1" ], "file": "models/P00698/HEWL-fibril.pdb", "format": "PDB", "model_id": "HEWL-fibril-pdb", "molecule_id": "P00698", "provenance": { "deposit_id": "9J0L", "doi": null, "licence": "CC0 1.0 (wwPDB archive data)", "retrieved": "2026-10-19", "source": "RCSB PDB", "url": "https://files.rcsb.org/download/9J0L.pdb" }, "state_id": "HEWL-fibril" } ], "molecule": { "components": [], "domains": [ { "end": 147, "name": "C-type lysozyme", "start": 19 } ], "gene": "LYZ", "identifiers": { "genbank": null, "isoform": null, "nakb": null, "pdb": [], "rfam": null, "rnacentral": null, "uniprot": "P00698" }, "ligands": [ "substrate" ], "modifications": [], "molecule_id": "P00698", "molecule_type": "protein", "name": "Lysozyme C", "organism": { "name": "Gallus gallus", "taxon_id": 9031 }, "provenance": { "deposit_id": "P00698", "doi": null, "licence": "CC BY 4.0 (UniProt)", "retrieved": "2026-10-19", "source": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P00698/entry" }, "sequence": "MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL", "sequence_length": 147 }, "molecule_id": "P00698", "states": [ { "assumptions": [], "basis": "observed", "description": "Native fold of hen lysozyme, as in 193L (tetragonal, 1.33 Å).", "family_label": null, "molecule_id": "P00698", "name": "native fold", "parent_state": null, "population": null, "provenance": { "deposit_id": null, "doi": null, "licence": "Project licence (pending decision)", "retrieved": "2026-10-19", "source": "Conformome curation (P00698.yaml)", "url": "https://github.com/matth55/conformome/blob/HEAD/curation/P00698.yaml" }, "representative_model": "HEWL-native-cif", "secondary_structure": null, "state_id": "HEWL-native", "status": "draft" }, { "assumptions": [ "Treated as a single ensemble; residual structure and intermediates are not resolved.", "Defined by indirect measurements (denaturation, NMR of denatured samples, force spectroscopy); no model is exported." ], "basis": "inferred", "description": "Unfolded ensemble reached by denaturant, temperature or force. No observed structure.", "family_label": null, "molecule_id": "P00698", "name": "unfolded", "parent_state": null, "population": null, "provenance": { "deposit_id": null, "doi": null, "licence": "Project licence (pending decision)", "retrieved": "2026-10-19", "source": "Conformome curation (P00698.yaml)", "url": "https://github.com/matth55/conformome/blob/HEAD/curation/P00698.yaml" }, "representative_model": null, "secondary_structure": null, "state_id": "HEWL-unfolded", "status": "draft" }, { "assumptions": [], "basis": "observed", "description": "Cross-beta amyloid fibril of hen lysozyme, as in 9J0L (type 1 fibril, cryo-EM, 2.29 Å). Types 1 and 2 (9J0M) and the heat-irreversible fibril (8QV8) are polymorphs and are pooled in this one state.", "family_label": null, "molecule_id": "P00698", "name": "amyloid fibril", "parent_state": null, "population": null, "provenance": { "deposit_id": null, "doi": null, "licence": "Project licence (pending decision)", "retrieved": "2026-10-19", "source": "Conformome curation (P00698.yaml)", "url": "https://github.com/matth55/conformome/blob/HEAD/curation/P00698.yaml" }, "representative_model": "HEWL-fibril-cif", "secondary_structure": null, "state_id": "HEWL-fibril", "status": "draft" } ], "transitions": [] }